Status Report of Simulated Space Radiation Environment Facility

International Nuclear Information System (INIS)

Kang, Phil Hyun; Nho, Young Chang; Jeun, Joon Pyo; Choi, Jae Hak; Lim, Youn Mook; Jung, Chan Hee; Jeon, Young Kyu

2007-11-01

The technology for performance testing and improvement of materials which are durable at space environment is a military related technology and veiled and securely regulated in advanced countries such as US and Russia. This core technology cannot be easily transferred to other country too. Therefore, this technology is the most fundamental and necessary research area for the successful establishment of space environment system. Since the task for evaluating the effects of space materials and components by space radiation plays important role in satellite lifetime extension and running failure percentage decrease, it is necessary to establish simulated space radiation facility and systematic testing procedure. This report has dealt with the status of the technology to enable the simulation of space environment effects, including the effect of space radiation on space materials. This information such as the fundamental knowledge of space environment and research status of various countries as to the simulation of space environment effects of space materials will be useful for the research on radiation hardiness of the materials. Furthermore, it will be helpful for developer of space material on deriving a better choice of materials, reducing the design cycle time, and improving safety

Space plasma observations - observations of solar-terrestrial environment. Space Weather Forecast

International Nuclear Information System (INIS)

Sagawa, Eiichi; Akioka, Maki

1996-01-01

The space environment becomes more important than ever before because of the expansion in the utilization of near-earth space and the increase in the vulnerability of large scale systems on the ground such as electrical power grids. The concept of the Space Weather Forecast program emerged from the accumulation of understanding on basic physical processes and from our activities as one of the regional warning centers of the international network of space environment services. (author)

Space Environments and Spacecraft Effects Organization Concept

Science.gov (United States)

Edwards, David L.; Burns, Howard D.; Miller, Sharon K.; Porter, Ron; Schneider, Todd A.; Spann, James F.; Xapsos, Michael

2012-01-01

The National Aeronautics and Space Administration (NASA) is embarking on a course to expand human presence beyond Low Earth Orbit (LEO) while also expanding its mission to explore the solar system. Destinations such as Near Earth Asteroids (NEA), Mars and its moons, and the outer planets are but a few of the mission targets. Each new destination presents an opportunity to increase our knowledge of the solar system and the unique environments for each mission target. NASA has multiple technical and science discipline areas specializing in specific space environments disciplines that will help serve to enable these missions. To complement these existing discipline areas, a concept is presented focusing on the development of a space environments and spacecraft effects (SENSE) organization. This SENSE organization includes disciplines such as space climate, space weather, natural and induced space environments, effects on spacecraft materials and systems and the transition of research information into application. This space environment and spacecraft effects organization will be composed of Technical Working Groups (TWG). These technical working groups will survey customers and users, generate products, and provide knowledge supporting four functional areas: design environments, engineering effects, operational support, and programmatic support. The four functional areas align with phases in the program mission lifecycle and are briefly described below. Design environments are used primarily in the mission concept and design phases of a program. Engineering effects focuses on the material, component, sub-system and system-level selection and the testing to verify design and operational performance. Operational support provides products based on real time or near real time space weather to mission operators to aid in real time and near-term decision-making. The programmatic support function maintains an interface with the numerous programs within NASA, other federal

Radiation environment in space

International Nuclear Information System (INIS)

Goka, Tateo; Koga, Kiyokazu; Matsumoto, Haruhisa; Komiyama, Tatsuo; Yasuda, Hiroshi

2011-01-01

Japanese Experiment Module (Kibo) had been build into the International Space Station (ISS), which is a multipurpose manned facility and laboratory and is operated in orbit at about 400 km in altitude. Two Japanese astronauts stayed in the ISS for long time (4.5 and 5.5 months) for the first time. Space radiation exposure is one of the biggest safety issues for astronauts to stay for such a long duration in space. This special paper is presenting commentary on space radiation environment in ISS, neutrons measurements and light particles (protons and electrons) measurements, the instruments, radiation exposure management for Japanese astronauts and some comments in view of health physics. (author)

Space environments and their effects on space automation and robotics

Science.gov (United States)

Garrett, Henry B.

1990-01-01

Automated and robotic systems will be exposed to a variety of environmental anomalies as a result of adverse interactions with the space environment. As an example, the coupling of electrical transients into control systems, due to EMI from plasma interactions and solar array arcing, may cause spurious commands that could be difficult to detect and correct in time to prevent damage during critical operations. Spacecraft glow and space debris could introduce false imaging information into optical sensor systems. The presentation provides a brief overview of the primary environments (plasma, neutral atmosphere, magnetic and electric fields, and solid particulates) that cause such adverse interactions. The descriptions, while brief, are intended to provide a basis for the other papers presented at this conference which detail the key interactions with automated and robotic systems. Given the growing complexity and sensitivity of automated and robotic space systems, an understanding of adverse space environments will be crucial to mitigating their effects.

Space Weather, Environment and Societies

CERN Document Server

Lilensten, Jean

2006-01-01

Our planet exists within a space environment affected by constantly changing solar atmosphere producing cosmic particles and electromagnetic waves. This "space weather" profoundly influences the performance of our technology because we primarily use two means for transmitting information and energy; namely, electromagnetic waves and electricity. On an everyday basis, we have developed methods to cope with the normal conditions. However, the sun remains a fiery star whose 'angry' outbursts can potentially destroy spacecrafts, kill astronauts, melt electricity transformers, stop trains, and generally wreak havoc with human activities. Space Weather is the developing field within astronomy that aims at predicting the sun’s violent activity and minimizing the impacts on our daily lives. Space Weather, Environment, and Societies explains why our technological societies are so dependent on solar activity and how the Sun disturbs the transmission of information and energy. Footnotes expand specific points and the ...

International Space Station External Contamination Environment for Space Science Utilization

Science.gov (United States)

Soares, Carlos E.; Mikatarian, Ronald R.; Steagall, Courtney A.; Huang, Alvin Y.; Koontz, Steven; Worthy, Erica

2014-01-01

The International Space Station (ISS) is the largest and most complex on-orbit platform for space science utilization in low Earth orbit. Multiple sites for external payloads, with exposure to the associated natural and induced environments, are available to support a variety of space science utilization objectives. Contamination is one of the induced environments that can impact performance, mission success and science utilization on the vehicle. The ISS has been designed, built and integrated with strict contamination requirements to provide low levels of induced contamination on external payload assets. This paper addresses the ISS induced contamination environment at attached payload sites, both at the requirements level as well as measurements made on returned hardware, and contamination forecasting maps being generated to support external payload topology studies and science utilization.

Space radiation environment

International Nuclear Information System (INIS)

Garrett, H.B.

1998-01-01

Coupled with the increasing concern over trapped radiation effects on microelectronics, the availability of new data, long term changes in the Earth's magnetic field, and observed variations in the trapped radiation fluxes have generated the need for better, more comprehensive tools for modeling and predicting the Earth's trapped radiation environment and its effects on space systems. The objective of this report is to describe the current status of those efforts and review methods for attacking the issues associated with modeling the trapped radiation environment in a systematic, practical fashion. The ultimate goal will be to point the way to increasingly better methods of testing, designing, and flying reliable microelectronic systems in the Earth's radiation environment. The review will include a description of the principal models of the trapped radiation environment currently available--the AE8 and AP8 models. Recent results rom radiation experiments on spacecraft such as CRRES, SAMPEX, and CLEMENTINE will then be described. (author)

Space Weather Monitoring for ISS Space Environments Engineering and Crew Auroral Observations

Science.gov (United States)

Minow, Joseph I.; Pettit, Donald R.; Hartman, William A.

2012-01-01

The awareness of potentially significant impacts of space weather on spaceand ground ]based technological systems has generated a strong desire in many sectors of government and industry to effectively transform knowledge and understanding of the variable space environment into useful tools and applications for use by those entities responsible for systems that may be vulnerable to space weather impacts. Essentially, effectively transitioning science knowledge to useful applications relevant to space weather has become important. This talk will present proven methodologies that have been demonstrated to be effective, and how in the current environment those can be applied to space weather transition efforts.

Mutagenic effects of space environment and protons on rice

International Nuclear Information System (INIS)

Wang Cailian; Chen Qiufang; Shen Mei

1998-07-01

Dry seeds of 5 rice varieties were carried by recoverable satellite for space mutation, and were irradiated by 4∼8 MeV protons with various doses. The mutagenic effects was studied. The results indicated that the space environment could cause chromosomal structure aberration and had stimulating mitosis action in root tip cells. As compared with γ-rays and protons, the effects of space environment flight were lower on chromosomal aberration but were significantly higher on mitosis index. Space environment and protons induce high frequency of chlorophyll deficient mutation and mutation in plant height and heading date in M 2 generation. Frequency of beneficial mutation induced by space environment and protons were higher than those induced by γ-rays

Space environment effects on polymers in low earth orbit

International Nuclear Information System (INIS)

Grossman, E.; Gouzman, I.

2003-01-01

Polymers are widely used in space vehicles and systems as structural materials, thermal blankets, thermal control coatings, conformal coatings, adhesives, lubricants, etc. The low earth orbit (LEO) space environment includes hazards such as atomic oxygen, UV radiation, ionizing radiation (electrons, protons), high vacuum, plasma, micrometeoroids and debris, as well as severe temperature cycles. Exposure of polymers and composites to the space environment may result in different detrimental effects via modification of their chemical, electrical, thermal, optical and mechanical properties as well as surface erosion. The high vacuum induces material outgassing (e.g. low-molecular weight residues, plasticizers and additives) and consequent contamination of nearby surfaces. The present work reviews the LEO space environment constituents and their interactions with polymers. Examples of degradation of materials exposed in ground simulation facilities are presented. The issues discussed include the erosion mechanisms of polymers, formation of contaminants and their interaction with the space environment, and protection of materials from the harsh space environment

The Near-Earth Space Radiation Environment

Science.gov (United States)

Xapsos, Michael

2008-01-01

This viewgraph presentation reviews the effects of the Near-Earth space radiation environment on NASA missions. Included in this presentation is a review of The Earth s Trapped Radiation Environment, Solar Particle Events, Galactic Cosmic Rays and Comparison to Accelerator Facilities.

Advanced Engineering Environments for Space Transportation System Development

Science.gov (United States)

Thomas, L. Dale; Smith, Charles A.; Beveridge, James

2000-01-01

There are significant challenges facing today's launch vehicle industry. Global competition, more complex products, geographically-distributed design teams, demands for lower cost, higher reliability and safer vehicles, and the need to incorporate the latest technologies quicker, all face the developer of a space transportation system. Within NASA, multiple technology development and demonstration projects are underway toward the objectives of safe, reliable, and affordable access to space. New information technologies offer promising opportunities to develop advanced engineering environments to meet these challenges. Significant advances in the state-of-the-art of aerospace engineering practice are envisioned in the areas of engineering design and analytical tools, cost and risk tools, collaborative engineering, and high-fidelity simulations early in the development cycle. At the Marshall Space Flight Center, work has begun on development of an advanced engineering environment specifically to support the design, modeling, and analysis of space transportation systems. This paper will give an overview of the challenges of developing space transportation systems in today's environment and subsequently discuss the advanced engineering environment and its anticipated benefits.

Lead-Free Experiment in a Space Environment

Science.gov (United States)

Blanche, J. F.; Strickland, S. M.

2012-01-01

This Technical Memorandum addresses the Lead-Free Technology Experiment in Space Environment that flew as part of the seventh Materials International Space Station Experiment outside the International Space Station for approximately 18 months. Its intent was to provide data on the performance of lead-free electronics in an actual space environment. Its postflight condition is compared to the preflight condition as well as to the condition of an identical package operating in parallel in the laboratory. Some tin whisker growth was seen on a flight board but the whiskers were few and short. There were no solder joint failures, no tin pest formation, and no significant intermetallic compound formation or growth on either the flight or ground units.

11th International Space Conference on Protection of Materials and Structures from Space Environment

CERN Document Server

2017-01-01

The proceedings published in this book document and foster the goals of the 11th International Space Conference on “Protection of Materials and Structures from Space Environment” ICPMSE-11 to facilitate exchanges between members of the various engineering and science disciplines involved in the development of space materials. Contributions cover aspects of interaction with space environment of LEO, GEO, Deep Space, Planetary environments, ground-based qualification and in-flight experiments, as well as lessons learned from operational vehicles that are closely interrelated to disciplines of atmospheric sciences, solar-terrestrial interactions and space life sciences.

Space Environment Testing of Photovoltaic Array Systems at NASA's Marshall Space Flight Center

Science.gov (United States)

Phillips, Brandon S.; Schneider, Todd A.; Vaughn, Jason A.; Wright, Kenneth H., Jr.

2015-01-01

To successfully operate a photovoltaic (PV) array system in space requires planning and testing to account for the effects of the space environment. It is critical to understand space environment interactions not only on the PV components, but also the array substrate materials, wiring harnesses, connectors, and protection circuitry (e.g. blocking diodes). Key elements of the space environment which must be accounted for in a PV system design include: Solar Photon Radiation, Charged Particle Radiation, Plasma, and Thermal Cycling. While solar photon radiation is central to generating power in PV systems, the complete spectrum includes short wavelength ultraviolet components, which photo-ionize materials, as well as long wavelength infrared which heat materials. High energy electron radiation has been demonstrated to significantly reduce the output power of III-V type PV cells; and proton radiation damages material surfaces - often impacting coverglasses and antireflective coatings. Plasma environments influence electrostatic charging of PV array materials, and must be understood to ensure that long duration arcs do not form and potentially destroy PV cells. Thermal cycling impacts all components on a PV array by inducing stresses due to thermal expansion and contraction. Given such demanding environments, and the complexity of structures and materials that form a PV array system, mission success can only be ensured through realistic testing in the laboratory. NASA's Marshall Space Flight Center has developed a broad space environment test capability to allow PV array designers and manufacturers to verify their system's integrity and avoid costly on-orbit failures. The Marshall Space Flight Center test capabilities are available to government, commercial, and university customers. Test solutions are tailored to meet the customer's needs, and can include performance assessments, such as flash testing in the case of PV cells.

The ionizing radiation environment in space and its effects

International Nuclear Information System (INIS)

Adams, Jim; Falconer, David; Fry, Dan

2012-01-01

The ionizing radiation environment in space poses a hazard for spacecraft and space crews. The hazardous components of this environment are reviewed and those which contribute to radiation hazards and effects identified. Avoiding the adverse effects of space radiation requires design, planning, monitoring and management. Radiation effects on spacecraft are avoided largely though spacecraft design. Managing radiation exposures of space crews involves not only protective spacecraft design and careful mission planning. Exposures must be managed in real time. The now-casting and forecasting needed to effectively manage crew exposures is presented. The techniques used and the space environment modeling needed to implement these techniques are discussed.

Solar/Space Environment Data (Satellites)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The National Oceanic and Atmospheric Administration (NOAA) monitors the geospace and solar environments using a variety of space weather sensors aboard its fleet of...

Overview of fiber optics in the natural space environment

International Nuclear Information System (INIS)

Barnes, C.; Dorsky, L.; Johnston, A.; Bergman, L.; Stassinopoulos, E.

1991-01-01

The potential applications of fiber-optic (FO) systems in spacecraft which will be exposed to the space radiation environment are discussed in view of tests conducted aboard the Long-Duration Exposure Facility and the Comet Rendezvous and Asteroid Flyby spacecraft. Attention is given to anticipated trends in the use of FO in spacecraft communications systems. The natural space radiation environment is noted to be far more benign than the military space environment, which encompasses displacement-damage effects due to significant neutron influences

The Orbital Space Environment and Space Situational Awareness Domain Ontology - Toward an International Information System for Space Data

Science.gov (United States)

Rovetto, R.

2016-09-01

The orbital space environment is home to natural and artificial satellites, debris, and space weather phenomena. As the population of orbital objects grows so do the potential hazards to astronauts, space infrastructure and spaceflight capability. Orbital debris, in particular, is a universal concern. This and other hazards can be minimized by improving global space situational awareness (SSA). By sharing more data and increasing observational coverage of the space environment we stand to achieve that goal, thereby making spaceflight safer and expanding our knowledge of near-Earth space. To facilitate data-sharing interoperability among distinct orbital debris and space object catalogs, and SSA information systems, I proposed ontology in (Rovetto, 2015) and (Rovetto and Kelso, 2016). I continue this effort toward formal representations and models of the overall domain that may serve to improve peaceful SSA and increase our scientific knowledge. This paper explains the project concept introduced in those publications, summarizing efforts to date as well as the research field of ontology development and engineering. I describe concepts for an ontological framework for the orbital space environment, near-Earth space environment and SSA domain. An ontological framework is conceived as a part of a potential international information system. The purpose of such a system is to consolidate, analyze and reason over various sources and types of orbital and SSA data toward the mutually beneficial goals of safer space navigation and scientific research. Recent internationals findings on the limitations of orbital data, in addition to existing publications on collaborative SSA, demonstrate both the overlap with this project and the need for datasharing and integration.

Environment monitoring from space

International Nuclear Information System (INIS)

Takagi, M.

1994-01-01

Environmental problems such as acid rain, ozone depletion, deforestation, erosion, and the greenhouse effect are of increasing concern, and continuous earth observation from artificial satellites has been contributing significant information on the environment since the 1960s. Earth observation from space has the advantages of wide area coverage at potentially high resolutions, periodic and long-term observation capability, data acquisition with uniform quality and repeatability, and ability to observe using different types of sensors. Problems to be solved in earth observation include the need for preprocessing of satellite data, understanding the relationship between observed physical parameters and objects, and the high volume of data for processing. In Japan, a research project on the higher-order utilization of remote sensing data from space was organized in 1985, and the results led to recognition of the importance of satellite observation. It was then decided to undertake a program to improve the understanding of the earth environment by satellite. Five research plans were selected: a basic study on earth observation by microwaves; global change analysis of the biosphere; a study of the physical process of the water cycle over land; a study of air-sea interaction; and higher-order processing of earth observation information. In recognition of the international nature of satellite data, as well as the capabilities of Canada and Japan in computer, communication, and multimedia technologies, bilateral cooperation is proposed in the area of earth environment information systems based on satellite observation

ISS External Contamination Environment for Space Science Utilization

Science.gov (United States)

Soares, Carlos; Mikatarian, Ron; Steagall, Courtney; Huang, Alvin; Koontz, Steven; Worthy, Erica

2014-01-01

(1) The International Space Station is the largest and most complex on-orbit platform for space science utilization in low Earth orbit, (2) Multiple sites for external payloads, with exposure to the associated natural and induced environments, are available to support a variety of space science utilization objectives, (3) Contamination is one of the induced environments that can impact performance, mission success and science utilization on the vehicle, and (4)The ISS has been designed, built and integrated with strict contamination requirements to provide low levels of induced contamination on external payload assets.

Space Analogue Environments: Are the Populations Comparable?

Science.gov (United States)

Sandal, G. M.

Background: Much of our present understanding about psychology in space is based on studies of groups operating in so-called analogue environments where personnel are exposed to many of the same stressors as those experienced by astronauts in space. One possible problem with extrapolating results is that personnel operating in various hazardous and confined environments might differ in characteristics influencing coping, interaction, and performance. The object of this study was to compare the psychological similarity of these populations in order to get a better understanding of whether this extrapolation is justifiable. The samples investigated include polar crossings (N= 22), personnel on Antarctic research stations (N= 183), several military occupations (N= 187), and participants in space simulation studies (N=20). Methods: Personnel in each of these environments were assessed using the Personality Characteristic Inventory (PCI) and Utrecht Coping List (UCL). The PCI is a multidimensional trait assessment battery that measures various aspects of achievement orientation and social competence. The UCL is a questionnaire designed to assess habitual coping strategies when encountering stressful or demanding situations. Results: Only minor differences in use of habitual coping strategies were evident across the different samples. In relation to personality scores, the military subjects and participants in space simulation studies indicated higher competitiveness and negative instrumentality compared to both the personnel on Antarctic research stations and participants in polar expedition. Among the personnel on Antarctic research stations, significant gender differences were found with women scoring lower on competitiveness, negative instrumentality and impatience/irritability. Compared to the other samples, the participants in polar expeditions were found to be more homogeneous in personality and no significant gender differences were evident on the traits that

Research on the Design of Public Space Environment for Aging Society

Science.gov (United States)

Fang, Gu; Soo, Kim Chul

2018-03-01

This paper studies the living space environment suitable for the elderly, because the elderly and the disabled have become increasingly prominent social problems. Through the discussion of the humanistic environment design method of the elderly and the disabled, the paper puts forward a new environment design which has the traditional characteristics and adapts to the new society to care for the elderly (the disabled).By studying and analyzing the background of social aging, the theory of public space environment design and the needs of the elderly, it is pointed out that the design of public space environment in the aged society needs to be implemented in detail design. The number of elderly people in public space will increase, give full attention to the public space outdoor environment quality, for the elderly to provide a variety of environmental facilities have long-term significance.

Space Environments and Effects Concept: Transitioning Research to Operations and Applications

Science.gov (United States)

Edwards, David L.; Spann, James; Burns, Howard D.; Schumacher, Dan

2012-01-01

The National Aeronautics and Space Administration (NASA) is embarking on a course to expand human presence beyond Low Earth Orbit (LEO) while expanding its mission to explore the solar system. Destinations such as Near Earth Asteroids (NEA), Mars and its moons, and the outer planets are but a few of the mission targets. NASA has established numerous offices specializing in specific space environments disciplines that will serve to enable these missions. To complement these existing discipline offices, a concept focusing on the development of space environment and effects application is presented. This includes space climate, space weather, and natural and induced space environments. This space environment and effects application is composed of 4 topic areas; characterization and modeling, engineering effects, prediction and operation, and mitigation and avoidance. These topic areas are briefly described below. Characterization and modeling of space environments will primarily focus on utilization during Program mission concept, planning, and design phases. Engineering effects includes materials testing and flight experiments producing data to be used in mission planning and design phases. Prediction and operation pulls data from existing sources into decision-making tools and empirical data sets to be used during the operational phase of a mission. Mitigation and avoidance will develop techniques and strategies used in the design and operations phases of the mission. The goal of this space environment and effects application is to develop decision-making tools and engineering products to support the mission phases of mission concept through operations by focusing on transitioning research to operations. Products generated by this space environments and effects application are suitable for use in anomaly investigations. This paper will outline the four topic areas, describe the need, and discuss an organizational structure for this space environments and effects

The Influence of Free Space Environment in the Mission Life Cycle: Material Selection

Science.gov (United States)

Edwards, David L.; Burns, Howard D.; de Groh, Kim K.

2014-01-01

The natural space environment has a great influence on the ability of space systems to perform according to mission design specification. Understanding the natural space environment and its influence on space system performance is critical to the concept formulation, design, development, and operation of space systems. Compatibility with the natural space environment is a primary factor in determining the functional lifetime of the space system. Space systems being designed and developed today are growing in complexity. In many instances, the increased complexity also increases its sensitivity to space environmental effects. Sensitivities to the natural space environment can be tempered through appropriate design measures, material selection, ground processing, mitigation strategies, and/or the acceptance of known risks. The design engineer must understand the effects of the natural space environment on the space system and its components. This paper will discuss the influence of the natural space environment in the mission life cycle with a specific focus on the role of material selection.

An Overview of the Space Environments and Spacecraft Effects Organization Concept

Science.gov (United States)

Edwards, David L.; Burns, Howard D.; Garrett, Henry B.; Miller, Sharon K.; Peddie, Darilyn; Porter Ron; Spann, James F.; Xapsos, Michael A.

2012-01-01

The National Aeronautics and Space Administration (NASA) is embarking on a course to expand human presence beyond Low Earth Orbit (LEO) while also expanding its mission to explore our Earth, and the solar system. Destinations such as Near Earth Asteroids (NEA), Mars and its moons, and the outer planets are but a few of the mission targets. Each new destination presents an opportunity to increase our knowledge on the solar system and the unique environments for each mission target. NASA has multiple technical and science discipline areas specializing in specific space environments fields that will serve to enable these missions. To complement these existing discipline areas, a concept is presented focusing on the development of a space environment and spacecraft effects (SESE) organization. This SESE organization includes disciplines such as space climate, space weather, natural and induced space environments, effects on spacecraft materials and systems, and the transition of research information into application. This space environment and spacecraft effects organization will be composed of Technical Working Groups (TWG). These technical working groups will survey customers and users, generate products, and provide knowledge supporting four functional areas: design environments, engineering effects, operational support, and programmatic support. The four functional areas align with phases in the program mission lifecycle and are briefly described below. Design environments are used primarily in the mission concept and design phases of a program. Environment effects focuses on the material, component, sub-system, and system-level response to the space environment and include the selection and testing to verify design and operational performance. Operational support provides products based on real time or near real time space weather to mission operators to aid in real time and near-term decision-making. The programmatic support function maintains an interface with

Teamwork in high-risk environments analogous to space

Science.gov (United States)

Kanki, Barbara G.

1990-01-01

Mountaineering expeditions combine a number of factors which make them potentially good analogs to the planetary exploration facet of long-duration space missions. A study of mountain climbing teams was conducted in order to evaluate the usefulness of the environment as a space analog and to specifically identify the factors and issues surrounding teamwork and 'successful' team performance in two mountaineering environments. This paper focuses on social/organizational factors, including team size and structure, leadership styles and authority structure which were found in the sample of 22 climb teams (122 individuals). The second major issue discussed is the construction of a valid performance measure in this high-risk environment.

The Living With a Star Space Environment Testbed Program

Science.gov (United States)

Barth, Janet; LaBel, Kenneth; Day, John H. (Technical Monitor)

2001-01-01

NASA has initiated the Living with a Star (LWS) Program to develop the scientific understanding to address the aspects of the Connected Sun-Earth system that affects life and society. The Program Architecture includes science missions, theory and modeling and Space Environment Testbeds (SET). This current paper discusses the Space Environment Testbeds. The goal of the SET program is to improve the engineering approach to accomodate and/or mitigate the effects of solar variability on spacecraft design and operations. The SET Program will infuse new technologies into the space programs through collection of data in space and subsequent design and validation of technologies. Examples of these technologies are cited and discussed.

Living with a Star Space Environment Testbed

Science.gov (United States)

Barth, Janet

2003-01-01

Summary of activities: (1) FYO1 NRA - Model development and data mining. (2) FY03 NRA - Flight investigations. (3) SET carrier development. (4) Study for accommodation of SET carrier to support advanced detectors. (5) Collaboration with other programs: LWS TR&T to maximize synergy between TR&T space environment research and SET space environment effects research. LWS Data System to optimize dissemination of SET data. NASA Electronic Parts and Packaging Program to leverage ground testing of technologies. Defense Threat Reduction Agency to leverage ground testing and common interests in advanced detectors. and Air Force Research Laboratory to leverage flight opportunities. (6) Education and Public Outreach.

The Living With a Star Space Environment Testbed Experiments

Science.gov (United States)

Xapsos, Michael A.

2014-01-01

The focus of the Living With a Star (LWS) Space Environment Testbed (SET) program is to improve the performance of hardware in the space radiation environment. The program has developed a payload for the Air Force Research Laboratory (AFRL) Demonstration and Science Experiments (DSX) spacecraft that is scheduled for launch in August 2015 on the SpaceX Falcon Heavy rocket. The primary structure of DSX is an Evolved Expendable Launch Vehicle (EELV) Secondary Payload Adapter (ESPA) ring. DSX will be in a Medium Earth Orbit (MEO). This oral presentation will describe the SET payload.

A study of dynamical behavior of space environment

Science.gov (United States)

Wu, S. T.

1974-01-01

Studies have covered a wide range of problems in the space environment, such as the problems of the dynamical behavior of the thermosphere, hydromagnetic wave propagation in the ionosphere, and interplanetary space environment. The theories used to analyze these problems range from a continuum theory of magnetohydrodynamics to the kinetic theory of free molecular flow. This is because the problems encountered covered the entire range of the Knudsen number (i.e., the ratio of mean free path to the characteristic length). Significant results are summarized.

Space environment durability of beta cloth in LDEF thermal blankets

Science.gov (United States)

Linton, Roger C.; Whitaker, Ann F.; Finckenor, Miria M.

1993-01-01

Beta cloth performance for use on long-term space vehicles such as Space Station Freedom (S.S. Freedom) requires resistance to the degrading effects of the space environment. The major issues are retention of thermal insulating properties through maintaining optical properties, preserving mechanical integrity, and generating minimal particulates for contamination-sensitive spacecraft surfaces and payloads. The longest in-flight test of beta cloth's durability was on the Long Duration Exposure Facility (LDEF), where it was exposed to the space environment for 68 months. The LDEF contained 57 experiments which further defined the space environment and its effects on spacecraft materials. It was deployed into low-Earth orbit (LEO) in Apr. 1984 and retrieved Jan. 1990 by the space shuttle. Among the 10,000 plus material constituents and samples onboard were thermal control blankets of multilayer insulation with a beta cloth outer cover and Velcro attachments. These blankets were exposed to hard vacuum, thermal cycling, charged particles, meteoroid/debris impacts, ultraviolet (UV) radiation, and atomic oxygen (AO). Of these space environmental exposure elements, AO appears to have had the greatest effect on the beta cloth. The beta cloth analyzed in this report came from the MSFC Experiment S1005 (Transverse Flat-Plate Heat Pipe) tray oriented approximately 22 deg from the leading edge vector of the LDEF satellite. The location of the tray on LDEF and the placement of the beta cloth thermal blankets are shown. The specific space environment exposure conditions for this material are listed.

Modeling of space environment impact on nanostructured materials. General principles

Science.gov (United States)

Voronina, Ekaterina; Novikov, Lev

2016-07-01

In accordance with the resolution of ISO TC20/SC14 WG4/WG6 joint meeting, Technical Specification (TS) 'Modeling of space environment impact on nanostructured materials. General principles' which describes computer simulation methods of space environment impact on nanostructured materials is being prepared. Nanomaterials surpass traditional materials for space applications in many aspects due to their unique properties associated with nanoscale size of their constituents. This superiority in mechanical, thermal, electrical and optical properties will evidently inspire a wide range of applications in the next generation spacecraft intended for the long-term (~15-20 years) operation in near-Earth orbits and the automatic and manned interplanetary missions. Currently, ISO activity on developing standards concerning different issues of nanomaterials manufacturing and applications is high enough. Most such standards are related to production and characterization of nanostructures, however there is no ISO documents concerning nanomaterials behavior in different environmental conditions, including the space environment. The given TS deals with the peculiarities of the space environment impact on nanostructured materials (i.e. materials with structured objects which size in at least one dimension lies within 1-100 nm). The basic purpose of the document is the general description of the methodology of applying computer simulation methods which relate to different space and time scale to modeling processes occurring in nanostructured materials under the space environment impact. This document will emphasize the necessity of applying multiscale simulation approach and present the recommendations for the choice of the most appropriate methods (or a group of methods) for computer modeling of various processes that can occur in nanostructured materials under the influence of different space environment components. In addition, TS includes the description of possible

The near coastal environment monitored from space

International Nuclear Information System (INIS)

Szekielda, K.H.

1977-01-01

The optical information required for monitoring the marine environment from space is discussed and applied for the near coastal area. By categorizing coastal features it is possible to recognize coastal regions to a high degree and to indentify water masses derived from land sources and sewage dumping sites. It is concluded that monitoring from space can be used as a tool in environmental planning. (orig.) [de

The Living With a Star Program Space Environment Testbed

Science.gov (United States)

Barth, Janet; Day, John H. (Technical Monitor)

2001-01-01

This viewgraph presentation describes the objective, approach, and scope of the Living With a Star (LWS) program at the Marshall Space Flight Center. Scientists involved in the project seek to refine the understanding of space weather and the role of solar variability in terrestrial climate change. Research and the development of improved analytic methods have led to increased predictive capabilities and the improvement of environment specification models. Specifically, the Space Environment Testbed (SET) project of LWS is responsible for the implementation of improved engineering approaches to observing solar effects on climate change. This responsibility includes technology development, ground test protocol development, and the development of a technology application model/engineering tool.

Analysis of the Thermo-Elastic Response of Space Reflectors to Simulated Space Environment

Science.gov (United States)

Allegri, G.; Ivagnes, M. M.; Marchetti, M.; Poscente, F.

2002-01-01

The evaluation of space environment effects on materials and structures is a key matter to develop a proper design of long duration missions: since a large part of satellites operating in the earth orbital environment are employed for telecommunications, the development of space antennas and reflectors featured by high dimensional stability versus space environment interactions represents a major challenge for designers. The structural layout of state of the art space antennas and reflectors is very complex, since several different sensible elements and materials are employed: particular care must be placed in evaluating the actual geometrical configuration of the reflectors operating in the space environment, since very limited distortions of the designed layout can produce severe effects on the quality of the signal both received and transmitted, especially for antennas operating at high frequencies. The effects of thermal loads due to direct sunlight exposition and to earth and moon albedo can be easily taken into account employing the standard methods of structural analysis: on the other hand the thermal cycling and the exposition to the vacuum environment produce a long term damage accumulation which affects the whole structure. The typical effects of the just mentioned exposition are the outgassing of polymeric materials and the contamination of the exposed surface, which can affect sensibly the thermo-mechanical properties of the materials themselves and, therefore, the structural global response. The main aim of the present paper is to evaluate the synergistic effects of thermal cycling and of the exposition to high vacuum environment on an innovative antenna developed by Alenia Spazio S.p.a.: to this purpose, both an experimental and numerical research activity has been developed. A complete prototype of the antenna has been exposed to the space environment simulated by the SAS facility: this latter is constituted by an high vacuum chamber, equipped by

Fictional space in participatory design of engaging interactive environments

DEFF Research Database (Denmark)

Dindler, Christian

2010-01-01

practices of visitors and museum knowledge. The second and larger part of the contribution addresses the issue of shaping design inquiries. This part is summarized through the overarching notion of fictional space denoting a perspective on the creation of a design space where established norms...... spaces for museums and science centres. The dissertation is composed of seven research papers framed by a general overview that summarises the arguments made in the papers and outlines related work and research method. The contribution reflects a dual yet intertwined concern for understanding engagement...... in exhibition spaces and shaping design inquiries around the notion of engaging interactive environments. The first part of the contribution relates to conceptualising aspects of engagement in relation to interactive environments. The perspective of participatory engagement is presented as an overarching...

The Living With a Star Space Environment Testbed Payload

Science.gov (United States)

Xapsos, Mike

2015-01-01

This presentation outlines a brief description of the Living With a Star (LWS) Program missions and detailed information about the Space Environment Testbed (SET) payload consisting of a space weather monitor and carrier containing 4 board experiments.

Modelling the near-Earth space environment using LDEF data

Science.gov (United States)

Atkinson, Dale R.; Coombs, Cassandra R.; Crowell, Lawrence B.; Watts, Alan J.

1992-01-01

Near-Earth space is a dynamic environment, that is currently not well understood. In an effort to better characterize the near-Earth space environment, this study compares the results of actual impact crater measurement data and the Space Environment (SPENV) Program developed in-house at POD, to theoretical models established by Kessler (NASA TM-100471, 1987) and Cour-Palais (NASA SP-8013, 1969). With the continuing escalation of debris there will exist a definite hazard to unmanned satellites as well as manned operations. Since the smaller non-trackable debris has the highest impact rate, it is clearly necessary to establish the true debris environment for all particle sizes. Proper comprehension of the near-Earth space environment and its origin will permit improvement in spacecraft design and mission planning, thereby reducing potential disasters and extreme costs. Results of this study directly relate to the survivability of future spacecraft and satellites that are to travel through and/or reside in low Earth orbit (LEO). More specifically, these data are being used to: (1) characterize the effects of the LEO micrometeoroid an debris environment on satellite designs and components; (2) update the current theoretical micrometeoroid and debris models for LEO; (3) help assess the survivability of spacecraft and satellites that must travel through or reside in LEO, and the probability of their collision with already resident debris; and (4) help define and evaluate future debris mitigation and disposal methods. Combined model predictions match relatively well with the LDEF data for impact craters larger than approximately 0.05 cm, diameter; however, for smaller impact craters, the combined predictions diverge and do not reflect the sporadic clouds identified by the Interplanetary Dust Experiment (IDE) aboard LDEF. The divergences cannot currently be explained by the authors or model developers. The mean flux of small craters (approximately 0.05 cm diameter) is

Radiation Effects in the Space Telecommunications Environment

Energy Technology Data Exchange (ETDEWEB)

Fleetwood, Daniel M.; Winokur, Peter S.

1999-05-17

Trapped protons and electrons in the Earth's radiation belts and cosmic rays present significant challenges for electronics that must operate reliably in the natural space environment. Single event effects (SEE) can lead to sudden device or system failure, and total dose effects can reduce the lifetime of a telecommmiications system with significant space assets. One of the greatest sources of uncertainty in developing radiation requirements for a space system is accounting for the small but finite probability that the system will be exposed to a massive solar particle event. Once specifications are decided, standard laboratory tests are available to predict the total dose response of MOS and bipolar components in space, but SEE testing of components can be more challenging. Prospects are discussed for device modeling and for the use of standard commercial electronics in space.

Radiation Effects in the Space Telecommunications Environment

International Nuclear Information System (INIS)

Fleetwood, Daniel M.; Winokur, Peter S.

1999-01-01

Trapped protons and electrons in the Earth's radiation belts and cosmic rays present significant challenges for electronics that must operate reliably in the natural space environment. Single event effects (SEE) can lead to sudden device or system failure, and total dose effects can reduce the lifetime of a telecommmiications system with significant space assets. One of the greatest sources of uncertainty in developing radiation requirements for a space system is accounting for the small but finite probability that the system will be exposed to a massive solar particle event. Once specifications are decided, standard laboratory tests are available to predict the total dose response of MOS and bipolar components in space, but SEE testing of components can be more challenging. Prospects are discussed for device modeling and for the use of standard commercial electronics in space

Space Environment Effects on Materials at Different Positions and Operational Periods of ISS

Science.gov (United States)

Kimoto, Yugo; Ichikawa, Shoichi; Miyazaki, Eiji; Matsumoto, Koji; Ishizawa, Junichiro; Shimamura, Hiroyuki; Yamanaka, Riyo; Suzuki, Mineo

2009-01-01

A space materials exposure experiment was condcuted on the exterior of the Russian Service Module (SM) of the International Space Station (ISS) using the Micro-Particles Capturer and Space Environment Exposure Device (MPAC&SEED) of the Japan Aerospace Exploration Agency (JAXA). Results reveal artificial environment effects such as sample contamination, attitude change effects on AO fluence, and shading effects of UV on ISS. The sample contamination was coming from ISS components. The particles attributed to micrometeoroids and/or debris captured by MPAC might originate from the ISS solar array. Another MPAC&SEED will be aboard the Exposure Facility of the Japanese Experiment Module, KIBO Exposure Facility (EF) on ISS. The JEM/MPAC&SEED is attached to the Space Environment Data Acquisition Equipment-Attached Payload (SEDA-AP) and is exposed to space. Actually, SEDA-AP is a payload on EF to be launched by Space Shuttle flight 2J/A. In fact, SEDA-AP has space environment monitors such as a high-energy particle monitor, atomic oxygen monitor, and plasma monitor to measure in-situ natural space environment data during JEM/MPAC&SEED exposure. Some exposure samples for JEM/MPAC&SEED are identical to SM/MPAC&SEED samples. Consequently, effects on identical materials at different positions and operation periods of ISS will be evaluated. This report summarizes results from space environment monitoring samples for atomic oxygen analysis on SM/MPAC&SEED, along with experimental plans for JEM/MPAC&SEED.

Thermally Induced Vibrations of the Hubble Space Telescope's Solar Array 3 in a Test Simulated Space Environment

Science.gov (United States)

Early, Derrick A.; Haile, William B.; Turczyn, Mark T.; Griffin, Thomas J. (Technical Monitor)

2001-01-01

NASA Goddard Space Flight Center and the European Space Agency (ESA) conducted a disturbance verification test on a flight Solar Array 3 (SA3) for the Hubble Space Telescope using the ESA Large Space Simulator (LSS) in Noordwijk, the Netherlands. The LSS cyclically illuminated the SA3 to simulate orbital temperature changes in a vacuum environment. Data acquisition systems measured signals from force transducers and accelerometers resulting from thermally induced vibrations of the SAI The LSS with its seismic mass boundary provided an excellent background environment for this test. This paper discusses the analysis performed on the measured transient SA3 responses and provides a summary of the results.

Optimization of application execution in the GridSpace environment

NARCIS (Netherlands)

Malawski, M.; Kocot, J.; Ryszka, I.; Bubak, M.; Wieczorek, M.; Fahringer, T.

2008-01-01

This paper describes an approach to optimization of execution of applications in the GridSpace environment. In this environment operations are invoked on special objects which reside on Grid resources what requires a specific approach to optimization of execution. This approach is implemented in the

Creating the Deep Space Environment for Testing the James Webb Space Telescope at NASA Johnson Space Center's Chamber A

Science.gov (United States)

Homan, Jonathan L.; Cerimele, Mary P.; Montz, Michael E.; Bachtel, Russell; Speed, John; O'Rear, Patrick

2013-01-01

Chamber A is the largest thermal vacuum chamber at the Johnson Space Center and is one of the largest space environment chambers in the world. The chamber is 19.8 m (65 ft.) in diameter and 36.6 m (120 ft.) tall and is equipped with cryogenic liquid nitrogen panels (shrouds) and gaseous helium shrouds to create a simulated space environment. It was originally designed and built in the mid 1960 s to test the Apollo Command and Service Module and several manned tests were conducted on that spacecraft, contributing to the success of the program. The chamber has been used since that time to test spacecraft active thermal control systems, Shuttle DTO, DOD, and ESA hardware in simulated Low Earth Orbit (LEO) conditions. NASA is now moving from LEO towards exploration of locations with environments approaching those of deep space. Therefore, Chamber A has undergone major modifications to enable it to simulate these deeper space environments. Environmental requirements were driven, and modifications were funded by the James Webb Space Telescope program, and this telescope, which will orbit Solar/Earth L2, will be the first test article to benefit from the chamber s new capabilities. To accommodate JWST, the Chamber A high vacuum system has been modernized, additional LN2 shrouds have been installed, the liquid nitrogen system has been modified to minimize dependency on electrical power and increase its reliability, a new helium shroud/refrigeration system has been installed to create a colder more stable and uniform heat sink, and the controls have been updated to increase the level of automation and improve operator interfaces. Testing of these major modifications was conducted in August of 2012 and this initial test was very successful, with all major systems exceeding their performance requirements. This paper will outline the changes in overall environmental requirements, discuss the technical design data that was used in the decisions leading to the extensive

Creating the Deep Space Environment for Testing the James Webb Space Telescope at the Johnson Space Center's Chamber A

Science.gov (United States)

Homan, Jonathan L.; Cerimele, Mary P.; Montz, Michael E.

2012-01-01

Chamber A is the largest thermal vacuum chamber at the Johnson Space Center and is one of the largest space environment chambers in the world. The chamber is 19.8 m (65 ft) in diameter and 36.6 m (120 ft) tall and is equipped with cryogenic liquid nitrogen panels (shrouds) and gaseous helium shrouds to create a simulated space environment. It was originally designed and built in the mid 1960's to test the Apollo Command and Service Module and several manned tests were conducted on that spacecraft, contributing to the success of the program. The chamber has been used since that time to test spacecraft active thermal control systems, Shuttle DTO, DOD, and ESA hardware in simulated Low Earth Orbit (LEO) conditions. NASA is now moving from LEO towards exploration of locations with environments approaching those of deep space. Therefore, Chamber A has undergone major modifications to enable it to simulate these deeper space environments. Environmental requirements were driven, and the modifications were funded, by the James Webb Space Telescope program, and this telescope which will orbit Solar/Earth L2, will be the first test article to benefit from the chamber s new capabilities. To accommodate JWST, the Chamber A high vacuum system has been modernized, additional LN2 shrouds have been installed, the liquid nitrogen system has been modified to remove dependency on electrical power and increase its reliability, a new helium shroud/refrigeration system has been installed to create a colder more stable and uniform heat sink and, the controls have been updated to increase the level of automation and improve operator interfaces. Testing of these major modifications was conducted in August 2012 and this initial test was very successful, with all major systems exceeding their performance requirements. This paper will outline the changes in the overall environmental requirements, discuss the technical design data that was used in the decisions leading to the extensive

Reading space characteristics in campus environment

Science.gov (United States)

Tampubolon, A. C.; Kusuma, H. E.

2018-03-01

Reading activity is a part of daily learning activities that are usually done by college students and takes place in the facilities that are provided by the campus. However, students tend to have a perception of a particular location that is considered appropriate with the activities undertaken. This study identified students’ perceptions of reading space characteristics in campus environment which are considered able to accommodate reading activity. Exploratory qualitative research methods were used to collect data from selected types of space and the reasons for the students in choosing the specifics space to do their reading. The results showed that students do not only use library facilities as a support unit of academic activities. This study found that students tend to use some places with non-library function, such as students’ union room, hallway, and classroom. Students perceive reading space by its physical and social characteristics. The physical consist of ambiance, quiet place, tranquility, availability of facilities, the level of coolness, lighting, location accessibility, connection with nature, convenience furniture, air quality, aesthetics, the flexibility of activities, the crowd of place, the level of shade, outdoor, ownership, and indoor. While the social characteristics of the reading space are to have privacy, favorable reading position, and the presence of others.

Public spaces and urban sustainability in the tropical built environment

Science.gov (United States)

Yusof, Y. M.; Kozlowski, M.

2018-01-01

Sustainability is an overarching sense of responsibility towards the future. On a city-wide level, urban sustainability incorporates a wide body of changes especially as they relate to the built environment, all of which intended at creating a livable place. This paper discusses existing public spaces in view of their achievement against a set of criteria for the built environment. The paper introduces performance design criteria for the tropical built environment. The key findings indicate that long-term strategies, guidance and directions for the city and region can achieve development which corresponds to local climate, synergies and provide a higher proportion of public spaces that offer something for everyone.

Book Review: Physics of the Space Environment

Science.gov (United States)

Holman, Gordon D.

1998-01-01

Space physics, narrowly defined as the study of Earth's plasma environment, has had an identity crisis throughout its relatively brief existence as a discipline. - The limited and often serendipitous nature of the data requires the research style of an astrophysicist. However, the in situ observations and instrumentation that are central to the field are quite different from the remote observations and instrumentation of astronomy. Compared to neutral gases, the wealth of additional phenomena and the complexity associated with magnetized plasmas and their interaction leaves little in common with the atmospheric scientist. Although the phenomena studied in space physics are ultimately important to astrophysics, the intimate measurements of plasma properties provide a greater commonality with the plasma physicist. Space physics has experienced something of a renaissance in the past few years. The interdisciplinary umbrella "Solar-Terrestrial Physics" or "Sun-Earth Connection" has stimulated an increasing interaction of space physicists, solar physicists and atmospheric scientists. Spectacular images of the Sun from Yohkoh and SOHO and solar-activity-related damage to communications satellites have increased the public's awareness of and interest in "space weather". The dangers of energetic particles and currents in space to technological systems and to future space exploration have elevated space physics observations from interesting scientific measurements that can be included on a space probe to critically important measurements that must be made.

Assessing Built Environment Walkability using Activity-Space Summary Measures.

Science.gov (United States)

Tribby, Calvin P; Miller, Harvey J; Brown, Barbara B; Werner, Carol M; Smith, Ken R

There is increasing emphasis on active transportation, such as walking, in transportation planning as a sustainable form of mobility and in public health as a means of achieving recommended physical activity and better health outcomes. A research focus is the influence of the built environment on walking, with the ultimate goal of identifying environmental modifications that invite more walking. However, assessments of the built environment for walkability are typically at a spatially disaggregate level (such as street blocks) or at a spatially aggregate level (such as census block groups). A key issue is determining the spatial units for walkability measures so that they reflect potential walking behavior. This paper develops methods for assessing walkability within individual activity spaces : the geographic region accessible to an individual during a given walking trip. We first estimate street network-based activity spaces using the shortest path between known trip starting/ending points and a travel time budget that reflects potential alternative paths. Based on objective walkability measures of the street blocks, we use three summary measures for walkability within activity spaces: i) the average walkability score across block segments (representing the general level of walkability in the activity space); ii) the standard deviation (representing the walkability variation), and; iii) the network autocorrelation (representing the spatial coherence of the walkability pattern). We assess the method using data from an empirical study of built environment walkability and walking behavior in Salt Lake City, Utah, USA. We visualize and map these activity space summary measures to compare walkability among individuals' trips within their neighborhoods. We also compare summary measures for activity spaces versus census block groups, with the result that they agree less than half of the time.

Impact of space environment on stability of medicines: Challenges and prospects.

Science.gov (United States)

Mehta, Priti; Bhayani, Dhara

2017-03-20

To upkeep health of astronauts in a unique, isolated, and extreme environment of space is the primary goal for a successful space mission, hence, safe and efficacious medications are essential for the wellness of astronauts. Space medication has been challenged with problems related to efficacy. Along with altered physiology, one of the possible reasons could be instability of space medications in the presence of harsh spaceflight environmental conditions. Altered physical and chemical stability can result in reduced potency which can result in reduced efficacy. Right now, medicines from the International Space Station are replaced before their expiration. But, for longer duration missions to Mars or any other asteroid, there will not be any chance of replacement of medicines. Hence, it is desired that medicines maintain the shelf-life throughout the space mission. Stability of medicines used for short term or long term space missions cannot be judged by drug stability guidelines based on terrestrial environmental factors. Unique environmental conditions related to spaceflight include microgravity, excessive vibration, hard vacuum, humidity variation, temperature differences and excessive radiation, which may cause instability of medicines. This write-up provides a review of the problem and countermeasure approaches for pharmaceuticals exposed to the space environment. The first part of the article discusses thought processes behind outlining of International Conference on Harmonization drug stability guidelines, Q1A (R2) and Q1B, and its acceptance limits for accelerated stability study. The second part of the article describes the difference in the radiation environment of deep space compared to radiation environment inside the space shuttle based on penetration power of different types of radiation. In the third part of the article, various promising approaches are listed which can be used for assurance of space medicine stability. One of the approaches is the

Creating the Deep Space Environment for Testing the James Webb Space Telescope (JWST) at NASA Johnson Space Center's Chamber A

Science.gov (United States)

Homan, Jonathan L.; Cerimele, Mary P.; Montz, Michael E.; Bachtel, Russell; Speed, John; O'Rear, Patrick

2013-01-01

Chamber A is the largest thermal vacuum chamber at the Johnson Space Center and is one of the largest space environment chambers in the world. The chamber is 19.8 m (65 ft) in diameter and 36.6 m (120 ft) tall and is equipped with cryogenic liquid nitrogen panels (shrouds) and gaseous helium shrouds to create a simulated space environment. It was originally designed and built in the mid 1960 s to test the Apollo Command and Service Module and several manned tests were conducted on that spacecraft, contributing to the success of the program. The chamber has been used since that time to test spacecraft active thermal control systems, Shuttle DTO, DOD, and ESA hardware in simulated Low Earth Orbit (LEO) conditions. NASA is now moving from LEO towards exploration of locations with environments approaching those of deep space. Therefore, Chamber A has undergone major modifications to enable it to simulate these deeper space environments. Environmental requirements were driven, and modifications were funded by the James Webb Space Telescope program, and this telescope which will orbit Solar/Earth L2, will be the first test article to benefit from the chamber s new capabilities. To accommodate JWST, the Chamber A high vacuum system has been modernized, additional LN2 shrouds have been installed, the liquid nitrogen system has been modified to remove dependency on electrical power and increase its reliability, a new helium shroud/refrigeration system has been installed to create a colder more stable and uniform heat sink, and the controls have been updated to increase the level of automation and improve operator interfaces. Testing of these major modifications was conducted in August of 2012 and this initial test was very successful, with all major systems exceeding their performance requirements. This paper will outline the changes in overall environmental requirements, discuss the technical design data that was used in the decisions leading to the extensive modifications

Protection from Induced Space Environments Effects on the International Space Station

Science.gov (United States)

Soares, Carlos; Mikatarian, Ron; Stegall, Courtney; Schmidl, Danny; Huang, Alvin; Olsen, Randy; Koontz, Steven

2010-01-01

The International Space Station (ISS) is one of the largest, most complex multinational scientific projects in history and protection from induced space environments effects is critical to its long duration mission as well as to the health of the vehicle and safety of on-orbit operations. This paper discusses some of the unique challenges that were encountered during the design, assembly and operation of the ISS and how they were resolved. Examples are provided to illustrate the issues and the risk mitigation strategies that were developed to resolve these issues. Of particular importance are issues related with the interaction of multiple spacecraft as in the case of ISS and Visiting Vehicles transporting crew, hardware elements, cargo and scientific payloads. These strategies are applicable to the development of future long duration space systems, not only during design, but also during assembly and operation of these systems.

The Near-Earth Space Radiation for Electronics Environment

Science.gov (United States)

Stassinopoulos, E. G.; LaBel, K. A.

2004-01-01

The earth's space radiation environment is described in terms of: a) charged particles as relevant to effects on spacecraft electronics, b) the nature and distribution of trapped and transiting radiation, and c) their effect on electronic components.

Effects of a Closed Space Environment on Gene Expression in Hair Follicles of Astronauts in the International Space Station

Data.gov (United States)

National Aeronautics and Space Administration — In recent times long-term stay has become a common occurrence in the International Space Station (ISS). However adaptation to the space environment can sometimes...

Research Progress and Prospect of GNSS Space Environment Science

Directory of Open Access Journals (Sweden)

YAO Yibin

2017-10-01

Full Text Available Troposphere and ionosphere are two important components of the near-earth space environment. They are close to the surface of the earth and have great influence on human life. The developments of Global Navigation Satellite System (GNSS over the past several decades provide a great opportunity for the GNSS-based space environment science. This review summarizes the research progress and prospect of the GNSS-based research of the Earth's troposphere and ionosphere. On the tropospheric perspective, modeling of the key tropospheric parameters and inversion of precipitable water vapor (PWV are dominant researching fields. On the ionospheric perspective, 2D/3D ionospheric models and regional/global ionospheric monitoring are dominant researching fields.

Human Pathophysiological Adaptations to the Space Environment

Directory of Open Access Journals (Sweden)

Gian C. Demontis

2017-08-01

Full Text Available Space is an extreme environment for the human body, where during long-term missions microgravity and high radiation levels represent major threats to crew health. Intriguingly, space flight (SF imposes on the body of highly selected, well-trained, and healthy individuals (astronauts and cosmonauts pathophysiological adaptive changes akin to an accelerated aging process and to some diseases. Such effects, becoming manifest over a time span of weeks (i.e., cardiovascular deconditioning to months (i.e., loss of bone density and muscle atrophy of exposure to weightlessness, can be reduced through proper countermeasures during SF and in due time are mostly reversible after landing. Based on these considerations, it is increasingly accepted that SF might provide a mechanistic insight into certain pathophysiological processes, a concept of interest to pre-nosological medicine. In this article, we will review the main stress factors encountered in space and their impact on the human body and will also discuss the possible lessons learned with space exploration in reference to human health on Earth. In fact, this is a productive, cross-fertilized, endeavor in which studies performed on Earth yield countermeasures for protection of space crew health, and space research is translated into health measures for Earth-bound population.

The contribution of woody plant materials on the several conditions in a space environment

Science.gov (United States)

Tomita-Yokotani, Kaori; Baba, Keiichi; Suzuki, Toshisada; Kimura, Shunta; Sato, Seigo; Katoh, Hiroshi; Abe, Yusuke; Katayama, Takeshi

Woody plant materials have several utilization elements in our habitation environment on earth. The studies of woody plants under a space-environment in the vegetable kingdom have a high contribution to the study of various and exotic environmental responses, too. Woody plants can produce an excess oxygen, woody materials for the living cabin, and provide a biomass by cultivating crops and other species of creatures. Tree material would become to be a tool in closed bio-ecosystems such as an environment in a space. We named the trees used as material for the experiment related to space environments “CosmoBon”, small tree bonsai. Japanese cherry tree, “Sakura”, is famous and lovely tree in Japan. One species of “Sakura”, “Mamezakura, Prunus incisa”, is not only lovely tree species, but also suitable tree for the model tree of our purpose. The species of Prunus incisa is originally grown in volcano environment. That species of Sakura is originally grown on Mt. Fuji aria, oligotrophic place. We will try to build the best utilization usage of woody plant under the space environment by “Mamezakura” as a model tree. Here, we will show the importance of uniformity of materials when we will use the tree materials in a space environment. We will also discuss that tree has a high possibility of utilization under the space environments by using our several results related to this research.

Modeling of Complex Material Systems in Extreme Environments for Space Technology

Data.gov (United States)

National Aeronautics and Space Administration — Among the many enabling technologies of space research is the design of materials which are stable in the environments of interest for a given application. At the...

Space - A unique environment for process modeling R&D

Science.gov (United States)

Overfelt, Tony

1991-01-01

Process modeling, the application of advanced computational techniques to simulate real processes as they occur in regular use, e.g., welding, casting and semiconductor crystal growth, is discussed. Using the low-gravity environment of space will accelerate the technical validation of the procedures and enable extremely accurate determinations of the many necessary thermophysical properties. Attention is given to NASA's centers for the commercial development of space; joint ventures of universities, industries, and goverment agencies to study the unique attributes of space that offer potential for applied R&D and eventual commercial exploitation.

Effects of space environment on biological characteristics of melanoma B16 cells

International Nuclear Information System (INIS)

Geng Chuanying; Xiang Qing; Xu Mei; Li Hongyan; Xu Bo; Fang Qing; Tang Jingtian; Guo Yupeng

2006-01-01

Objective: To examine the effects of space environment on biological characteristics of melanoma B16 Cells. Methods: B16 cells were carried to the space (in orbit for 8 days, circle the earth 286 times) by the 20th Chinese recoverable satellite, and then harvested and monocloned. 110 strains of space B16 cells were obtained in total. Ten strains of space B16 cells were selected and its morphological changes were examined with the phasecontrast microscope. Flow cytometry and MTT assay were carried out to evaluate the cell cycle and cell viability. Results Morphological changes were observed in the space cells, and melainin granules on the surface in some cells. It was demonstrated by MTF assay that space cells viability varied muti- directionally. It was showed by flow cytometry analysis that G1 phase of space cells was prolonged, S phase shortened. Conclusion: Space environment may change the biological characteristics of melanoma B16 cells. (authors)

TDRS-1 single event upsets and the effect of the space environment

International Nuclear Information System (INIS)

Wilkinson, D.C.; Daughtridge, S.C.; Stone, J.L.; Sauer, H.H.; Darling, P.

1991-01-01

The systematic recording of Single Event Upsets on TDRS-1 from 1984 to 1990 allows correlations to be drawn between those upsets and the space environment. In this paper, ground based neutron monitor data are used to illustrate the long-term relationship between galactic cosmic rays and TDRS-1 upsets. The short-term effects of energetic solar particles are illustrated with space environment data from GOES-7

The Objectives of NASA's Living with a Star Space Environment Testbed

Science.gov (United States)

Barth, Janet L.; LaBel, Kenneth A.; Brewer, Dana; Kauffman, Billy; Howard, Regan; Griffin, Geoff; Day, John H. (Technical Monitor)

2001-01-01

NASA is planning to fly a series of Space Environment Testbeds (SET) as part of the Living With A Star (LWS) Program. The goal of the testbeds is to improve and develop capabilities to mitigate and/or accommodate the affects of solar variability in spacecraft and avionics design and operation. This will be accomplished by performing technology validation in space to enable routine operations, characterize technology performance in space, and improve and develop models, guidelines and databases. The anticipated result of the LWS/SET program is improved spacecraft performance, design, and operation for survival of the radiation, spacecraft charging, meteoroid, orbital debris and thermosphere/ionosphere environments. The program calls for a series of NASA Research Announcements (NRAs) to be issued to solicit flight validation experiments, improvement in environment effects models and guidelines, and collateral environment measurements. The selected flight experiments may fly on the SET experiment carriers and flights of opportunity on other commercial and technology missions. This paper presents the status of the project so far, including a description of the types of experiments that are intended to fly on SET-1 and a description of the SET-1 carrier parameters.

Simulated Space Environment Effects on a Candidate Solar Sail Material

Science.gov (United States)

Kang, Jin Ho; Bryant, Robert G.; Wilkie, W. Keats; Wadsworth, Heather M.; Craven, Paul D.; Nehls, Mary K.; Vaughn, Jason A.

2017-01-01

For long duration missions of solar sails, the sail material needs to survive harsh space environments and the degradation of the sail material controls operational lifetime. Therefore, understanding the effects of the space environment on the sail membrane is essential for mission success. In this study, we investigated the effect of simulated space environment effects of ionizing radiation, thermal aging and simulated potential damage on mechanical, thermal and optical properties of a commercial off the shelf (COTS) polyester solar sail membrane to assess the degradation mechanisms on a feasible solar sail. The solar sail membrane was exposed to high energy electrons (about 70 keV and 10 nA/cm2), and the physical properties were characterized. After about 8.3 Grad dose, the tensile modulus, tensile strength and failure strain of the sail membrane decreased by about 20 95%. The aluminum reflective layer was damaged and partially delaminated but it did not show any significant change in solar absorbance or thermal emittance. The effect on mechanical properties of a pre-cracked sample, simulating potential impact damage of the sail membrane, as well as thermal aging effects on metallized PEN (polyethylene naphthalate) film will be discussed.

Space Environment Automated Alerts and Anomaly Analysis Assistant (SEA^5) for NASA

Data.gov (United States)

National Aeronautics and Space Administration — We propose to develop a comprehensive analysis and dissemination system (Space Environment Automated Alerts  & Anomaly Analysis Assistant: SEA5) that will...

On public space design for Chinese urban residential area based on integrated architectural physics environment evaluation

Science.gov (United States)

Dong, J. Y.; Cheng, W.; Ma, C. P.; Tan, Y. T.; Xin, L. S.

2017-04-01

The residential public space is an important part in designing the ecological residence, and a proper physics environment of public space is of greater significance to urban residence in China. Actually, the measure to apply computer aided design software into residential design can effectively avoid an inconformity of design intent with actual using condition, and a negative impact on users due to bad architectural physics environment of buildings, etc. The paper largely adopts a design method of analyzing architectural physics environment of residential public space. By analyzing and evaluating various physics environments, a suitability assessment is obtained for residential public space, thereby guiding the space design.

Anaesthesia in austere environments: literature review and considerations for future space exploration missions.

Science.gov (United States)

Komorowski, Matthieu; Fleming, Sarah; Mawkin, Mala; Hinkelbein, Jochen

2018-01-01

Future space exploration missions will take humans far beyond low Earth orbit and require complete crew autonomy. The ability to provide anaesthesia will be important given the expected risk of severe medical events requiring surgery. Knowledge and experience of such procedures during space missions is currently extremely limited. Austere and isolated environments (such as polar bases or submarines) have been used extensively as test beds for spaceflight to probe hazards, train crews, develop clinical protocols and countermeasures for prospective space missions. We have conducted a literature review on anaesthesia in austere environments relevant to distant space missions. In each setting, we assessed how the problems related to the provision of anaesthesia (e.g., medical kit and skills) are dealt with or prepared for. We analysed how these factors could be applied to the unique environment of a space exploration mission. The delivery of anaesthesia will be complicated by many factors including space-induced physiological changes and limitations in skills and equipment. The basic principles of a safe anaesthesia in an austere environment (appropriate training, presence of minimal safety and monitoring equipment, etc.) can be extended to the context of a space exploration mission. Skills redundancy is an important safety factor, and basic competency in anaesthesia should be part of the skillset of several crewmembers. The literature suggests that safe and effective anaesthesia could be achieved by a physician during future space exploration missions. In a life-or-limb situation, non-physicians may be able to conduct anaesthetic procedures, including simplified general anaesthesia.

Prediction of Thermal Environment in a Large Space Using Artificial Neural Network

Directory of Open Access Journals (Sweden)

Hyun-Jung Yoon

2018-02-01

Full Text Available Since the thermal environment of large space buildings such as stadiums can vary depending on the location of the stands, it is important to divide them into different zones and evaluate their thermal environment separately. The thermal environment can be evaluated using physical values measured with the sensors, but the occupant density of the stadium stands is high, which limits the locations available to install the sensors. As a method to resolve the limitations of installing the sensors, we propose a method to predict the thermal environment of each zone in a large space. We set six key thermal factors affecting the thermal environment in a large space to be predicted factors (indoor air temperature, mean radiant temperature, and clothing and the fixed factors (air velocity, metabolic rate, and relative humidity. Using artificial neural network (ANN models and the outdoor air temperature and the surface temperature of the interior walls around the stands as input data, we developed a method to predict the three thermal factors. Learning and verification datasets were established using STAR CCM+ (2016.10, Siemens PLM software, Plano, TX, USA. An analysis of each model’s prediction results showed that the prediction accuracy increased with the number of learning data points. The thermal environment evaluation process developed in this study can be used to control heating, ventilation, and air conditioning (HVAC facilities in each zone in a large space building with sufficient learning by ANN models at the building testing or the evaluation stage.

A Comprehensive CFD Tool for Aerothermal Environment Around Space Vehicles, Phase I

Data.gov (United States)

National Aeronautics and Space Administration — The goal of this SBIR project is to develop an innovative, high fidelity computational tool for accurate prediction of aerothermal environment around space vehicles....

A Comprehensive CFD Tool for Aerothermal Environment Around Space Vehicles, Phase II

Data.gov (United States)

National Aeronautics and Space Administration — The goal of this SBIR project is to develop an innovative, high fidelity computational tool for accurate prediction of aerothermal environment around space vehicles....

Atmospheric and Space Sciences: Ionospheres and Plasma Environments

Science.gov (United States)

Yiǧit, Erdal

2018-01-01

The SpringerBriefs on Atmospheric and Space Sciences in two volumes presents a concise and interdisciplinary introduction to the basic theory, observation & modeling of atmospheric and ionospheric coupling processes on Earth. The goal is to contribute toward bridging the gap between meteorology, aeronomy, and planetary science. In addition recent progress in several related research topics, such atmospheric wave coupling and variability, is discussed. Volume 1 will focus on the atmosphere, while Volume 2 will present the ionospheres and the plasma environments. Volume 2 is aimed primarily at (research) students and young researchers that would like to gain quick insight into the basics of space sciences and current research. In combination with the first volume, it also is a useful tool for professors who would like to develop a course in atmospheric and space physics.

The ESA Space Environment Information System (SPENVIS)

Science.gov (United States)

Heynderickx, D.; Quaghebeur, B.; Evans, H. D. R.

2002-01-01

The ESA SPace ENVironment Information System (SPENVIS) provides standardized access to models of the hazardous space environment through a user-friendly WWW interface. The interface includes parameter input with extensive defaulting, definition of user environments, streamlined production of results (both in graphical and textual form), background information, and on-line help. It is available on-line at http://www.spenvis.oma.be/spenvis/. SPENVIS Is designed to help spacecraft engineers perform rapid analyses of environmental problems and, with extensive documentation and tutorial information, allows engineers with relatively little familiarity with the models to produce reliable results. It has been developed in response to the increasing pressure for rapid-response tools for system engineering, especially in low-cost commercial and educational programmes. It is very useful in conjunction with radiation effects and electrostatic charging testing in the context of hardness assurance. SPENVIS is based on internationally recognized standard models and methods in many domains. It uses an ESA-developed orbit generator to produce orbital point files necessary for many different types of problem. It has various reporting and graphical utilities, and extensive help facilities. The SPENVIS radiation module features models of the proton and electron radiation belts, as well as solar energetic particle and cosmic ray models. The particle spectra serve as input to models of ionising dose (SHIELDOSE), Non-Ionising Energy Loss (NIEL), and Single Event Upsets (CREME). Material shielding is taken into account for all these models, either as a set of user-defined shielding thicknesses, or in combination with a sectoring analysis that produces a shielding distribution from a geometric description of the satellite system. A sequence of models, from orbit generator to folding dose curves with a shielding distribution, can be run as one process, which minimizes user interaction and

Neighbourhood green space, social environment and mental health: an examination in four European cities.

Science.gov (United States)

Ruijsbroek, Annemarie; Mohnen, Sigrid M; Droomers, Mariël; Kruize, Hanneke; Gidlow, Christopher; Gražulevičiene, Regina; Andrusaityte, Sandra; Maas, Jolanda; Nieuwenhuijsen, Mark J; Triguero-Mas, Margarita; Masterson, Daniel; Ellis, Naomi; van Kempen, Elise; Hardyns, Wim; Stronks, Karien; Groenewegen, Peter P

2017-07-01

This study examines the relationship between neighbourhood green space, the neighbourhood social environment (social cohesion, neighbourhood attachment, social contacts), and mental health in four European cities. The PHENOTYPE study was carried out in 2013 in Barcelona (Spain), Stoke-on-Trent (United Kingdom), Doetinchem (The Netherlands), and Kaunas (Lithuania). 3771 adults living in 124 neighbourhoods answered questions on mental health, neighbourhood social environment, and amount and quality of green space. Additionally, audit data on neighbourhood green space were collected. Multilevel regression analyses examined the relation between neighbourhood green space and individual mental health and the influence of neighbourhood social environment. Mental health was only related to green (audit) in Barcelona. The amount and quality of neighbourhood green space (audit and perceived) were related to social cohesion in Doetinchem and Stoke-on-Trent and to neighbourhood attachment in Doetinchem. In all four cities, mental health was associated with social contacts. Neighbourhood green was related to mental health only in Barcelona. Though neighbourhood green was related to social cohesion and attachment, the neighbourhood social environment seems not the underlying mechanism for this relationship.

Effects of the space environment on the health and safety of space workers

Science.gov (United States)

Hull, W. E.

1980-07-01

Large numbers of individuals are required to work in space to assemble and operate a Solar Power Satellite. The physiological and behavioral consequences for large groups of men and women who perform complex tasks in the vehicular or extravehicular environments over long periods of orbital stay time were considered. The most disturbing consequences of exposure to the null gravity environment found relate to: (1) a generalized cardiovascular deconditioning along with loss of a significant amount of body fluid volume; (2) loss of bone minerals and muscle mass; and (3) degraded performance of neutral mechanisms which govern equilibrium and spatial orientation.

Effects of the space environment on the health and safety of space workers

Science.gov (United States)

Hull, W. E.

1980-01-01

Large numbers of individuals are required to work in space to assemble and operate a Solar Power Satellite. The physiological and behavioral consequences for large groups of men and women who perform complex tasks in the vehicular or extravehicular environments over long periods of orbital stay time were considered. The most disturbing consequences of exposure to the null gravity environment found relate to: (1) a generalized cardiovascular deconditioning along with loss of a significant amount of body fluid volume; (2) loss of bone minerals and muscle mass; and (3) degraded performance of neutral mechanisms which govern equilibrium and spatial orientation.

Effect of science laboratory centrifuge of space station environment

Science.gov (United States)

Searby, Nancy

1990-01-01

It is argued that it is essential to have a centrifuge operating during manned space station operations. Background information and a rationale for the research centrifuge are given. It is argued that we must provide a controlled acceleration environment for comparison with microgravity studies. The lack of control groups in previous studies throws into question whether the obseved effects were the result of microgravity or not. The centrifuge could be used to provide a 1-g environment to supply specimens free of launch effects for long-term studies. With the centrifuge, the specimens could be immediately transferred to microgravity without undergoing gradual acclimation. Also, the effects of artificial gravity on humans could be investigated. It is also argued that the presence of the centrifuge on the space station will not cause undo vibrations or other disturbing effects.

Oncogenesis of melanoma B16 cell clones mutagenized by space environment

International Nuclear Information System (INIS)

Guo Yupeng; Yang Hongsheng; Tang Jingtian; Xu Mei; Geng Chuanying; Fang Qing; Xu Bo; Li Hongyan; Xiang Xing; Pan Lin

2005-01-01

Objective: To explore the oncogenesis of the melanoma B16 cell clones mutagenized by space environment, and find the B16 cell clones with remarkably mutated immunogenicity. Methods: B16 cells were carried by the Chinese 20th recoverable satellite to the outer space, and were harvested after 18 days' spaceflight and then monocloned. Four cell clones, which were randomly selected from the total 110 clones obtained , and the control clone were routinely cultured. The cultured cells were injected to 10 groups of C57BL/6J mice, 82.1 mice in each group. Five groups of mice received hypodermic injection and another 5 groups of mice received abdominal injection. The survival time was observed in abdominal injection groups. The mice in hypodermic injection groups were sacrificed after 14 days, the tumor, spleen and thymus were weighted, and the serum IL-2 concentration was determined. Moreover, the melanoma tumor tissues were examined histopathologically. Results: An experiment program suitable to screening space mutagenesis of B16 tumor cell clones in vivo and the observation indices were basically established. One clone was found out which was remarkably different from the control clone in latent period of tumor formation, tumor weight, survival time of the tumor-bearing mice and the expression of IL-2. Conclusions: Cultured melanoma B16 cells could be mutated by outer space environment. The further study will be focused on the influence of space environment on immunogenicity of mutagenized B16 cells. (authors)

Analysis on Space Environment from the Anomalies of Geosynchronous Satellites

Directory of Open Access Journals (Sweden)

Jaejin Lee

2009-12-01

Full Text Available While it is well known that space environment can produce spacecraft anomaly, defining space environment effects for each anomalies is difficult. This is caused by the fact that spacecraft anomaly shows various symptoms and reproducing it is impossible. In this study, we try to find the conditions of when spacecraft failures happen more frequently and give satellite operators useful information. Especially, our study focuses on the geosynchronous satellites which cost is high and required high reliability. We used satellite anomaly data given by Satellite News Digest which is internet newspaper providing space industry news. In our analysis, 88 anomaly cases occurred from 1997 to 2008 shows bad corelation with Kp index. Satellite malfunctions were likely to happen in spring and fall and in local time from midnight to dawn. In addition, we found the probability of anomaly increase when high energy electron flux is high. This is more clearly appeared in solar minimum than maximum period.

Specification of the near-Earth space environment with SHIELDS

International Nuclear Information System (INIS)

Jordanova, Vania Koleva; Delzanno, Gian Luca; Henderson, Michael Gerard; Godinez, Humberto C.; Jeffery, Christopher Andrew Munn

2017-01-01

Here, predicting variations in the near-Earth space environment that can lead to spacecraft damage and failure is one example of “space weather” and a big space physics challenge. A project recently funded through the Los Alamos National Laboratory (LANL) Directed Research and Development (LDRD) program aims at developing a new capability to understand, model, and predict Space Hazards Induced near Earth by Large Dynamic Storms, the SHIELDS framework. The project goals are to understand the dynamics of the surface charging environment (SCE), the hot (keV) electrons representing the source and seed populations for the radiation belts, on both macro- and micro-scale. Important physics questions related to particle injection and acceleration associated with magnetospheric storms and substorms, as well as plasma waves, are investigated. These challenging problems are addressed using a team of world-class experts in the fields of space science and computational plasma physics, and state-of-the-art models and computational facilities. A full two-way coupling of physics-based models across multiple scales, including a global MHD (BATS-R-US) embedding a particle-in-cell (iPIC3D) and an inner magnetosphere (RAM-SCB) codes, is achieved. New data assimilation techniques employing in situ satellite data are developed; these provide an order of magnitude improvement in the accuracy in the simulation of the SCE. SHIELDS also includes a post-processing tool designed to calculate the surface charging for specific spacecraft geometry using the Curvilinear Particle-In-Cell (CPIC) code that can be used for reanalysis of satellite failures or for satellite design.

Electro-Mechanical Systems for Extreme Space Environments

Science.gov (United States)

Mojarradi, Mohammad M.; Tyler, Tony R.; Abel, Phillip B.; Levanas, Greg

2011-01-01

Exploration beyond low earth orbit presents challenges for hardware that must operate in extreme environments. The current state of the art is to isolate and provide heating for sensitive hardware in order to survive. However, this protection results in penalties of weight and power for the spacecraft. This is particularly true for electro-mechanical based technology such as electronics, actuators and sensors. Especially when considering distributed electronics, many electro-mechanical systems need to be located in appendage type locations, making it much harder to protect from the extreme environments. The purpose of this paper to describe the advances made in the area of developing electro-mechanical technology to survive these environments with minimal protection. The Jet Propulsion Lab (JPL), the Glenn Research Center (GRC), the Langley Research Center (LaRC), and Aeroflex, Inc. over the last few years have worked to develop and test electro-mechanical hardware that will meet the stringent environmental demands of the moon, and which can also be leveraged for other challenging space exploration missions. Prototype actuators and electronics have been built and tested. Brushless DC actuators designed by Aeroflex, Inc have been tested with interface temperatures as low as 14 degrees Kelvin. Testing of the Aeroflex design has shown that a brushless DC motor with a single stage planetary gearbox can operate in low temperature environments for at least 120 million cycles (measured at motor) if long life is considered as part of the design. A motor control distributed electronics concept developed by JPL was built and operated at temperatures as low as -160 C, with many components still operational down to -245 C. Testing identified the components not capable of meeting the low temperature goal of -230 C. This distributed controller is universal in design with the ability to control different types of motors and read many different types of sensors. The controller

TIROS-N/NOAA A-J space environment monitor subsystem. Technical memo

International Nuclear Information System (INIS)

Seale, R.A.; Bushnell, R.H.

1987-04-01

The Space Environment Monitor (SEM), which is incorporated as a subsystem in the TIROS-N and NOAA A-J satellites, is described. The SEM consists of a Total Energy Detector (TED), a Medium Energy Proton and Electron Detector (MEPED), a High Energy Proton and Alpha Detector (HEPAD) and a Data Processing Unit (DPU). The detectors are intended to provide near-real-time particle data for use in the Space Environment Service Center of National Oceanic and Atmospheric Administration (NOAA) and to provide a long-term scientific data base. Telemeter codes, data reduction, and test instructions are given

BUSEFL: The Boston University Space Environment Forecast Laboratory

International Nuclear Information System (INIS)

Contos, A.R.; Sanchez, L.A.; Jorgensen, A.M.

1996-01-01

BUSEFL (Boston University Space Environment Forecast Laboratory) is a comprehensive, integrated project to address the issues and implications of space weather forecasting. An important goal of the BUSEFL mission is to serve as a testing ground for space weather algorithms and operational procedures. One such algorithm is the Magnetospheric Specification and Forecast Model (MSFM), which may be implemented in possible future space weather prediction centers. Boston University Student-satellite for Applications and Training (BUSAT), the satellite component of BUSEFL, will incorporate four experiments designed to measure (1) the earth close-quote s magnetic field, (2) distribution of energetic electrons trapped in the earth close-quote s radiation belts, (3) the mass and charge composition of the ion fluxes along the magnetic field lines and (4) the auroral forms at the foot of the field line in the auroral zones. Data from these experiments will be integrated into a ground system to evaluate space weather prediction codes. Data from the BUSEFL mission will be available to the scientific community and the public through media such as the World Wide Web (WWW). copyright 1996 American Institute of Physics

The contamination of personal space : boundary construction in a prison environment

NARCIS (Netherlands)

Sibley, David; van Hoven, Bettina

In this paper, inmates in dormitories in a prison in New Mexico, USA, talk about their everyday lives. We are particularly interested in the ways in which they think about space. Their principal concern appears to be the definition of personal space in an environment where boundaries are weak. The

From outer space to Earth-The social significance of isolated and confined environment research in human space exploration

Science.gov (United States)

Tachibana, Koji; Tachibana, Shoichi; Inoue, Natsuhiko

2017-11-01

Human space exploration requires massive budgets every fiscal year. Especially under severe financial constraint conditions, governments are forced to justify to society why spending so much tax revenue for human space exploration is worth the cost. The value of human space exploration might be estimated in many ways, but its social significance and cost-effectiveness are two key ways to gauge that worth. Since these measures should be applied country by country because sociopolitical conditions differ in each country and must be taken into consideration, the study on the social significance of human space exploration must take the coloration of a case-study. This paper, focusing on the case of Japan with surveying Japanese literary and national documents as well as taking its sociopolitical conditions into account, examines the social significance of human space exploration. First, we give an overview of the circumstances surrounding Japan's human space exploration program. Derived from the statements of such relevant parties as scholars, journalists, policy makers, and astronauts, this overview indicates that the main concerns about human space exploration in Japan are its social significance and cost-effectiveness (Section 1). Next, an overview of behavioral science-an essential field for human space exploration (referred to in this paper as space behavioral science) that provides support for astronauts-is presented from the perspective of stress research in isolated and confined environments (Section 2). We then give two examples of where such knowledge from space behavioral science research has been applied to terrestrial isolated and confined environments. One is JAXA's support in 2009 for people who were vulnerable to infection by a new strain of flu and accordingly placed in an isolated and confined facility under the Infectious Disease Law and the Quarantine Law. The other is NASA's support in 2010 for Chilean mine workers who were trapped 700 m

Creating the Thermal Environment for Safely Testing the James Webb Space Telescope at the Johnson Space Center's Chamber A

Science.gov (United States)

Homan, Jonathan L.; Lauterbach, John; Garcia, Sam

2016-01-01

Chamber A is the largest thermal vacuum chamber at the Johnson Space Center and is one of the largest space environment chambers in the world. The chamber is 19.8 m (65 ft) in diameter and 36.6 m (120 ft) tall and is equipped with cryogenic liquid nitrogen panels (shrouds) and gaseous helium shrouds to create a simulated space environment. The chamber was originally built to support testing of the Apollo Service and Command Module for lunar missions, but underwent major modifications to be able to test the James Webb Space Telescope in a simulated deep space environment. To date seven tests have been performed in preparation of testing the flight optics for the James Webb Space Telescope (JWST). Each test has had a uniquie thermal profile and set of thermal requirements for cooling down and warming up, controlling contamination, and releasing condensed air. These range from temperatures from 335K to 15K, with tight uniformity and controllability for maintining thermal stability and pressure control. One unique requirement for two test was structurally proof loading hardware by creating thermal gradients at specific temperatures. This paper will discuss the thermal requirements and goals of the tests, the original requirements of the chamber thermal systems for planned operation, and how the new requirements were met by the team using the hardware, system flexiblilty, and engineering creativity. It will also discuss the mistakes and successes to meet the unique goals, especially when meeting the thermal proof load.

Towards the Next Generation of Space Environment Prediction Capabilities.

Science.gov (United States)

Kuznetsova, M. M.

2015-12-01

Since its establishment more than 15 years ago, the Community Coordinated Modeling Center (CCMC, http://ccmc.gsfc.nasa.gov) is serving as an assess point to expanding collection of state-of-the-art space environment models and frameworks as well as a hub for collaborative development of next generation space weather forecasting systems. In partnership with model developers and international research and operational communities the CCMC integrates new data streams and models from diverse sources into end-to-end space weather impacts predictive systems, identifies week links in data-model & model-model coupling and leads community efforts to fill those gaps. The presentation will highlight latest developments, progress in CCMC-led community-wide projects on testing, prototyping, and validation of models, forecasting techniques and procedures and outline ideas on accelerating implementation of new capabilities in space weather operations.

Urban Public Space Context and Cognitive Psychology Evolution in Information Environment

Science.gov (United States)

Feng, Chen; Xu, Hua-wei

2017-11-01

The rapid development of information technology has had a great impact on the understanding of urban environment, which brings different spatially psychological experience. Information and image transmission has been full with the streets, both the physical space and virtual space have been unprecedentedly blended together through pictures, images, electronic media and other tools, which also stimulates people’s vision and psychology and gives birth to a more complex form of urban space. Under the dual role of spatial mediumlization and media spatialization, the psychological cognitive pattern of urban public space context is changing.

Healing environments in cancer treatment and care. Relations of space and practice in hematological cancer treatment.

Science.gov (United States)

Høybye, Mette Terp

2013-02-01

Given the growing attention to the importance of design in shaping healing hospital environments this study extends the understanding of healing environments, beyond causal links between environmental exposure and health outcome by elucidating how environments and practices interrelate. The study was conducted as an ethnographic fieldwork from March 2011 to September 2011 at the Department of Haematology at Odense University Hospital, Denmark, systematically using participant observation and interviews as research strategies. It included 20 patients, four of who were followed closely over an extended time period. Through thematic analysis five key concepts emerged about the social dynamics of hospital environments: practices of self; creating personal space; social recognition; negotiating space; and ambiguity of space and care. Through these concepts, the study demonstrates how the hospital environment is a flow of relations between space and practice that changes and challenges a structural idea of design and healing. Patients' sense of healing changes with the experience of progression in treatment and the capacity of the hospital space to incite an experience of homeliness and care. Furthermore, cancer patients continuously challenge the use and limits of space by individual objects and practices of privacy and home. Healing environments are complex relations between practices, space and care, where recognition of the individual patient's needs, values and experiences is key to developing the environment to support the patient quality of life. The present study holds implications for practice to inform design of future hospital environments for cancer treatment. The study points to the importance for being attentive to the need for flexible spaces in hospitals that recognize the dynamics of healing, by providing individualized care, relating to the particular and changing needs of patients supporting their potential and their challenged condition with the best

Crystal Growth and Other Materials Physical Researches in Space Environment

Science.gov (United States)

Pan, Mingxiang

Material science researches in space environment are based on reducing the effects of buoyancy driven transport, the effects of atomic oxygen, radiation, extremes of heat and cold and the ultrahigh vacuum, so as to unveil the underlying fundamental phenomena, lead maybe to new potential materials or new industrial processes and develop space techniques. Currently, research program on materials sciences in Chinese Manned Space Engineering (CMSE) is going on. More than ten projects related to crystal growth and materials processes are selected as candidates to be executed in Shenzhou spacecraft, Tiangong Space Laboratory and Chinese Space Station. In this talk, we will present some examples of the projects, which are being prepared and executed in the near future flight tasks. They are both basic and applied research, from discovery to technology.

Crew behavior and performance in space analog environments

Science.gov (United States)

Kanki, Barbara G.

1992-01-01

The objectives and the current status of the Crew Factors research program conducted at NASA-Ames Research Center are reviewed. The principal objectives of the program are to determine the effects of a broad class of input variables on crew performance and to provide guidance with respect to the design and management of crews assigned to future space missions. A wide range of research environments are utilized, including controlled experimental settings, high fidelity full mission simulator facilities, and fully operational field environments. Key group processes are identified, and preliminary data are presented on the effect of crew size, type, and structure on team performance.

Electrochemical DNA biosensor based on grafting-to mode of terminal deoxynucleoside transferase-mediated extension.

Science.gov (United States)

Chen, Jinyuan; Liu, Zhoujie; Peng, Huaping; Zheng, Yanjie; Lin, Zhen; Liu, Ailin; Chen, Wei; Lin, Xinhua

2017-12-15

Previously reported electrochemical DNA biosensors based on in-situ polymerization approach reveal that terminal deoxynucleoside transferase (TdTase) has good amplifying performance and promising application in the design of electrochemical DNA biosensor. However, this method, in which the background is significantly affected by the amount of TdTase, suffers from being easy to produce false positive result and poor stability. Herein, we firstly present a novel electrochemical DNA biosensor based on grafting-to mode of TdTase-mediated extension, in which DNA targets are polymerized in homogeneous solution and then hybridized with DNA probes on BSA-based DNA carrier platform. It is surprising to find that the background in the grafting-to mode of TdTase-based electrochemical DNA biosensor have little interference from the employed TdTase. Most importantly, the proposed electrochemical DNA biosensor shows greatly improved detection performance over the in-situ polymerization approach-based electrochemical DNA biosensor. Copyright © 2017 Elsevier B.V. All rights reserved.

VirtualSpace: A vision of a machine-learned virtual space environment

Science.gov (United States)

Bortnik, J.; Sarno-Smith, L. K.; Chu, X.; Li, W.; Ma, Q.; Angelopoulos, V.; Thorne, R. M.

2017-12-01

Space borne instrumentation tends to come and go. A typical instrument will go through a phase of design and construction, be deployed on a spacecraft for several years while it collects data, and then be decommissioned and fade into obscurity. The data collected from that instrument will typically receive much attention while it is being collected, perhaps in the form of event studies, conjunctions with other instruments, or a few statistical surveys, but once the instrument or spacecraft is decommissioned, the data will be archived and receive progressively less attention with every passing year. This is the fate of all historical data, and will be the fate of data being collected by instruments even at the present time. But what if those instruments could come alive, and all be simultaneously present at any and every point in time and space? Imagine the scientific insights, and societal gains that could be achieved with a grand (virtual) heliophysical observatory that consists of every current and historical mission ever deployed? We propose that this is not just fantasy but is imminently doable with the data currently available, with the present computational resources, and with currently available algorithms. This project revitalizes existing data resources and lays the groundwork for incorporating data from every future mission to expand the scope and refine the resolution of the virtual observatory. We call this project VirtualSpace: a machine-learned virtual space environment.

Overview of the Space Launch System Ascent Aeroacoustic Environment Test Program

Science.gov (United States)

Herron, Andrew J.; Crosby, William A.; Reed, Darren K.

2016-01-01

Characterization of accurate flight vehicle unsteady aerodynamics is critical for component and secondary structure vibroacoustic design. The Aerosciences Branch at the National Aeronautics and Space Administration (NASA) Marshall Space Flight Center has conducted a test at the NASA Ames Research Center (ARC) Unitary Plan Wind Tunnels (UPWT) to determine such ascent aeroacoustic environments for the Space Launch System (SLS). Surface static pressure measurements were also collected to aid in determination of local environments for venting, CFD substantiation, and calibration of the flush air data system located on the launch abort system. Additionally, this test supported a NASA Engineering and Safety Center study of alternate booster nose caps. Testing occurred during two test campaigns: August - September 2013 and December 2013 - January 2014. Four primary model configurations were tested for ascent aeroacoustic environment definition. The SLS Block 1 vehicle was represented by a 2.5% full stack model and a 4% truncated model. Preliminary Block 1B payload and manned configurations were also tested, using 2.5% full stack and 4% truncated models respectively. This test utilized the 11 x 11 foot transonic and 9 x 7 foot supersonic tunnel sections at the ARC UPWT to collect data from Mach 0.7 through 2.5 at various total angles of attack. SLS Block 1 design environments were developed primarily using these data. SLS Block 1B preliminary environments have also been prepared using these data. This paper discusses the test and analysis methodology utilized, with a focus on the unsteady data collection and processing.

A research on the excavation, support, and environment control of large scale underground space

Energy Technology Data Exchange (ETDEWEB)

Kang, Pil Chong; Kwon, Kwang Soo; Jeong, So Keul [Korea Institute of Geology Mining and Materials, Taejon (Korea, Republic of)

1995-12-01

With the growing necessity of the underground space due to the deficiency of above-ground space, the size and shape of underground structures tend to be complex and diverse. This complexity and variety force the development of new techniques for rock mass classification, excavation and supporting of underground space, monitoring and control of underground environment. All these techniques should be applied together to make the underground space comfortable. To achieve this, efforts have been made on 5 different areas; research on the underground space design and stability analysis, research on the techniques for excavation of rock by controlled blasting, research on the development of monitoring system to forecast the rock behaviour of underground space, research on the environment inspection system in closed space, and research on dynamic analysis of the airflow and environmental control in the large geos-spaces. The 5 main achievements are improvement of the existing structure analysis program(EXCRACK) to consider the deformation and failure characteristics of rock joints, development of new blasting design (SK-cut), prediction of ground vibration through the newly proposed wave propagation equation, development and In-Situ application of rock mass deformation monitoring system and data acquisition software, and trial manufacture of the environment inspection system in closed space. Should these techniques be applied to the development of underground space, prevention of industrial disaster, cut down of construction cost, domestication of monitoring system, improvement of tunnel stability, curtailment of royalty, upgrade of domestic technologies will be brought forth. (Abstract Truncated)

Robust online belief space planning in changing environments: Application to physical mobile robots

KAUST Repository

Agha-mohammadi, Ali-akbar

2014-05-01

© 2014 IEEE. Motion planning in belief space (under motion and sensing uncertainty) is a challenging problem due to the computational intractability of its exact solution. The Feedback-based Information RoadMap (FIRM) framework made an important theoretical step toward enabling roadmap-based planning in belief space and provided a computationally tractable version of belief space planning. However, there are still challenges in applying belief space planners to physical systems, such as the discrepancy between computational models and real physical models. In this paper, we propose a dynamic replanning scheme in belief space to address such challenges. Moreover, we present techniques to cope with changes in the environment (e.g., changes in the obstacle map), as well as unforeseen large deviations in the robot\\'s location (e.g., the kidnapped robot problem). We then utilize these techniques to implement the first online replanning scheme in belief space on a physical mobile robot that is robust to changes in the environment and large disturbances. This method demonstrates that belief space planning is a practical tool for robot motion planning.

Reproduction in the space environment: Part I. Animal reproductive studies

Science.gov (United States)

Santy, P. A.; Jennings, R. T.; Craigie, D.

1990-01-01

Mankind's exploration and colonization of the frontier of space will ultimately depend on men's and women's ability to live, work, and reproduce in the space environment. This paper reviews animal studies, from microorganisms to mammals, done in space or under space-simulated conditions, which identify some of the key areas which might interfere with human reproductive physiology and/or embryonic development. Those space environmental factors which impacted almost all species included: microgravity, artificial gravity, radiation, and closed life support systems. These factors may act independently and in combination to produce their effects. To date, there have been no studies which have looked at the entire process of reproduction in any animal species. This type of investigation will be critical in understanding and preventing the problems which will affect human reproduction. Part II will discuss these problems directly as they relate to human physiology.

Farming of Vegetables in Space-Limited Environments

Science.gov (United States)

He, Jie

2015-10-01

Vegetables that contain most of the essential components of human nutrition are perishable and cannot be stocked. To secure vegetable supply in space limited cities such as Singapore, there are different farming methods to produce vegetables. These include low-cost urban community gardening and innovative rooftop and vertical farms integrated with various technologies such as hydroponics, aquaponics and aeroponics. However, for large-scale vegetable production in space-limited Singapore, we need to develop farming systems that not only increase productivity many-fold per unit of land but also produce all types of vegetable, all year-round for today and the future. This could be resolved through integrated vertical aeroponic farming system. Manipulation of root-zone (RZ) environments such as cooling the RZ, modifying mineral nutrients and introducing elevated RZ CO2 using aeroponics can further boost crop productivity beyond what can be achieved from more efficient use of land area. We could also adopt energy saving light emitting diodes (LEDs) for vertical aeroponic farming system to promote uniform growth and to improve the utilisation of limited space via shortening the growth cycle, thus improving vegetable production in a cost-effective manner.

CosmoBon, tree research team, for studying utilization of woody plant in space environment

Science.gov (United States)

Tomita-Yokotani, Kaori; Yamashita, Masamichi; Hashimoto, Hirofumi; Sato, Seigo; Baba, Keiichi; Chida, Yukari

2012-07-01

We are proposing to raise woody plants in space for several applications and plant science, as Tree research team, TRT. Trees produce excess oxygen, wooden materials for living cabin, and provide biomass for cultivating mushroom and insect as for the space agriculture. Excellent tree shapes which would be deeply related to wood formation improve quality of life under stressful environment in outer space. We have the serious problem about their size. Bonsai is one of the Japanese traditional arts. We have been investigating the tension wood formation under exotic gravitational environment using Bonsai. CosmoBon is the small tree Bonsai for our space experiment. The tension wood formation in CosmoBon was confirmed as the same as that in the natural trees. Our goal is to examine feasibility to grow various species of trees in space as bioresource for space agriculture.

Studies of Earth Space Environment and Sudden Disappearances of Solar Prominences

National Research Council Canada - National Science Library

Huang, Tian-Sen

2005-01-01

With the support from AFOSR's Minority University Program, we worked on research of Sun-Earth space environment, conducted daily solar observation programs, improved solar instruments, and established...

Space Environment Modelling with the Use of Artificial Intelligence Methods

Science.gov (United States)

Lundstedt, H.; Wintoft, P.; Wu, J.-G.; Gleisner, H.; Dovheden, V.

1996-12-01

Space based technological systems are affected by the space weather in many ways. Several severe failures of satellites have been reported at times of space storms. Our society also increasingly depends on satellites for communication, navigation, exploration, and research. Predictions of the conditions in the satellite environment have therefore become very important. We will here present predictions made with the use of artificial intelligence (AI) techniques, such as artificial neural networks (ANN) and hybrids of AT methods. We are developing a space weather model based on intelligence hybrid systems (IHS). The model consists of different forecast modules, each module predicts the space weather on a specific time-scale. The time-scales range from minutes to months with the fundamental time-scale of 1-5 minutes, 1-3 hours, 1-3 days, and 27 days. Solar and solar wind data are used as input data. From solar magnetic field measurements, either made on the ground at Wilcox Solar Observatory (WSO) at Stanford, or made from space by the satellite SOHO, solar wind parameters can be predicted and modelled with ANN and MHD models. Magnetograms from WSO are available on a daily basis. However, from SOHO magnetograms will be available every 90 minutes. SOHO magnetograms as input to ANNs will therefore make it possible to even predict solar transient events. Geomagnetic storm activity can today be predicted with very high accuracy by means of ANN methods using solar wind input data. However, at present real-time solar wind data are only available during part of the day from the satellite WIND. With the launch of ACE in 1997, solar wind data will on the other hand be available during 24 hours per day. The conditions of the satellite environment are not only disturbed at times of geomagnetic storms but also at times of intense solar radiation and highly energetic particles. These events are associated with increased solar activity. Predictions of these events are therefore

Living with a Star (LWS) Space Environment Testbeds (SET), Mission Carrier Overview and Capabilities

Science.gov (United States)

Patschke, Robert; Barth, Janet; Label, Ken; Mariano, Carolyn; Pham, Karen; Brewer, Dana; Cuviello, Michael; Kobe, David; Wu, Carl; Jarosz, Donald

2004-01-01

NASA has initiated the Living With a Star (LWS) Program to develop the scientific understanding to address the aspects of the Connected Sun-Earth system that affect life and society. A goal of the program is to bridge the gap between science, engineering, and user application communities. This will enable future science, operational, and commercial objectives in space and atmospheric environments by improving engineering approaches to the accommodation and/or mitigation of the effects of solar variability on technological systems. The three program elements of the LWS Program are Science Missions; Targeted Research and Technology; and Space Environment Testbeds (SETS). SET is an ideal platform for small experiments performing research on space environment effects on technologies and on the mitigation of space weather effects. A short description of the LWS Program will be given, and the SET will be described in detail, giving the mission objectives, available carrier services, and upcoming flight opportunities.

The Effects of Space Environment on Wireless Communication Devices' Performance

OpenAIRE

Landon, Hillyard; Dennison, JR

2012-01-01

This project evaluates the effects of the space environment on small radio hardware devices called Bluetooth (a proprietary open wireless technology standard for exchanging data over short distances) chips (hoovers). When electronics are exposed to the harsh environment outside the Earth's atmosphere, they sometimes do not perform as expected. The USU Getaway Away Special (GAS) team is now in the design stages of launching a CubeSat (a 10 cm cubed autonomous satellite to fly in Low Earth Orbi...

Operational environments for electrical power wiring on NASA space systems

Science.gov (United States)

Stavnes, Mark W.; Hammoud, Ahmad N.; Bercaw, Robert W.

1994-01-01

Electrical wiring systems are used extensively on NASA space systems for power management and distribution, control and command, and data transmission. The reliability of these systems when exposed to the harsh environments of space is very critical to mission success and crew safety. Failures have been reported both on the ground and in flight due to arc tracking in the wiring harnesses, made possible by insulation degradation. This report was written as part of a NASA Office of Safety and Mission Assurance (Code Q) program to identify and characterize wiring systems in terms of their potential use in aerospace vehicles. The goal of the program is to provide the information and guidance needed to develop and qualify reliable, safe, lightweight wiring systems, which are resistant to arc tracking and suitable for use in space power applications. This report identifies the environments in which NASA spacecraft will operate, and determines the specific NASA testing requirements. A summary of related test programs is also given in this report. This data will be valuable to spacecraft designers in determining the best wiring constructions for the various NASA applications.

Healing environments in cancer treatment and care. Relations of space and practice in hematological cancer treatment

DEFF Research Database (Denmark)

Høybye, Mette Terp

2013-01-01

of the individual patient ’ s needs, values and experiences is key to developing the environment to support the patient quality of life. The present study holds implications for practice to inform design of future hospital environments for cancer treatment. The study points to the importance for being attentive...... these concepts, the study demonstrates how the hospital environment is a fl ow of relations between space and practice that changes and challenges a structural idea of design and healing. Patients ’ sense of healing changes with the experience of progression in treatment and the capacity of the hospital space...... to incite an experience of homeliness and care. Furthermore, cancer patients continuously challenge the use and limits of space by individual objects and practices of privacy and home. Discussion. Healing environments are complex relations between practices, space and care, where recognition...

CosmoBon for studying wood formation under exotic gravitational environment for future space agriculture

Science.gov (United States)

Tomita-Yokotani, Kaori; Baba, Keiichi; Suzuki, Toshisada; Funada, Ryo; Nakamura, Teruko; Hashimoto, Hirofumi; Yamashita, Masamichi; Cosmobon, Jstwg

We are proposing to raise woody plants in space for several applications and plant science. Japanese flowering cherry tree is one of a candidate for these studies. Mechanism behind sensing gravity and controlling shape of tree has been studied quite extensively. Even molecular mechanism for the response of plant against gravity has been investigated quite intensively for various species, woody plants are left behind. Morphology of woody branch growth is different from that of stem growth in herbs. Morphology in tree is strongly dominated by the secondary xylem formation. Nobody knows the tree shape grown under the space environment. If whole tree could be brought up to space as research materials, it might provide important scientific knowledge. Furthermore, trees produce excess oxygen, wooden materials for living cabin, and provide biomass for cultivating mushroom and insect as for the space agriculture. Excellent tree shapes which would be deeply related to wood formation improve quality of life under stressful environment in outer space. The serious problem would be their size. Bonsai is one of the Japanese traditional arts. We can study secondly xylem formation, wood formation, under exotic gravitational environment using Bonsai. "CosmoBon" is the small tree Bonsai for our space experiment. It has been recognized that the reaction wood in CosmoBon is formed similar to natural trees. Our goal is to examine feasibility to grow various species of trees in space as bioresource for space agriculture.

Comparison of Space Debris Environment Models: ORDEM2000, MASTER-2001, MASTER-2005 and MASTER-2009

OpenAIRE

Kanemitsu, Yuki; 赤星, 保浩; Akahoshi, Yasuhiro; 鳴海, 智博; Narumi, Tomohiro; Faure, Pauline; 松本, 晴久; Matsumoto, Haruhisa; 北澤, 幸人; Kitazawa, Yukihito

2012-01-01

Hypervelocity impact by space debris on spacecraft is one of the most important issues for space development and operation, especially considering the growing amount of space debris in recent years. It is therefore important for spacecraft design to evaluate the impact risk by using environment models. In this paper, the authors compared the results of the debris impact flux in low Earth orbit, as calculated by four debris environment engineering models -NASA's ORDEM2000 and ESA's MASTER-2001...

Simulation of the space debris environment in LEO using a simplified approach

Science.gov (United States)

Kebschull, Christopher; Scheidemann, Philipp; Hesselbach, Sebastian; Radtke, Jonas; Braun, Vitali; Krag, H.; Stoll, Enrico

2017-01-01

Several numerical approaches exist to simulate the evolution of the space debris environment. These simulations usually rely on the propagation of a large population of objects in order to determine the collision probability for each object. Explosion and collision events are triggered randomly using a Monte-Carlo (MC) approach. So in many different scenarios different objects are fragmented and contribute to a different version of the space debris environment. The results of the single Monte-Carlo runs therefore represent the whole spectrum of possible evolutions of the space debris environment. For the comparison of different scenarios, in general the average of all MC runs together with its standard deviation is used. This method is computationally very expensive due to the propagation of thousands of objects over long timeframes and the application of the MC method. At the Institute of Space Systems (IRAS) a model capable of describing the evolution of the space debris environment has been developed and implemented. The model is based on source and sink mechanisms, where yearly launches as well as collisions and explosions are considered as sources. The natural decay and post mission disposal measures are the only sink mechanisms. This method reduces the computational costs tremendously. In order to achieve this benefit a few simplifications have been applied. The approach of the model partitions the Low Earth Orbit (LEO) region into altitude shells. Only two kinds of objects are considered, intact bodies and fragments, which are also divided into diameter bins. As an extension to a previously presented model the eccentricity has additionally been taken into account with 67 eccentricity bins. While a set of differential equations has been implemented in a generic manner, the Euler method was chosen to integrate the equations for a given time span. For this paper parameters have been derived so that the model is able to reflect the results of the numerical MC

Application of Advanced Materials Protecting from Influence of Free Space Environment

Science.gov (United States)

Dotsenko, Oleg; Shovkoplyas, Yuriy

2016-07-01

High cost and low availability of the components certified for use in the space environment forces satellite designers to using industrial and even commercial items. Risks associated with insufficient knowledge about behavior of these components in radiation environment are parried, mainly, by careful radiating designing of a satellite where application of special protective materials with improved space radiation shielding characteristics is one of the most widely used practices. Another advantage of protective materials application appears when a satellite designer needs using equipment in more severe space environment conditions then it has been provided at the equipment development. In such cases only expensive repeated qualification of the equipment hardness can be alternative to protective materials application. But mostly this way is unacceptable for satellite developers, being within strong financial and temporal restrictions. To apply protective materials effectively, the developer should have possibility to answer the question: "Where inside a satellite shall I place these materials and what shall be their shape to meet the requirements on space radiation hardness with minimal mass and volume expenses?" At that, the minimum set of requirements on space radiation hardness include: ionizing dose, nonionizing dose, single events, and internal charging. The standard calculative models and experimental techniques, now in use for space radiation hardness assurance of a satellite are unsuitable for the problem solving in such formulation. The sector analysis methodology, widely used in satellite radiating designing, is applicable only for aluminium shielding and doesn't allow taking into account advantages of protective materials. The programs simulating transport of space radiations through a substance with the use of Monte-Carlo technique, such as GEANT4, FLUKA, HZETRN and others, are fully applicable in view of their capabilities; but time required for

DISILICIDE BASE REFRACTORY METAL COATINGS IN SPACE ENVIRONMENT

Energy Technology Data Exchange (ETDEWEB)

Bocarsly, Sidney I.

1963-03-15

Studies of probable effects of space environment exposure of Durak B'' (a Chromizing Corp. proprietary disilicide coating) coated Mo are described. It was concluded that, in a high-temperature environment, solar radiation will not affect the material system. Sputtering will not cause a structural problem, but it may cause a change in optical properties. Meteoroids may cause coating spalling and minimum to possibly total failure. Some protection system will probably be necessary. Vacuum will cause some coating evaporation. The rate will be temperature-dependent and probably of a low order. The possible problem area is that the evaporation appears to occur preferentially at crack sites. Ionized nitrogen and hydrogen may react with the coating and charge physical or mechanical properties. (A.G.W.)

Geostationary Communications Satellites as Sensors for the Space Weather Environment: Telemetry Event Identification Algorithms

Science.gov (United States)

Carlton, A.; Cahoy, K.

2015-12-01

Reliability of geostationary communication satellites (GEO ComSats) is critical to many industries worldwide. The space radiation environment poses a significant threat and manufacturers and operators expend considerable effort to maintain reliability for users. Knowledge of the space radiation environment at the orbital location of a satellite is of critical importance for diagnosing and resolving issues resulting from space weather, for optimizing cost and reliability, and for space situational awareness. For decades, operators and manufacturers have collected large amounts of telemetry from geostationary (GEO) communications satellites to monitor system health and performance, yet this data is rarely mined for scientific purposes. The goal of this work is to acquire and analyze archived data from commercial operators using new algorithms that can detect when a space weather (or non-space weather) event of interest has occurred or is in progress. We have developed algorithms, collectively called SEER (System Event Evaluation Routine), to statistically analyze power amplifier current and temperature telemetry by identifying deviations from nominal operations or other events and trends of interest. This paper focuses on our work in progress, which currently includes methods for detection of jumps ("spikes", outliers) and step changes (changes in the local mean) in the telemetry. We then examine available space weather data from the NOAA GOES and the NOAA-computed Kp index and sunspot numbers to see what role, if any, it might have played. By combining the results of the algorithm for many components, the spacecraft can be used as a "sensor" for the space radiation environment. Similar events occurring at one time across many component telemetry streams may be indicative of a space radiation event or system-wide health and safety concern. Using SEER on representative datasets of telemetry from Inmarsat and Intelsat, we find events that occur across all or many of

Space Shuttle Orbiter logistics - Managing in a dynamic environment

Science.gov (United States)

Renfroe, Michael B.; Bradshaw, Kimberly

1990-01-01

The importance and methods of monitoring logistics vital signs, logistics data sources and acquisition, and converting data into useful management information are presented. With the launch and landing site for the Shuttle Orbiter project at the Kennedy Space Center now totally responsible for its own supportability posture, it is imperative that logistics resource requirements and management be continually monitored and reassessed. Detailed graphs and data concerning various aspects of logistics activities including objectives, inventory operating levels, customer environment, and data sources are provided. Finally, some lessons learned from the Shuttle Orbiter project and logistics options which should be considered by other space programs are discussed.

Local structure and defect chemistry of [(SnSe)1.15]m(TaSe2) ferecrystals – A new type of layered intergrowth compound

International Nuclear Information System (INIS)

Grosse, Corinna; Atkins, Ryan; Kirmse, Holm; Mogilatenko, Anna; Neumann, Wolfgang; Johnson, David C.

2013-01-01

Highlights: •The crystal structure of [(SnSe) 1.15 ] m (TaSe 2 ) ferecrystals was analyzed by TEM. •The layers exhibit turbostratic disorder, but we also observed a local ordering. •The structures of the SnSe and TaSe 2 layers are similar to binary SnSe and 2H-TaSe 2 . •An increasing in-plane SnSe grain size with increasing m was observed. •Defect areas with missing, substituted or additional layers were found. -- Abstract: The atomic structure of the family of ferecrystals [(SnSe) 1.15 ] m (TaSe 2 ) (m = 1, 3, and 6) was investigated by means of transmission electron microscopy. The tantalum in the TaSe 2 layers was observed to have trigonal prismatic coordination similar to that found in the 2H polytype of bulk TaSe 2 . The structure of the SnSe constituent was found to be similar to that of orthorhombic α-SnSe. In the compounds with m = 1 and m = 3, regions with a local ordering of the layers along a commensurate axis, similar to the ordering in conventional misfit layer compounds, were observed. However, on a longer range the ferecrystals were found to exhibit a turbostratically disordered structure. Stacking defects were occasionally found in the samples in which a layer is interrupted and the surrounding layers are bent around these defects, while maintaining abrupt interfaces instead of interdiffusing. Volume defects were found in one sample of [(SnSe) 1.15 ] 1 (TaSe 2 ) 1 in which a SnSe layer locally substitutes a part of a TaSe 2 layer without interrupting the surrounding layers

Space Radiation Environment Prediction for VLSI microelectronics devices onboard a LEO Satellite using OMERE-Trad Software

Science.gov (United States)

Sajid, Muhammad

This tutorial/survey paper presents the assessment/determination of level of hazard/threat to emerging microelectronics devices in Low Earth Orbit (LEO) space radiation environment with perigee at 300 Km, apogee at 600Km altitude having different orbital inclinations to predict the reliability of onboard Bulk Built-In Current Sensor (BBICS) fabricated in 350nm technology node at OptMA Lab. UFMG Brazil. In this context, the various parameters for space radiation environment have been analyzed to characterize the ionizing radiation environment effects on proposed BBICS. The Space radiation environment has been modeled in the form of particles trapped in Van-Allen radiation belts(RBs), Energetic Solar Particles Events (ESPE) and Galactic Cosmic Rays (GCR) where as its potential effects on Device- Under-Test (DUT) has been predicted in terms of Total Ionizing Dose (TID), Single-Event Effects (SEE) and Displacement Damage Dose (DDD). Finally, the required mitigation techniques including necessary shielding requirements to avoid undesirable effects of radiation environment at device level has been estimated /determined with assumed standard thickness of Aluminum shielding. In order to evaluate space radiation environment and analyze energetic particles effects on BBICS, OMERE toolkit developed by TRAD was utilized.

Sensor Systems for Vehicle Environment Perception in a Highway Intelligent Space System

Science.gov (United States)

Tang, Xiaofeng; Gao, Feng; Xu, Guoyan; Ding, Nenggen; Cai, Yao; Ma, Mingming; Liu, Jianxing

2014-01-01

A Highway Intelligent Space System (HISS) is proposed to study vehicle environment perception in this paper. The nature of HISS is that a space sensors system using laser, ultrasonic or radar sensors are installed in a highway environment and communication technology is used to realize the information exchange between the HISS server and vehicles, which provides vehicles with the surrounding road information. Considering the high-speed feature of vehicles on highways, when vehicles will be passing a road ahead that is prone to accidents, the vehicle driving state should be predicted to ensure drivers have road environment perception information in advance, thereby ensuring vehicle driving safety and stability. In order to verify the accuracy and feasibility of the HISS, a traditional vehicle-mounted sensor system for environment perception is used to obtain the relative driving state. Furthermore, an inter-vehicle dynamics model is built and model predictive control approach is used to predict the driving state in the following period. Finally, the simulation results shows that using the HISS for environment perception can arrive at the same results detected by a traditional vehicle-mounted sensors system. Meanwhile, we can further draw the conclusion that using HISS to realize vehicle environment perception can ensure system stability, thereby demonstrating the method's feasibility. PMID:24834907

ORF Alignment: NC_002937 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available tase [Desulfovibrio vulgaris subsp. vulgaris str. ... Hildenborough] gb|AAS94860.1| thioredoxin reduc...tase ... [Desulfovibrio vulgaris subsp. vulgaris str. ... Hildenborough] ... Length = 29...7 ... Query: 4 ... AFDLIILGGGVAGMTSAIYAARANLRVLILDENACGGLVNWTKVVENMPSYTSIGGMELA 63 ... ... ... AFDLIILGGGVAGMTSAIYAARANLRVLILDENACGGLVNWTKVVENMPSYTSIGGMELA Sbjct: 1 ... AFDLIILGGGVAGMTSAIYAARANLRVLILDE

JPL Space Telecommunications Radio System Operating Environment

Science.gov (United States)

Lux, James P.; Lang, Minh; Peters, Kenneth J.; Taylor, Gregory H.; Duncan, Courtney B.; Orozco, David S.; Stern, Ryan A.; Ahten, Earl R.; Girard, Mike

2013-01-01

A flight-qualified implementation of a Software Defined Radio (SDR) Operating Environment for the JPL-SDR built for the CoNNeCT Project has been developed. It is compliant with the NASA Space Telecommunications Radio System (STRS) Architecture Standard, and provides the software infrastructure for STRS compliant waveform applications. This software provides a standards-compliant abstracted view of the JPL-SDR hardware platform. It uses industry standard POSIX interfaces for most functions, as well as exposing the STRS API (Application Programming In terface) required by the standard. This software includes a standardized interface for IP components instantiated within a Xilinx FPGA (Field Programmable Gate Array). The software provides a standardized abstracted interface to platform resources such as data converters, file system, etc., which can be used by STRS standards conformant waveform applications. It provides a generic SDR operating environment with a much smaller resource footprint than similar products such as SCA (Software Communications Architecture) compliant implementations, or the DoD Joint Tactical Radio Systems (JTRS).

Sustainable Shaping of Urban Spaces in the Context of the Environment

Directory of Open Access Journals (Sweden)

Joanna Agnieszka Pawłowicz

2017-11-01

Full Text Available The natural environment is of great importance when it comes to developing a city, as it shapes its spaces, defines its roles and performs climatic and protective functions. Industrialization often requires removing landscape obstacles and vegetation to erect new buildings. An urban planner, though, should be aware of the borders that must not be crossed. Designing new streets and buildings should follow a sustainable growth pattern, if the city landscape and its climatic conditions are to improve for generations to come. This paper discusses the aspects of planning and managing urban spaces in such a way as to provide their users with healthy and comfortable living conditions. The paper is based on a survey conducted to gather the opinions of members of a city community on the environment in which they live.

NASA Strategy to Safely Live and Work in the Space Radiation Environment

Science.gov (United States)

Cucinotta, Francis; Wu, Honglu; Corbin, Barbara; Sulzman, Frank; Kreneck, Sam

2007-01-01

This viewgraph document reviews the radiation environment that is a significant potential hazard to NASA's goals for space exploration, of living and working in space. NASA has initiated a Peer reviewed research program that is charged with arriving at an understanding of the space radiation problem. To this end NASA Space Radiation Laboratory (NSRL) was constructed to simulate the harsh cosmic and solar radiation found in space. Another piece of the work was to develop a risk modeling tool that integrates the results from research efforts into models of human risk to reduce uncertainties in predicting risk of carcinogenesis, central nervous system damage, degenerative tissue disease, and acute radiation effects acute radiation effects.

The Design Space of Multi-Language Development Environments

DEFF Research Database (Denmark)

Pfeiffer, Rolf-Helge; Wasowski, Andrzej

2014-01-01

Non-trivial software systems integrate many artifacts expressed in multiple modeling and program- ming languages. However, even though these artifacts heavily depend on each other, existing development envi- ronments do not sufficiently support handling relations between artifacts in different...... languages. By means of a literature survey, tool prototyping and experiments we study the design space of multi-language development environments (MLDEs)—tools that consider the cross-language relations as first artifacts. We ask: what is the state of the art in the MLDE space? What are the design choices...... and challenges faced by tool builders? To what extent MLDEs are desired by users, and for what support features? Our main conclusions are that (a) cross-language re- lations are ubiquitous and troublesome in multi-language systems, (b) users highly appreciated cross-language sup- port mechanisms of MLDEs and (c...

Designing new collaborative learning spaces in clinical environments: experiences from a children's hospital in Australia.

Science.gov (United States)

Bines, Julie E; Jamieson, Peter

2013-09-01

Hospitals are complex places that provide a rich learning environment for students, staff, patients and their families, professional groups and the community. The "new" Royal Children's Hospital opened in late 2011. Its mission is focused on improving health and well-being of children and adolescents through leadership in healthcare, research and education. Addressing the need to create "responsive learning environments" aligned with the shift to student-centred pedagogy, two distinct learning environments were developed within the new Royal Children's Hospital; (i) a dedicated education precinct providing a suite of physical environments to promote a more active, collaborative and social learning experience for education and training programs conducted on the Royal Children's Hospital campus and (ii) a suite of learning spaces embedded within clinical areas so that learning becomes an integral part of the daily activities of this busy Hospital environment. The aim of this article is to present the overarching educational principles that lead the design of these learning spaces and describe the opportunities and obstacles encountered in the development of collaborative learning spaces within a large hospital development.

Experience of Multisensory Environments in Public Space among People with Visual Impairment

Directory of Open Access Journals (Sweden)

Gavin R. Jenkins

2015-07-01

Full Text Available This qualitative study explored the role of sensory characteristics embedded in the built environment and whether they support or hinder people with visual impairment in their use of public spaces. An online survey link was e-mailed to the presidents and committee members of each state’s chapters and associations of the National Federation of the Blind in the United States, resulting in 451 direct invitations to participate. Written responses of the survey questions from 48 respondents with visual impairment were analyzed. Three main themes: Barriers, Supporters, and Context-Dependence emerged from the respondents’ experience of multisensory characteristics within the built environment. The four subthemes subsumed in Barriers were: (1 Population specific design, (2 Extreme sensory backgrounds, (3 Uneven ground surfaces and objects, and (4 Inconsistent lighting. For Supporters, respondents provided specific examples of various sensory characteristics in built environments, including audible cues and echoes, smells, tactile quality of the ground surface, and temperature. Context-Dependence referred to the effects of sensory characteristics embedded in public spaces depending on one’s vision condition, the proximity to the sensory cues and the purpose of the activities one was performing at that moment. Findings provide occupational therapy practitioners an in-depth understanding of the transactional relationship between embedded sensory characteristics in the built environment, occupations, and people with visual impairment in order to make appropriate modifications or removal of barriers that affect occupational performance and engagement. Suggestions for occupational therapists as well as architects, designers, planners, policy makers/legislators related to functional sensory cues in the design of built environments were provided to increase accessibility in the use of public spaces by people with visual impairment.

Experience of Multisensory Environments in Public Space among People with Visual Impairment.

Science.gov (United States)

Jenkins, Gavin R; Yuen, Hon K; Vogtle, Laura K

2015-07-23

This qualitative study explored the role of sensory characteristics embedded in the built environment and whether they support or hinder people with visual impairment in their use of public spaces. An online survey link was e-mailed to the presidents and committee members of each state's chapters and associations of the National Federation of the Blind in the United States, resulting in 451 direct invitations to participate. Written responses of the survey questions from 48 respondents with visual impairment were analyzed. Three main themes: Barriers, Supporters, and Context-Dependence emerged from the respondents' experience of multisensory characteristics within the built environment. The four subthemes subsumed in Barriers were: (1) Population specific design, (2) Extreme sensory backgrounds, (3) Uneven ground surfaces and objects, and (4) Inconsistent lighting. For Supporters, respondents provided specific examples of various sensory characteristics in built environments, including audible cues and echoes, smells, tactile quality of the ground surface, and temperature. Context-Dependence referred to the effects of sensory characteristics embedded in public spaces depending on one's vision condition, the proximity to the sensory cues and the purpose of the activities one was performing at that moment. Findings provide occupational therapy practitioners an in-depth understanding of the transactional relationship between embedded sensory characteristics in the built environment, occupations, and people with visual impairment in order to make appropriate modifications or removal of barriers that affect occupational performance and engagement. Suggestions for occupational therapists as well as architects, designers, planners, policy makers/legislators related to functional sensory cues in the design of built environments were provided to increase accessibility in the use of public spaces by people with visual impairment.

Carrier Plus: A sensor payload for Living With a Star Space Environment Testbed (LWS/SET)

Science.gov (United States)

Marshall, Cheryl J.; Moss, Steven; Howard, Regan; LaBel, Kenneth A.; Grycewicz, Tom; Barth, Janet L.; Brewer, Dana

2003-01-01

The Defense Threat Reduction Agency (DTR4) and National Aeronautics and Space Administration (NASA) Goddard Space Flight Center are collaborating to develop the Carrier Plus sensor experiment platform as a capability of the Space Environments Testbed (SET). The Space Environment Testbed (SET) provides flight opportunities for technology experiments as part of NASA's Living With a Star (LWS) program. The Carrier Plus will provide new capability to characterize sensor technologies such as state-of-the-art visible focal plane arrays (FPAs) in a natural space radiation environment. The technical objectives include on-orbit validation of recently developed FPA technologies and performance prediction methodologies, as well as characterization of the FPA radiation response to total ionizing dose damage, displacement damage and transients. It is expected that the sensor experiment will carry 4-6 FPAs and associated radiation correlative environment monitors (CEMs) for a 2006-2007 launch. Sensor technology candidates may include n- and p-charge coupled devices (CCDs), active pixel sensors (APS), and hybrid CMOS arrays. The presentation will describe the Carrier Plus goals and objectives, as well as provide details about the architecture and design. More information on the LWS program can be found at http://lws.gsfc.nasa.gov/. Business announcements for LWS/SET and program briefings are posted at http://lws-set.gsfc.nasa.gov

Adaptation of radiation shielding code to space environment

International Nuclear Information System (INIS)

Okuno, Koichi; Hara, Akihisa

1992-01-01

Recently, the trend to the development of space has heightened. To the development of space, many problems are related, and as one of them, there is the protection from cosmic ray. The cosmic ray is the radiation having ultrahigh energy, and there was not the radiation shielding design code that copes with cosmic ray so far. Therefore, the high energy radiation shielding design code for accelerators was improved so as to cope with the peculiarity that cosmic ray possesses. Moreover, the calculation of the radiation dose equivalent rate in the moon base to which the countermeasures against cosmic ray were taken was simulated by using the improved code. As the important countermeasures for the safety protection from radiation, the covering with regolith is carried out, and the effect of regolith was confirmed by using the improved code. Galactic cosmic ray, solar flare particles, radiation belt, the adaptation of the radiation shielding code HERMES to space environment, the improvement of the three-dimensional hadron cascade code HETCKFA-2 and the electromagnetic cascade code EGS 4-KFA, and the cosmic ray simulation are reported. (K.I.)

Operation of commercially-based microcomputer technology in a space radiation environment

Science.gov (United States)

Yelverton, J. N.

This paper focuses on detection and recovery techniques that should enable the reliable operation of commercially-based microprocessor technology in the harsh radiation environment of space and at high altitudes. This approach is especially significant in light of the current shift in emphasis (due to cost) from space hardened Class-S parts qualification to a more direct use of commercial parts. The method should offset some of the concern that the newer high density state-of-the-art RISC and CISC microprocessors can be used in future space applications. Also, commercial aviation, should benefit, since radiation induced transients are a new issue arising from the increased quantities of microcomputers used in aircraft avionics.

Habituation to novel visual vestibular environments with special reference to space flight

Science.gov (United States)

Young, L. R.; Kenyon, R. V.; Oman, C. M.

1981-01-01

The etiology of space motion sickness and the underlying physiological mechanisms associated with spatial orientation in a space environment were investigated. Human psychophysical experiments were used as the basis for the research concerning the interaction of visual and vestibular cues in the development of motion sickness. Particular emphasis is placed on the conflict theory in terms of explaining these interactions. Research on the plasticity of the vestibulo-ocular reflex is discussed.

Artificial intelligence and the space station software support environment

Science.gov (United States)

Marlowe, Gilbert

1986-01-01

In a software system the size of the Space Station Software Support Environment (SSE), no one software development or implementation methodology is presently powerful enough to provide safe, reliable, maintainable, cost effective real time or near real time software. In an environment that must survive one of the most harsh and long life times, software must be produced that will perform as predicted, from the first time it is executed to the last. Many of the software challenges that will be faced will require strategies borrowed from Artificial Intelligence (AI). AI is the only development area mentioned as an example of a legitimate reason for a waiver from the overall requirement to use the Ada programming language for software development. The limits are defined of the applicability of the Ada language Ada Programming Support Environment (of which the SSE is a special case), and software engineering to AI solutions by describing a scenario that involves many facets of AI methodologies.

Space Use in the Commons: Evaluating a Flexible Library Environment

Directory of Open Access Journals (Sweden)

Andrew D. Asher

2017-06-01

Full Text Available Abstract Objective – This article evaluates the usage and user experience of the Herman B Wells Library’s Learning Commons, a newly renovated technology and learning centre that provides services and spaces tailored to undergraduates’ academic needs at Indiana University Bloomington (IUB. Methods – A mixed-method research protocol combining time-lapse photography, unobtrusive observation, and random-sample surveys was employed to construct and visualize a representative usage and activity profile for the Learning Commons space. Results – Usage of the Learning Commons by particular student groups varied considerably from expectations based on student enrollments. In particular, business, first and second year students, and international students used the Learning Commons to a higher degree than expected, while humanities students used it to a much lower degree. While users were satisfied with the services provided and the overall atmosphere of the space, they also experienced the negative effects of insufficient space and facilities due to the space often operating at or near its capacity. Demand for collaboration rooms and computer workstations was particularly high, while additional evidence suggests that the Learning Commons furniture mix may not adequately match users’ needs. Conclusions – This study presents a unique approach to space use evaluation that enables researchers to collect and visualize representative observational data. This study demonstrates a model for quickly and reliably assessing space use for open-plan and learning-centred academic environments and for evaluating how well these learning spaces fulfill their institutional mission.

Do Inner Planets Modulate the Space Environment of the Earth?

Directory of Open Access Journals (Sweden)

Jung-Hee Kim

2014-03-01

Full Text Available Variabilities in the solar wind cause disturbances throughout the heliosphere on all temporal and spatial scales, which leads to changeable space weather. As a view of space weather forecasting, in particular, it is important to know direct and indirect causes modulating the space environment near the Earth in advance. Recently, there are discussions on a role of the interaction of the solar wind with Mercury in affecting the solar wind velocity in the Earth’s neighborhood during its inferior conjunctions. In this study we investigate a question of whether other parameters describing the space environment near the Earth are modulated by the inner planets’ wake, by examining whether the interplanetary magnetic field and the proton density in the solar wind observed by the Advanced Composition Explorer (ACE spacecraft, and the geomagnetic field via the Dst index and Auroral Electrojet index (AE index are dependent upon the relative position of the inner planets. We find there are indeed apparent variations. For example, the mean variations of the geomagnetic fields measured in the Earth’s neighborhood apparently have varied with a timescale of about 10 to 25 days. Those variations in the parameters we have studied, however, turn out to be a part of random fluctuations and have nothing to do with the relative position of inner planets. Moreover, it is found that variations of the proton density in the solar wind, the Dst index, and the AE index are distributed with the Gaussian distribution. Finally, we point out that some of properties in the behavior of the random fluctuation are to be studied.

Role of Green Spaces in Favorable Microclimate Creating in Urban Environment (Exemplified by Italian Cities)

Science.gov (United States)

Finaeva, O.

2017-11-01

The article represents a brief analysis of factors that influence the development of an urban green space system: territorial and climatic conditions, cultural and historical background as well as the modern strategy of historic cities development. The introduction defines the concept of urban greening, green spaces and green space distribution. The environmental parameters influenced by green spaces are determined. By the example of Italian cities the principles of the urban greening system development are considered: the historical aspects of formation of the urban greening system in Italian cities are analyzed, the role of green spaces in the formation of the urban environment structure and the creation of a favorable microclimate is determined, and a set of measures aimed at its improvement is highlighted. The modern principles of urban greening systems development and their characteristic features are considered. Special attention is paid to the interrelation of architectural and green structures in the formation of a favorable microclimate and psychological comfort in the urban environment; various methods of greening are considered by the example of existing architectural complexes depending on the climate of the area and the landscape features. The examples for the choice of plants and the application of compositional techniques are given. The results represent the basic principles of developing an urban green spaces system. The conclusion summarizes the techniques aimed at the microclimate improvement in the urban environment.

Vertebrate development in the environment of space: models, mechanisms, and use of the medaka

Science.gov (United States)

Wolgemuth, D. J.; Herrada, G.; Kiss, S.; Cannon, T.; Forsstrom, C.; Pranger, L. A.; Weismann, W. P.; Pearce, L.; Whalon, B.; Phillips, C. R.

1997-01-01

With the advent of space travel, it is of immediate interest and importance to study the effects of exposure to various aspects of the altered environment of space, including microgravity, on Earth-based life forms. Initial studies of space travel have focused primarily on the short-term effects of radiation and microgravity on adult organisms. However, with the potential for increased lengths of time in space, it is critical to now address the effects of space on all phases of an organism's life cycle, from embryogenesis to post-natal development to reproduction. It is already possible for certain species to undergo multiple generations within the confines of the Mir Space Station. The possibility now exists for scientists to consider the consequences of even potentially subtle defects in development through multiple phases of an organism's life cycle, or even through multiple generations. In this discussion, we highlight a few of the salient observations on the effects of the space environment on vertebrate development and reproductive function. We discuss some of the many unanswered questions, in particular, in the context of the choice of appropriate models in which to address these questions, as well as an assessment of the availability of hardware already existing or under development which would be useful in addressing these questions.

10th meeting of the International Conference on Protection of Materials and Structures from Space Environment

CERN Document Server

Tagawa, Masahito; Kimoto, Yugo; Protection of Materials and Structures From the Space Environment

2013-01-01

The goals of the 10th International Space Conference on “Protection of Materials and Structures from Space Environment” ICPMSE-10J, since its inception in 1992, have been to facilitate exchanges between members of the various engineering and science disciplines involved in the development of space materials, including aspects of LEO, GEO and Deep Space environments, ground-based qualification, and in-flight experiments and lessons learned from operational vehicles that are closely interrelated to disciplines of the atmospheric sciences, solar-terrestrial interactions and space life sciences. The knowledge of environmental conditions on and around the Moon, Mars, Venus and the low Earth orbit as well as other possible candidates for landing such as asteroids have become an important issue, and protecting both hardware and human life from the effects of space environments has taken on a new meaning in light of the increased interest in space travel and colonization of other planets.  And while many materia...

Space Radiation Peculiarities in the Extra Vehicular Environment of the International Space Station (ISS)

Science.gov (United States)

Dachev, Tsvetan; Bankov, Nikolay; Tomov, Borislav; Matviichuk, Yury; Dimitrov, Plamen

2013-12-01

The space weather and the connected with it ionizing radiation were recognized as a one of the main health concern to the International Space Station (ISS) crew. Estimation the effects of radiation on humans in ISS requires at first order accurate knowledge of the accumulated by them absorbed dose rates, which depend of the global space radiation distribution and the local variations generated by the 3D surrounding shielding distribution. The R3DE (Radiation Risks Radiometer-Dosimeter (R3D) for the EXPOSE-E platform on the European Technological Exposure Facility (EuTEF) worked successfully outside of the European Columbus module between February 2008 and September 2009. Very similar instrument named R3DR for the EXPOSE-R platform worked outside Russian Zvezda module of ISS between March 2009 and August 2010. Both are Liulin type, Bulgarian build miniature spectrometers-dosimeters. They accumulated about 5 million measurements of the flux and absorbed dose rate with 10 seconds resolution behind less than 0.41 g cm-2 shielding, which is very similar to the Russian and American space suits [1-3] average shielding. That is why all obtained data can be interpreted as possible doses during Extra Vehicular Activities (EVA) of the cosmonauts and astronauts. The paper first analyses the obtained long-term results in the different radiation environments of: Galactic Cosmic Rays (GCR), inner radiation belt trapped protons in the region of the South Atlantic Anomaly (SAA) and outer radiation belt (ORB) relativistic electrons. The large data base was used for development of an empirical model for calculation of the absorbed dose rates in the extra vehicular environment of ISS at 359 km altitude. The model approximate the averaged in a grid empirical dose rate values to predict the values at required from the user geographical point, station orbit or area in geographic coordinate system. Further in the paper it is presented an intercomparison between predicted by the model dose

Process material management in the Space Station environment

Science.gov (United States)

Perry, J. L.; Humphries, W. R.

1988-01-01

The Space Station will provide a unique facility for conducting material-processing and life-science experiments under microgravity conditions. These conditions place special requirements on the U.S. Laboratory for storing and transporting chemicals and process fluids, reclaiming water from selected experiments, treating and storing experiment wastes, and providing vacuum utilities. To meet these needs and provide a safe laboratory environment, the Process Material Management System (PMMS) is being developed. Preliminary design requirements and concepts related to the PMMS are addressed, and the MSFC PMMS breadboard test facility and a preliminary plan for validating the overall system design are discussed.

Fast neutron irradiation tests of flash memories used in space environment at the ISIS spallation neutron source

Directory of Open Access Journals (Sweden)

C. Andreani

2018-02-01

Full Text Available This paper presents a neutron accelerated study of soft errors in advanced electronic devices used in space missions, i.e. Flash memories performed at the ChipIr and VESUVIO beam lines at the ISIS spallation neutron source. The two neutron beam lines are set up to mimic the space environment spectra and allow neutron irradiation tests on Flash memories in the neutron energy range above 10 MeV and up to 800 MeV. The ISIS neutron energy spectrum is similar to the one occurring in the atmospheric as well as in space and planetary environments, with intensity enhancements varying in the range 108- 10 9 and 106- 10 7 respectively. Such conditions are suitable for the characterization of the atmospheric, space and planetary neutron radiation environments, and are directly applicable for accelerated tests of electronic components as demonstrated here in benchmark measurements performed on flash memories.

Fast neutron irradiation tests of flash memories used in space environment at the ISIS spallation neutron source

Science.gov (United States)

Andreani, C.; Senesi, R.; Paccagnella, A.; Bagatin, M.; Gerardin, S.; Cazzaniga, C.; Frost, C. D.; Picozza, P.; Gorini, G.; Mancini, R.; Sarno, M.

2018-02-01

This paper presents a neutron accelerated study of soft errors in advanced electronic devices used in space missions, i.e. Flash memories performed at the ChipIr and VESUVIO beam lines at the ISIS spallation neutron source. The two neutron beam lines are set up to mimic the space environment spectra and allow neutron irradiation tests on Flash memories in the neutron energy range above 10 MeV and up to 800 MeV. The ISIS neutron energy spectrum is similar to the one occurring in the atmospheric as well as in space and planetary environments, with intensity enhancements varying in the range 108- 10 9 and 106- 10 7 respectively. Such conditions are suitable for the characterization of the atmospheric, space and planetary neutron radiation environments, and are directly applicable for accelerated tests of electronic components as demonstrated here in benchmark measurements performed on flash memories.

Urban green spaces assessment approach to health, safety and environment

Directory of Open Access Journals (Sweden)

B. Akbari Neisiani

2016-04-01

Full Text Available The city is alive with dynamic systems, where parks and urban green spaces have high strategic importance which help to improve living conditions. Urban parks are used as visual landscape with so many benefits such as reducing stress, reducing air pollution and producing oxygen, creating opportunities for people to participate in physical activities, optimal environment for children and decreasing noise pollution. The importance of parks is such extent that are discussed as an indicator of urban development. Hereupon the design and maintenance of urban green spaces requires integrated management system based on international standards of health, safety and the environment. In this study, Nezami Ganjavi Park (District 6 of Tehran with the approach to integrated management systems have been analyzed. In order to identify the status of the park in terms of the requirements of the management system based on previous studies and all Tehran Municipality’s considerations, a check list has been prepared and completed by park survey and interview with green space experts. The results showed that the utility of health indicators were 92.33 % (the highest and environmental and safety indicators were 72 %, 84 % respectively. According to SWOT analysis in Nezami Ganjavi Park some of strength points are fire extinguishers, first aid box, annual testing of drinking water and important weakness is using unseparated trash bins also as an opportunities, there are some interesting factors for children and parents to spend free times. Finally, the most important threat is unsuitable park facilities for disabled.

Radiation and Internal Charging Environments for Thin Dielectrics in Interplanetary Space

Science.gov (United States)

Minow, Joseph I.; Parker, Linda Neergaard; Altstatt, Richard L.

2004-01-01

Spacecraft designs using solar sails for propulsion or thin membranes to shade instruments from the sun to achieve cryogenic operating temperatures are being considered for a number of missions in the next decades. A common feature of these designs are thin dielectric materials that will be exposed to the solar wind, solar energetic particle events, and the distant magnetotail plasma environments encountered by spacecraft in orbit about the Earth-Sun L2 point. This paper will discuss the relevant radiation and internal charging environments developed to support spacecraft design for both total dose radiation effects as well as dose rate dependent phenomenon, such as internal charging in the solar wind and distant magnetotail environments. We will describe the development of radiation and internal charging environment models based on nearly a complete solar cycle of Ulysses solar wind plasma measurements over a complete range of heliocentric latitudes and the early years of the Geotail mission where distant magnetotail plasma environments were sampled beyond X(sub GSE) = -100 Re to nearly L2 (X(sub GSE) -236 Re). Example applications of the environment models are shown to demonstrate the radiation and internal charging environments of thin materials exposed to the interplanetary space plasma environments.

A user interface development tool for space science systems Transportable Applications Environment (TAE) Plus

Science.gov (United States)

Szczur, Martha R.

1990-01-01

The Transportable Applications Environment Plus (TAE PLUS), developed at NASA's Goddard Space Flight Center, is a portable What You See Is What You Get (WYSIWYG) user interface development and management system. Its primary objective is to provide an integrated software environment that allows interactive prototyping and development that of user interfaces, as well as management of the user interface within the operational domain. Although TAE Plus is applicable to many types of applications, its focus is supporting user interfaces for space applications. This paper discusses what TAE Plus provides and how the implementation has utilized state-of-the-art technologies within graphic workstations, windowing systems and object-oriented programming languages.

Design and Implementation of a Space Environment Simulation Toolbox for Small Satellites

DEFF Research Database (Denmark)

Amini, Rouzbeh; Larsen, Jesper A.; Izadi-Zamanabadi, Roozbeh

This paper presents a developed toolbox for space environment model in SIMULINK that facilitates development and design of Attitude Determination and Control Systems (ADCS) for a Low Earth Orbit (LEO) spacecraft. The toolbox includes, among others, models of orbit propagators, disturbances, Earth...

On reflexivity of random walks in a random environment on a metric space

International Nuclear Information System (INIS)

Rozikov, U.A.

2002-11-01

In this paper, we consider random walks in random environments on a countable metric space when jumps of the walks of the fractions are finite. The transfer probabilities of the random walk from x is an element of G (where G is the considering metric space) are defined by vector p(x) is an element of R k , k>1, where {p(x), x is an element of G} is the set of independent and indentically distributed random vectors. For the random walk, a sufficient condition of nonreflexivity is obtained. Examples for metric spaces Z d free groups and free product of finite numbers cyclic groups of the second order and some other metric spaces are considered. (author)

Challenges for Transitioning Science Knowledge to an Operational Environment for Space Weather

Science.gov (United States)

Spann, James

2012-01-01

Effectively transitioning science knowledge to an operational environment relevant to space weather is critical to meet the civilian and defense needs, especially considering how technologies are advancing and present evolving susceptibilities to space weather impacts. The effort to transition scientific knowledge to a useful application is not a research task nor is an operational activity, but an effort that bridges the two. Successful transitioning must be an intentional effort that has a clear goal for all parties and measureable outcome and deliverable. This talk will present proven methodologies that have been demonstrated to be effective for terrestrial weather and disaster relief efforts, and how those methodologies can be applied to space weather transition efforts.

A Monte Carlo transport code study of the space radiation environment using FLUKA and ROOT

CERN Document Server

Wilson, T; Carminati, F; Brun, R; Ferrari, A; Sala, P; Empl, A; MacGibbon, J

2001-01-01

We report on the progress of a current study aimed at developing a state-of-the-art Monte-Carlo computer simulation of the space radiation environment using advanced computer software techniques recently available at CERN, the European Laboratory for Particle Physics in Geneva, Switzerland. By taking the next-generation computer software appearing at CERN and adapting it to known problems in the implementation of space exploration strategies, this research is identifying changes necessary to bring these two advanced technologies together. The radiation transport tool being developed is tailored to the problem of taking measured space radiation fluxes impinging on the geometry of any particular spacecraft or planetary habitat and simulating the evolution of that flux through an accurate model of the spacecraft material. The simulation uses the latest known results in low-energy and high-energy physics. The output is a prediction of the detailed nature of the radiation environment experienced in space as well a...

Growth of 48 built environment bacterial isolates on board the International Space Station (ISS

Directory of Open Access Journals (Sweden)

David A. Coil

2016-03-01

Full Text Available Background. While significant attention has been paid to the potential risk of pathogenic microbes aboard crewed spacecraft, the non-pathogenic microbes in these habitats have received less consideration. Preliminary work has demonstrated that the interior of the International Space Station (ISS has a microbial community resembling those of built environments on Earth. Here we report the results of sending 48 bacterial strains, collected from built environments on Earth, for a growth experiment on the ISS. This project was a component of Project MERCCURI (Microbial Ecology Research Combining Citizen and University Researchers on ISS. Results. Of the 48 strains sent to the ISS, 45 of them showed similar growth in space and on Earth using a relative growth measurement adapted for microgravity. The vast majority of species tested in this experiment have also been found in culture-independent surveys of the ISS. Only one bacterial strain showed significantly different growth in space. Bacillus safensis JPL-MERTA-8-2 grew 60% better in space than on Earth. Conclusions. The majority of bacteria tested were not affected by conditions aboard the ISS in this experiment (e.g., microgravity, cosmic radiation. Further work on Bacillus safensis could lead to interesting insights on why this strain grew so much better in space.

The Canadian Space Agency, Space Station, Strategic Technologies for Automation and Robotics Program technology development activity in protection of materials from the low Earth orbit space environment

Science.gov (United States)

Francoeur, J. R.

1992-01-01

The Strategic Technologies in Automation and Robotics (STEAR) program is managing a number of development contracts to improve the protection of spacecraft materials from the Low Earth Orbit (LEO) space environment. The project is structured in two phases over a 3 to 4 year period with a budget of 3 to 4 million dollars. Phase 1 is designed to demonstrate the technical feasibility and commercial potential of a coating/substrate system and its associated application process. The objective is to demonstrate a prototype fabrication capability using a full scale component of a commercially viable process for the protection of materials and surface finishes from the LEO space environment, and to demonstrate compliance with a set of performance requirements. Only phase 1 will be discussed in this paper.

Culture and error in space: implications from analog environments.

Science.gov (United States)

Helmreich, R L

2000-09-01

An ongoing study investigating national, organizational, and professional cultures in aviation and medicine is described. Survey data from 26 nations on 5 continents show highly significant national differences regarding appropriate relationships between leaders and followers, in group vs. individual orientation, and in values regarding adherence to rules and procedures. These findings replicate earlier research on dimensions of national culture. Data collected also isolate significant operational issues in multi-national flight crews. While there are no better or worse cultures, these cultural differences have operational implications for the way crews function in an international space environment. The positive professional cultures of pilots and physicians exhibit a high enjoyment of the job and professional pride. However, a negative component was also identified characterized by a sense of personal invulnerability regarding the effects of stress and fatigue on performance. This misperception of personal invulnerability has operational implications such as failures in teamwork and increased probability of error. A second component of the research examines team error in operational environments. From observational data collected during normal flight operations, new models of threat and error and their management were developed that can be generalized to operations in space and other socio-technological domains. Five categories of crew error are defined and their relationship to training programs in team performance, known generically as Crew Resource Management, is described. The relevance of these data for future spaceflight is discussed.

The space radiation environment

International Nuclear Information System (INIS)

Robbins, D.E.

1997-01-01

There are three primary sources of space radiation: galactic cosmic rays (GCR), trapped belt radiation, and solar particle events (SPE). All are composed of ions, the nuclei of atoms. Their energies range from a few MeV u -1 to over a GeV u -1 . These ions can fragment when they interact with spacecraft materials and produce energetic neutrons and ions of lower atomic mass. Absorbed dose rates inside a typical spacecraft (like the Space Shuttle) in a low inclination (28.5 degrees) orbit range between 0.05 and 2 mGy d -1 depending on the altitude and flight inclination (angle of orbit with the equator). The quality factor of radiation in orbit depends on the relative contributions of trapped belt radiation and GCR, and the dose rate varies both with orbital altitude and inclination. The corresponding equivalent dose rate ranges between 0.1 and 4 mSv d -1 . In high inclination orbits, like that of the Mir Space Station and as is planned for the International Space Station, blood-forming organ (BFO) equivalent dose rates as high as 1.5 mSv d -1 . Thus, on a 1 y mission, a crew member could obtain a total dose of 0.55 Sv. Maximum equivalent dose rates measured in high altitude passes through the South Atlantic Anomaly (SAA) were 10 mSv h -1 . For an interplanetary space mission (e.g., to Mars) annual doses from GCR alone range between 150 mSv y -1 at solar maximum and 580 mSv y -1 at solar minimum. Large SPE, like the October 1989 series, are more apt to occur in the years around solar maximum. In free space, such an event could contribute another 300 mSv, assuming that a warning system and safe haven can be effectively used with operational procedures to minimize crew exposures. Thus, the total dose for a 3 y mission to Mars could exceed 2 Sv

Enhanced Predictions of Time to Critical Dielectric Breakdown of Materials Under Prolonged Exposure to Space Plasma Environments

Data.gov (United States)

National Aeronautics and Space Administration — The leading cause of spacecraft failures and malfunctions due to interactions with the space plasma environment is electrostatic discharge (ESD). The enhanced time...

Challenges for Life Support Systems in Space Environments, Including Food Production

Science.gov (United States)

Wheeler, Raymond M.

2012-01-01

Environmental Control and Life Support Systems (ECLSS) refer to the technologies needed to sustain human life in space environments. Histor ically these technologies have focused on providing a breathable atmo sphere, clean water, food, managing wastes, and the associated monitoring capabilities. Depending on the space agency or program, ELCSS has sometimes expanded to include other aspects of managing space enviro nments, such as thermal control, radiation protection, fire detection I suppression, and habitat design. Other times, testing and providing these latter technologies have been associated with the vehicle engi neering. The choice of ECLSS technologies is typically driven by the mission profile and their associated costs and reliabilities. These co sts are largely defined by the mass, volume, power, and crew time req uirements. For missions close to Earth, e.g., low-Earth orbit flights, stowage and resupply of food, some 0 2, and some water are often the most cost effective option. But as missions venture further into spa ce, e.g., transit missions to Mars or asteroids, or surface missions to Moon or Mars, the supply line economics change and the need to clos e the loop on life support consumables increases. These are often ref erred to as closed loop or regenerative life support systems. Regardless of the technologies, the systems must be capable of operating in a space environment, which could include micro to fractional g setting s, high radiation levels, and tightly closed atmospheres, including perhaps reduced cabin pressures. Food production using photosynthetic o rganisms such as plants by nature also provides atmospheric regenerat ion (e.g., CO2 removal and reduction, and 0 2 production), yet to date such "bioregenerative" technologies have not been used due largely t o the high power requirements for lighting. A likely first step in te sting bioregenerative capabilities will involve production of small a mounts of fresh foods to supplement to crew

Conceptual Design and Demonstration of Space Scale for Measuring Mass in Microgravity Environment

Directory of Open Access Journals (Sweden)

Youn-Kyu Kim

2015-12-01

Full Text Available In this study, a new idea for developing a space scale for measuring mass in a microgravity environment was proposed by using the inertial force properties of an object to measure its mass. The space scale detected the momentum change of the specimen and reference masses by using a load-cell sensor as the force transducer based on Newton’s laws of motion. In addition, the space scale calculated the specimen mass by comparing the inertial forces of the specimen and reference masses in the same acceleration field. By using this concept, a space scale with a capacity of 3 kg based on the law of momentum conservation was implemented and demonstrated under microgravity conditions onboard International Space Station (ISS with an accuracy of ±1 g. By the performance analysis on the space scale, it was verified that an instrument with a compact size could be implemented and be quickly measured with a reasonable accuracy under microgravity conditions.

Development and Application of a Wireless Sensor for Space Charge Density Measurement in an Ultra-High-Voltage, Direct-Current Environment.

Science.gov (United States)

Xin, Encheng; Ju, Yong; Yuan, Haiwen

2016-10-20

A space charge density wireless measurement system based on the idea of distributed measurement is proposed for collecting and monitoring the space charge density in an ultra-high-voltage direct-current (UHVDC) environment. The proposed system architecture is composed of a number of wireless nodes connected with space charge density sensors and a base station. The space charge density sensor based on atmospheric ion counter method is elaborated and developed, and the ARM microprocessor and Zigbee radio frequency module are applied. The wireless network communication quality and the relationship between energy consumption and transmission distance in the complicated electromagnetic environment is tested. Based on the experimental results, the proposed measurement system demonstrates that it can adapt to the complex electromagnetic environment under the UHVDC transmission lines and can accurately measure the space charge density.

Preserving the Near-Earth Space Environment with Green Engineering and Operations

Science.gov (United States)

Johnson, Nicholas L.

2009-01-01

Green engineering and operations are essential to preserving the near-Earth space environment for future generations. The U.S. and the international aerospace community have been proactive in addressing the threat of the increasing orbital debris population and the risks to people and property from reentering debris. NASA has led this activity first by devoting resources to thoroughly understand the technical issues and then by developing effective and acceptable policies and guidelines. NASA also worked closely with the international community to ensure that the US aerospace industry was not placed at an economic disadvantage. In the long term, the removal of large orbital debris will be essential to the sustainability of space operations.

Innovative Learning Environments and New Materialism: A Conjunctural Analysis of Pedagogic Spaces

Science.gov (United States)

Charteris, Jennifer; Smardon, Dianne; Nelson, Emily

2017-01-01

An Organisation for Economic Cooperation and Development research priority, innovative learning environments (ILEs) have been translated into policy and practice in 25 countries around the world. In Aotearoa/New Zealand, learning spaces are being reconceptualised in relation to this policy work by school leaders who are confronted by an impetus to…

Robust online belief space planning in changing environments: Application to physical mobile robots

KAUST Repository

Agha-mohammadi, Ali-akbar; Agarwal, Saurav; Mahadevan, Aditya; Chakravorty, Suman; Tomkins, Daniel; Denny, Jory; Amato, Nancy M.

2014-01-01

, such as the discrepancy between computational models and real physical models. In this paper, we propose a dynamic replanning scheme in belief space to address such challenges. Moreover, we present techniques to cope with changes in the environment (e.g., changes

Effects of a Green Space Layout on the Outdoor Thermal Environment at the Neighborhood Level

Directory of Open Access Journals (Sweden)

Chi-Ming Lai

2012-09-01

Full Text Available This study attempted to address the existing urban design needs and computer-aided thermal engineering and explore the optimal green space layout to obtain an acceptable thermal environment at the neighborhood scale through a series of building energy and computational fluid dynamics (CFD simulations. The building-energy analysis software eQUEST and weather database TMY2 were adopted to analyze the electric energy consumed by air conditioners and the analysis results were incorporated to derive the heat dissipated from air conditioners. Then, the PHOENICS CFD software was used to analyze how the green space layout influences outdoor thermal environment based on the heat dissipated from air conditioners and the solar heat reemitted from the built surfaces. The results show that a green space located in the center of this investigated area and at the far side of the downstream of a summer monsoon is the recommended layout. The layouts, with green space in the center, can decrease the highest temperature by 0.36 °C.

Workshop on Two-Phase Fluid Behavior in a Space Environment

Science.gov (United States)

Swanson, Theodore D. (Editor); Juhasz, AL (Editor); Long, W. Russ (Editor); Ottenstein, Laura (Editor)

1989-01-01

The Workshop was successful in achieving its main objective of identifying a large number of technical issues relating to the design of two-phase systems for space applications. The principal concern expressed was the need for verified analytical tools that will allow an engineer to confidently design a system to a known degree of accuracy. New and improved materials, for such applications as thermal storage and as heat transfer fluids, were also identified as major needs. In addition to these research efforts, a number of specific hardware needs were identified which will require development. These include heat pumps, low weight radiators, advanced heat pipes, stability enhancement devices, high heat flux evaporators, and liquid/vapor separators. Also identified was the need for a centralized source of reliable, up-to-date information on two-phase flow in a space environment.

Control of the Onboard Microgravity Environment and Extension of the Service Life of the Long-Term Space Station

Science.gov (United States)

Titov, V. A.

2018-03-01

The problem of control of the on-board microgravity environment in order to extend the service life of the long-term space station has been discussed. Software developed for the ISS and the results of identifying dynamic models and external impacts based on telemetry data have been presented. Proposals for controlling the onboard microgravity environment for future long-term space stations have been formulated.

CliniSpace: a multiperson 3D online immersive training environment accessible through a browser.

Science.gov (United States)

Dev, Parvati; Heinrichs, W LeRoy; Youngblood, Patricia

2011-01-01

Immersive online medical environments, with dynamic virtual patients, have been shown to be effective for scenario-based learning (1). However, ease of use and ease of access have been barriers to their use. We used feedback from prior evaluation of these projects to design and develop CliniSpace. To improve usability, we retained the richness of prior virtual environments but modified the user interface. To improve access, we used a Software-as-a-Service (SaaS) approach to present a richly immersive 3D environment within a web browser.

Heliosheath Space Environment Interactions with Icy Bodies in the Outermost Solar System

Science.gov (United States)

Cooper, John F.; Hill, Matthew E.; Richardson, John D.; Sturner, Steven J.

2006-01-01

The Voyager 1 and 2 spacecraft are exploring the space environment of the outermost solar system at the same time that earth-based astronomy continues to discover new icy bodies, one larger than Pluto, in the transitional region outward from the Classical Kuiper Belt to the Inner Oort Cloud. Some of the Scattered Disk Objects in this region periodically pass through the heliosheath, entered by Voyager 1 in Dec. 2004 and later expected to be reached by Voyager 2, and out even beyond the heliopause into the Very Local Interstellar Medium. The less energetic heliosheath ions, important for implantation and sputtering processes, are abundant near and beyond the termination shock inner boundary, but the source region of the more penetrating anomalous cosmic ray component has not yet been found. Advantageous for modeling of icy body interactions, the measured heliosheath flux spectra are relatively more stable within this new regime of isotropic compressional magnetic turbulence than in the upstream heliospheric environment. The deepest interactions and resultant radiation-induced chemistry arise from the inwardly diffusing component of the galactic cosmic ray ions with significant intensity modulation also arising in the heliosheath beyond Voyager 1. Surface gardening by high-velocity impacts of smaller bodies (e.g., fragments of previous KBO collisions) and dust is a further space weathering process setting the time scales for long term exposure of different regolith layers to the ion irradiation. Sputtering and ionization of impact ejecta grains may provide a substantial feedback of pickup ions for multiple cycles of heliosheath acceleration and icy body interaction. Thus the space weathering interactions are potentially of interest not only for effects on sensible surface composition of the icy bodies but also for evolution of the heliosheath plasma energetic ion, and neutral emission environment.

Considering the space environment

International Nuclear Information System (INIS)

Boudenot, J.C.; Fillon, T.; Barrillot, C.; Calvet, M.C.

1999-01-01

The high levels of radiation encountered in space and in the upper atmosphere can affect the onboard electronics in satellites, launch vehicles and aircraft. The main categories of radiation in space have been classified into four distinct types; radiation belts, solar flares, cosmic radiation and the solar wind. Most of the risk to modern electronic systems arises from heavy ions. In geostationary and low polar orbits, these originate mainly as protons from solar flares. In medium earth orbits, the main source is trapped protons and the South Atlantic anomaly. (authors)

From LDEF to a national Space Environment and Effects (SEE) program: A natural progression

Science.gov (United States)

Bowles, David E.; Calloway, Robert L.; Funk, Joan G.; Kinard, William H.; Levine, Arlene S.

1995-02-01

As the LDEF program draws to a close, it leaves in place the fundamental building blocks for a Space Environment and Effects (SEE) program. Results from LDEF data analyses and investigations now form a substantial core of knowledge on the long term effects of the space environment on materials, system and structures. In addition, these investigations form the basic structure of a critically-needed SEE archive and database system. An agency-wide effort is required to capture all elements of a SEE program to provide a more comprehensive and focused approach to understanding the space environment, determining the best techniques for both flight and ground-based experimentation, updating the models which predict both the environments and those effects on subsystems and spacecraft, and, finally, ensuring that this multitudinous information is properly maintained, and inserted into spacecraft design programs. Many parts and pieces of a SEE program already exist at various locations to fulfill specific needs. The primary purpose of this program, under the direction of the Office of Advanced Concepts and Technology (OACT) in NASA Headquarters, is to take advantage of these parts; apply synergisms where possible; identify and when possible fill-in gaps; coordinate and advocate a comprehensive SEE program. The SEE program must coordinate and support the efforts of well-established technical communities wherein the bulk of the work will continue to be done. The SEE program will consist of a NASA-led SEE Steering Committee, consisting of government and industry users, with the responsibility for coordination between technology developers and NASA customers; and Technical Working Groups with primary responsibility for program technical content in response to user needs. The Technical Working Groups are as follows: Materials and Processes; Plasma and Fields; Ionizing Radiation; Meteoroids and Orbital Debris; Neutral External Contamination; Thermosphere, Thermal, and Solar

OverView of Space Applications for Environment (SAFE) initiative

Science.gov (United States)

Hamamoto, Ko; Fukuda, Toru; Tajima, Yoshimitsu; Takeuchi, Wataru; Sobue, Shinichi; Nukui, Tomoyuki

2014-06-01

Climate change and human activities have a direc or indirect influence on the acceleration of environmental problems and natural hazards such as forest fires, draughts and floods in the Asia-Pacific countries. Satellite technology has become one of the key information sources in assessment, monitoring and mitigation of these disasters and related phenomenon. However, there are still gaps between science and application of satellite technology in real-world usage. Asia-Pacific Regional Space Agency Forum (APRSAF) recommended to initiate the Space Applications for Environment (SAFE) proposal providing opportunity to potential user agencies in the Asia Pacific region to develop prototype applications of satellite technology for number of key issues including forest resources management, coastal monitoring and management, agriculture and food security, water resource management and development user-friendly tools for application of satellite technology. This paper describes the overview of SAFE initiative and outcomes of two selected prototypes; agricultural drought monitoring in Indonesia and coastal management in Sri Lanka, as well as the current status of on-going prototypes.

OverView of Space Applications for Environment (SAFE) initiative

International Nuclear Information System (INIS)

Hamamoto, Ko; Fukuda, Toru; Nukui, Tomoyuki; Tajima, Yoshimitsu; Takeuchi, Wataru; Sobue, Shinichi

2014-01-01

Climate change and human activities have a direc or indirect influence on the acceleration of environmental problems and natural hazards such as forest fires, draughts and floods in the Asia-Pacific countries. Satellite technology has become one of the key information sources in assessment, monitoring and mitigation of these disasters and related phenomenon. However, there are still gaps between science and application of satellite technology in real-world usage. Asia-Pacific Regional Space Agency Forum (APRSAF) recommended to initiate the Space Applications for Environment (SAFE) proposal providing opportunity to potential user agencies in the Asia Pacific region to develop prototype applications of satellite technology for number of key issues including forest resources management, coastal monitoring and management, agriculture and food security, water resource management and development user-friendly tools for application of satellite technology. This paper describes the overview of SAFE initiative and outcomes of two selected prototypes; agricultural drought monitoring in Indonesia and coastal management in Sri Lanka, as well as the current status of on-going prototypes

Fiber-based laser MOPA transmitter packaging for space environment

Science.gov (United States)

Stephen, Mark; Yu, Anthony; Chen, Jeffrey; Numata, Kenji; Wu, Stewart; Gonzales, Brayler; Han, Lawrence; Fahey, Molly; Plants, Michael; Rodriguez, Michael; Allan, Graham; Abshire, James; Nicholson, Jeffrey; Hariharan, Anand; Mamakos, William; Bean, Brian

2018-02-01

NASA's Goddard Space Flight Center has been developing lidar to remotely measure CO2 and CH4 in the Earth's atmosphere. The ultimate goal is to make space-based satellite measurements with global coverage. We are working on maturing the technology readiness of a fiber-based, 1.57-micron wavelength laser transmitter designed for use in atmospheric CO2 remote-sensing. To this end, we are building a ruggedized prototype to demonstrate the required power and performance and survive the required environment. We are building a fiber-based master oscillator power amplifier (MOPA) laser transmitter architecture. The laser is a wavelength-locked, single frequency, externally modulated DBR operating at 1.57-micron followed by erbium-doped fiber amplifiers. The last amplifier stage is a polarization-maintaining, very-large-mode-area fiber with 1000 μm2 effective area pumped by a Raman fiber laser. The optical output is single-frequency, one microsecond pulses with >450 μJ pulse energy, 7.5 KHz repetition rate, single spatial mode, and < 20 dB polarization extinction.

Reactor Start-up and Control Methodologies: Consideration of the Space Radiation Environment

International Nuclear Information System (INIS)

Bragg-Sitton, Shannon M.; Holloway, James Paul

2004-01-01

The use of fission energy in space power and propulsion systems offers considerable advantages over chemical propulsion. Fission provides over six orders of magnitude higher energy density, which translates to higher vehicle specific impulse and lower specific mass. These characteristics enable the accomplishment of ambitious space exploration missions. The natural radiation environment in space provides an external source of protons and high energy, high Z particles that can result in the production of secondary neutrons through interactions in reactor structures. Initial investigation using MCNPX 2.5.b for proton transport through the SAFE-400 reactor indicates a secondary neutron net current of 1.4x107 n/s at the core-reflector interface, with an incoming current of 3.4x106 n/s due to neutrons produced in the Be reflector alone. This neutron population could provide a reliable startup source for a space reactor. Additionally, this source must be considered in developing a reliable control strategy during reactor startup, steady-state operation, and power transients. An autonomous control system is developed and analyzed for application during reactor startup, accounting for fluctuations in the radiation environment that result from changes in vehicle location (altitude, latitude, position in solar system) or due to temporal variations in the radiation field, as may occur in the case of solar flares. One proposed application of a nuclear electric propulsion vehicle is in a tour of the Jovian system, where the time required for communication to Earth is significant. Hence, it is important that a reactor control system be designed with feedback mechanisms to automatically adjust to changes in reactor temperatures, power levels, etc., maintaining nominal operation without user intervention. This paper will evaluate the potential use of secondary neutrons produced by proton interactions in the reactor vessel as a startup source for a space reactor and will present a

The Value of Biomedical Simulation Environments to Future Human Space Flight Missions

Science.gov (United States)

Mulugeta, Lealem; Myers, Jerry G.; Skytland, Nicholas G.; Platts, Steven H.

2010-01-01

With the ambitious goals to send manned missions to asteroids and onto Mars, substantial work will be required to ensure the well being of the men and women who will undertake these difficult missions. Unlike current International Space Station or Shuttle missions, astronauts will be required to endure long-term exposure to higher levels of radiation, isolation and reduced gravity. These new operation conditions will pose health risks that are currently not well understood and perhaps unanticipated. Therefore, it is essential to develop and apply advanced tools to predict, assess and mitigate potential hazards to astronaut health. NASA s Digital Astronaut Project (DAP) is working to develop and apply computational models of physiologic response to space flight operation conditions over various time periods and environmental circumstances. The collective application and integration of well vetted models assessing the physiology, biomechanics and anatomy is referred to as the Digital Astronaut. The Digital Astronaut simulation environment will serve as a practical working tool for use by NASA in operational activities such as the prediction of biomedical risks and functional capabilities of astronauts. In additional to space flight operation conditions, DAP s work has direct applicability to terrestrial biomedical research by providing virtual environments for hypothesis testing, experiment design, and to reduce animal/human testing. A practical application of the DA to assess pre and post flight responses to exercise is illustrated and the difficulty in matching true physiological responses is discussed.

Neighbourhood green space, social environment and mental health: an examination in four European cities.

NARCIS (Netherlands)

Ruijsbroek, A.; Mohnen, S.M.; Droomers, M.; Kruize, H.; Gidlow, C.; Grazuleviciene, R.; Andrusaityte, S.; Helbich, M.; Maas, J.; Nieuwenhuijsen, M.J.; Triguero-Mas, M.; Masterson, D.; Ellis, N.; Kempen, E. van; Hardyns, W.; Stronks, K.; Groenewegen, P.P.

2017-01-01

Objectives: This study examines the relationship between neighbourhood green space, the neighbourhood social environment (social cohesion, neighbourhood attachment, social contacts), and mental health in four European cities. Methods: The PHENOTYPE study was carried out in 2013 in Barcelona

Contamination Control Assessment of the World's Largest Space Environment Simulation Chamber

Science.gov (United States)

Snyder, Aaron; Henry, Michael W.; Grisnik, Stanley P.; Sinclair, Stephen M.

2012-01-01

The Space Power Facility s thermal vacuum test chamber is the largest chamber in the world capable of providing an environment for space simulation. To improve performance and meet stringent requirements of a wide customer base, significant modifications were made to the vacuum chamber. These include major changes to the vacuum system and numerous enhancements to the chamber s unique polar crane, with a goal of providing high cleanliness levels. The significance of these changes and modifications are discussed in this paper. In addition, the composition and arrangement of the pumping system and its impact on molecular back-streaming are discussed in detail. Molecular contamination measurements obtained with a TQCM and witness wafers during two recent integrated system tests of the chamber are presented and discussed. Finally, a concluding remarks section is presented.

Neighbourhood green space, social environment and mental health : an examination in four European cities

NARCIS (Netherlands)

Ruijsbroek, Annemarie; Mohnen, Sigrid M.; Droomers, Mariël; Kruize, Hanneke; Gidlow, Christopher; Gražulevičiene, Regina; Andrusaityte, Sandra; Maas, Jolanda; Nieuwenhuijsen, Mark J.; Triguero-Mas, Margarita; Masterson, Daniel; Ellis, Naomi; van Kempen, Elise; Hardyns, Wim; Stronks, Karien; Groenewegen, Peter P.

2017-01-01

Objectives: This study examines the relationship between neighbourhood green space, the neighbourhood social environment (social cohesion, neighbourhood attachment, social contacts), and mental health in four European cities. Methods: The PHENOTYPE study was carried out in 2013 in Barcelona (Spain),

A trajectory planning scheme for spacecraft in the space station environment. M.S. Thesis - University of California

Science.gov (United States)

Soller, Jeffrey Alan; Grunwald, Arthur J.; Ellis, Stephen R.

1991-01-01

Simulated annealing is used to solve a minimum fuel trajectory problem in the space station environment. The environment is special because the space station will define a multivehicle environment in space. The optimization surface is a complex nonlinear function of the initial conditions of the chase and target crafts. Small permutations in the input conditions can result in abrupt changes to the optimization surface. Since no prior knowledge about the number or location of local minima on the surface is available, the optimization must be capable of functioning on a multimodal surface. It was reported in the literature that the simulated annealing algorithm is more effective on such surfaces than descent techniques using random starting points. The simulated annealing optimization was found to be capable of identifying a minimum fuel, two-burn trajectory subject to four constraints which are integrated into the optimization using a barrier method. The computations required to solve the optimization are fast enough that missions could be planned on board the space station. Potential applications for on board planning of missions are numerous. Future research topics may include optimal planning of multi-waypoint maneuvers using a knowledge base to guide the optimization, and a study aimed at developing robust annealing schedules for potential on board missions.

Using the FLUKA Monte Carlo Code to Simulate the Interactions of Ionizing Radiation with Matter to Assist and Aid Our Understanding of Ground Based Accelerator Testing, Space Hardware Design, and Secondary Space Radiation Environments

Science.gov (United States)

Reddell, Brandon

2015-01-01

Designing hardware to operate in the space radiation environment is a very difficult and costly activity. Ground based particle accelerators can be used to test for exposure to the radiation environment, one species at a time, however, the actual space environment cannot be duplicated because of the range of energies and isotropic nature of space radiation. The FLUKA Monte Carlo code is an integrated physics package based at CERN that has been under development for the last 40+ years and includes the most up-to-date fundamental physics theory and particle physics data. This work presents an overview of FLUKA and how it has been used in conjunction with ground based radiation testing for NASA and improve our understanding of secondary particle environments resulting from the interaction of space radiation with matter.

Radiation Environment at LEO in the frame of Space Monitoring Data Center at Moscow State University - recent, current and future missions

Science.gov (United States)

Myagkova, Irina; Kalegaev, Vladimir; Panasyuk, Mikhail; Svertilov, Sergey; Bogomolov, Vitaly; Bogomolov, Andrey; Barinova, Vera; Barinov, Oleg; Bobrovnikov, Sergey; Dolenko, Sergey; Mukhametdinova, Ludmila; Shiroky, Vladimir; Shugay, Julia

2016-04-01

Radiation Environment of Near-Earth space is one of the most important factors of space weather. Space Monitoring Data Center of Moscow State University provides operational control of radiation conditions at Low Earth's Orbits (LEO) of the near-Earth space using data of recent (Vernov, CORONAS series), current (Meteor-M, Electro-L series) and future (Lomonosov) space missions. Internet portal of Space Monitoring Data Center of Skobeltsyn Institute of Nuclear Physics of Lomonosov Moscow State University (SINP MSU) http://swx.sinp.msu.ru/ provides possibilities to control and analyze the space radiation conditions in the real time mode together with the geomagnetic and solar activity including hard X-ray and gamma- emission of solar flares. Operational data obtained from space missions at L1, GEO and LEO and from the Earth's magnetic stations are used to represent radiation and geomagnetic state of near-Earth environment. The models of space environment that use space measurements from different orbits were created. Interactive analysis and operational neural network forecast services are based on these models. These systems can automatically generate alerts on particle fluxes enhancements above the threshold values, both for SEP and relativistic electrons of outer Earth's radiation belt using data from GEO and LEO as input. As an example of LEO data we consider data from Vernov mission, which was launched into solar-synchronous orbit (altitude 640 - 83 0 km, inclination 98.4°, orbital period about 100 min) on July 8, 2014 and began to receive scientific information since July 20, 2014. Vernov mission have provided studies of the Earth's radiation belt relativistic electron precipitation and its possible connection with atmosphere transient luminous events, as well as the solar hard X-ray and gamma-emission measurements. Radiation and electromagnetic environment monitoring in the near-Earth Space, which is very important for space weather study, was also realised

Neighbourhood green space, social environment and mental health: an examination in four European cities

NARCIS (Netherlands)

Ruijsbroek, Annemarie; Mohnen, Sigrid M.; Droomers, Mariël; Kruize, Hanneke; Gidlow, Christopher; Gražulevičiene, Regina; Andrusaityte, Sandra; Maas, Jolanda; Nieuwenhuijsen, Mark J.; Triguero-Mas, Margarita; Masterson, Daniel; Ellis, Naomi; van Kempen, Elise; Hardyns, Wim; Stronks, Karien; Groenewegen, Peter P.

2017-01-01

This study examines the relationship between neighbourhood green space, the neighbourhood social environment (social cohesion, neighbourhood attachment, social contacts), and mental health in four European cities. The PHENOTYPE study was carried out in 2013 in Barcelona (Spain), Stoke-on-Trent

Design for unusual environment (space). Complementary use of modelling and testing phases

International Nuclear Information System (INIS)

Cambiaghi, Danilo; Cambiaghi, Andrea

2004-01-01

Designing for space requires a great imagination effort from the designer. He must perceive that the stresses experimented by the facilities he is designing will be quite different in space (during the mission), in launch phase and on ground (before launch handling phase), and he must design for all such environmental conditions. Furthermore he must design for mechanical and thermal environment, which often lead to conflicting needs. Virtual models may help very much in balancing the conflicting requirements, but models must be validated to be reliable. Test phase help validating the models, but may overstress the items. The aim of the designer is to reach an efficient and safe design through a balanced use of creativity, modelling and testing

A universal mirror wave-mode threshold condition for non-thermal space plasma environments

Directory of Open Access Journals (Sweden)

M. P. Leubner

2002-01-01

Full Text Available Magnetic fluctuations are recognized in a large variety of space plasmas by increasingly high resolution, in situ observations as mirror wave mode structures. A typical requirement for the excitation of mirror modes is a dominant perpendicular pressure in a high-beta plasma environment. Contrary, we demonstrate from a realistic kinetic analysis how details of the velocity space distributions are of considerable significance for the instability threshold. Introducing the most common characteristics of observed ion and electron distributions by a mixed suprathermal-loss-cone, we derive a universal mirror instability criterion from an energy principle for collisionless plasmas. As a result, the transition from two temperature Maxwellians to realistic non-thermal features provides a strong source for the generation of mirror wave mode activity, reducing drastically the instability threshold. In particular, a number of space-related examples illuminate how the specific structure of the velocity space distribution dominates as a regulating excitation mechanism over the effects related to changes in the plasma parameters.

Effects of the Extraterrestrial Environment on Plants: Recommendations for Future Space Experiments for the MELiSSA Higher Plant Compartment

Directory of Open Access Journals (Sweden)

Silje A. Wolff

2014-05-01

Full Text Available Due to logistical challenges, long-term human space exploration missions require a life support system capable of regenerating all the essentials for survival. Higher plants can be utilized to provide a continuous supply of fresh food, atmosphere revitalization, and clean water for humans. Plants can adapt to extreme environments on Earth, and model plants have been shown to grow and develop through a full life cycle in microgravity. However, more knowledge about the long term effects of the extraterrestrial environment on plant growth and development is necessary. The European Space Agency (ESA has developed the Micro-Ecological Life Support System Alternative (MELiSSA program to develop a closed regenerative life support system, based on micro-organisms and higher plant processes, with continuous recycling of resources. In this context, a literature review to analyze the impact of the space environments on higher plants, with focus on gravity levels, magnetic fields and radiation, has been performed. This communication presents a roadmap giving directions for future scientific activities within space plant cultivation. The roadmap aims to identify the research activities required before higher plants can be included in regenerative life support systems in space.

Addressing Challenges to the Design & Test of Operational Lighting Environments for the International Space Station

Science.gov (United States)

Clark, Toni A.

2014-01-01

In our day to day lives, the availability of light, with which to see our environment, is often taken for granted. The designers of land based lighting systems use sunlight and artificial light as their toolset. The availability of power, quantity of light sources, and variety of design options are often unlimited. The accessibility of most land based lighting systems makes it easy for the architect and engineer to verify and validate their design ideas. Failures with an implementation, while sometimes costly, can easily be addressed by renovation. Consider now, an architectural facility orbiting in space, 260 miles above the surface of the earth. This human rated architectural facility, the International Space Station (ISS) must maintain operations every day, including life support and appropriate human comforts without fail. The facility must also handle logistics of regular shipments of cargo, including new passengers. The ISS requires accommodations necessary for human control of machine systems. Additionally, the ISS is a research facility and supports investigations performed inside and outside its livable volume. Finally, the facility must support remote operations and observations by ground controllers. All of these architectural needs require a functional, safe, and even an aesthetic lighting environment. At Johnson Space Center, our Habitability and Human Factors team assists our diverse customers with their lighting environment challenges, via physical test and computer based analysis. Because of the complexity of ISS operational environment, our team has learned and developed processes that help ISS operate safely. Because of the dynamic exterior lighting environment, uses computational modeling to predict the lighting environment. The ISS' orbit exposes it to a sunrise every 90 minutes, causing work surfaces to quickly change from direct sunlight to earthshine to total darkness. Proper planning of vehicle approaches, robotics operations, and crewed

Is green space in the living environment associated with people's feelings of social safety?

NARCIS (Netherlands)

Maas, J.; Spreeuwenberg, P.; Winsum-Westra, M. van; Verheij, R.A.; Vries, S. de; Groenewegen, P.P.

2009-01-01

The authors investigate whether the percentage of green space in people’s living environment affects their feelings of social safety positively or negatively. More specifically they investigate the extent to which this relationship varies between urban and rural areas, between groups in the

Is green space in the living environment associated with people's feelings of social safety?

NARCIS (Netherlands)

Maas, J.; Spreeuwenberg, P.; Winsum-Westra, M. van; Verheij, R.A.; Vries, S. de; Groenewegen, P.P.

2009-01-01

Abstract. The authors investigate whether the percentage of green space in people's living environ- ment affects their feelings of social safety positively or negatively. More specifically they investigate the extent to which this relationship varies between urban and rural areas, between groups in

Creating Welcoming Spaces for Lesbian, Gay, Bisexual, and Transgender (LGBT) Patients: An Evaluation of the Health Care Environment.

Science.gov (United States)

McClain, Zachary; Hawkins, Linda A; Yehia, Baligh R

2016-01-01

Health outcomes are affected by patient, provider, and environmental factors. Previous studies have evaluated patient-level factors; few focusing on environment. Safe clinical spaces are important for lesbian, gay, bisexual, and transgender (LGBT) communities. This study evaluates current models of LGBT health care delivery, identifies strengths and weaknesses, and makes recommendations for LGBT spaces. Models are divided into LGBT-specific and LGBT-embedded care delivery. Advantages to both models exist, and they provide LGBT patients different options of healthcare. Yet certain commonalities must be met: a clean and confidential system. Once met, LGBT-competent environments and providers can advocate for appropriate care for LGBT communities, creating environments where they would want to seek care.

Virtual environment navigation with look-around mode to explore new real spaces by people who are blind.

Science.gov (United States)

Lahav, Orly; Gedalevitz, Hadas; Battersby, Steven; Brown, David; Evett, Lindsay; Merritt, Patrick

2018-05-01

This paper examines the ability of people who are blind to construct a mental map and perform orientation tasks in real space by using Nintendo Wii technologies to explore virtual environments. The participant explores new spaces through haptic and auditory feedback triggered by pointing or walking in the virtual environments and later constructs a mental map, which can be used to navigate in real space. The study included 10 participants who were congenitally or adventitiously blind, divided into experimental and control groups. The research was implemented by using virtual environments exploration and orientation tasks in real spaces, using both qualitative and quantitative methods in its methodology. The results show that the mode of exploration afforded to the experimental group is radically new in orientation and mobility training; as a result 60% of the experimental participants constructed mental maps that were based on map model, compared with only 30% of the control group participants. Using technology that enabled them to explore and to collect spatial information in a way that does not exist in real space influenced the ability of the experimental group to construct a mental map based on the map model. Implications for rehabilitation The virtual cane system for the first time enables people who are blind to explore and collect spatial information via the look-around mode in addition to the walk-around mode. People who are blind prefer to use look-around mode to explore new spaces, as opposed to the walking mode. Although the look-around mode requires users to establish a complex collecting and processing procedure for the spatial data, people who are blind using this mode are able to construct a mental map as a map model. For people who are blind (as for the sighted) construction of a mental map based on map model offers more flexibility in choosing a walking path in a real space, accounting for changes that occur in the space.

Natural Hazards of the Space Environment

Science.gov (United States)

Evans, Steven W.; Kross, Dennis A. (Technical Monitor)

2000-01-01

Spacecraft in Low Earth Orbit (LEO) are subject to numerous environmental hazards. Here I'll briefly discuss three environment factors that pose acute threats to the survival of spacecraft systems and crew: atmospheric drag, impacts by meteoroids and orbital debris, and ionizing radiation. Atmospheric drag continuously opposes the orbital motion of a satellite, causing the orbit to decay. This decay will lead to reentry if not countered by reboost maneuvers. Orbital debris is a by-product of man's activities in space, and consists of objects ranging in size from miniscule paint chips to spent rocket stages and dead satellites. Ionizing radiation experienced in LEO has several components: geomagnetically trapped protons and electrons (Van Allen belts); energetic solar particles; galactic cosmic rays; and albedo neutrons. These particles can have several types of prompt harmful effects on equipment and crew, from single-event upsets, latchup, and burnout of electronics, to lethal doses to crew.All three types of prompt threat show some dependence on the solar activity cycle. Atmospheric drag mitigation and large debris avoidance require propulsive maneuvers. M/OD and ionizing radiation require some form of shielding for crew and sensitive equipment. Limiting exposure time is a mitigation technique for ionizing radiation and meteor streams.

Comparative proteomic analysis of rice after seed ground simulated radiation and spaceflight explains the radiation effects of space environment

Science.gov (United States)

Wang, Wei; Shi, Jinming; Liang, Shujian; Lei, Huang; Shenyi, Zhang; Sun, Yeqing

In previous work, we compared the proteomic profiles of rice plants growing after seed space-flights with ground controls by two-dimensional difference gel electrophoresis (2-D DIGE) and found that the protein expression profiles were changed after seed space environment exposures. Spaceflight represents a complex environmental condition in which several interacting factors such as cosmic radiation, microgravity and space magnetic fields are involved. Rice seed is in the process of dormant of plant development, showing high resistance against stresses, so the highly ionizing radiation (HZE) in space is considered as main factor causing biological effects to seeds. To further investigate the radiation effects of space environment, we performed on-ground simulated HZE particle radiation and compared between the proteomes of seed irra-diated plants and seed spaceflight (20th recoverable satellite) plants from the same rice variety. Space ionization shows low-dose but high energy particle effects, for searching the particle effects, ground radiations with the same low-dose (2mGy) but different liner energy transfer (LET) values (13.3KeV/µm-C, 30KeV/µm-C, 31KeV/µm-Ne, 62.2KeV/µm-C, 500Kev/µm-Fe) were performed; using 2-D DIGE coupled with clustering and principle component analysis (PCA) for data process and comparison, we found that the holistic protein expression patterns of plants irradiated by LET-62.2KeV/µm carbon particles were most similar to spaceflight. In addition, although space environment presents a low-dose radiation (0.177 mGy/day on the satellite), the equivalent simulated radiation dose effects should still be evaluated: radiations of LET-62.2KeV/µm carbon particles with different cumulative doses (2mGy, 20mGy, 200mGy, 2000mGy) were further carried out and resulted that the 2mGy radiation still shared most similar proteomic profiles with spaceflight, confirming the low-dose effects of space radiation. Therefore, in the protein expression level

Surgical Space Suits Increase Particle and Microbiological Emission Rates in a Simulated Surgical Environment.

Science.gov (United States)

Vijaysegaran, Praveen; Knibbs, Luke D; Morawska, Lidia; Crawford, Ross W

2018-05-01

The role of space suits in the prevention of orthopedic prosthetic joint infection remains unclear. Recent evidence suggests that space suits may in fact contribute to increased infection rates, with bioaerosol emissions from space suits identified as a potential cause. This study aimed to compare the particle and microbiological emission rates (PER and MER) of space suits and standard surgical clothing. A comparison of emission rates between space suits and standard surgical clothing was performed in a simulated surgical environment during 5 separate experiments. Particle counts were analyzed with 2 separate particle counters capable of detecting particles between 0.1 and 20 μm. An Andersen impactor was used to sample bacteria, with culture counts performed at 24 and 48 hours. Four experiments consistently showed statistically significant increases in both PER and MER when space suits are used compared with standard surgical clothing. One experiment showed inconsistent results, with a trend toward increases in both PER and MER when space suits are used compared with standard surgical clothing. Space suits cause increased PER and MER compared with standard surgical clothing. This finding provides mechanistic evidence to support the increased prosthetic joint infection rates observed in clinical studies. Copyright © 2017 Elsevier Inc. All rights reserved.

Development of a Radio Frequency Space Environment Path Emulator for Evaluating Spacecraft Ranging Hardware

Science.gov (United States)

Mitchell, Jason W.; Baldwin, Philip J.; Kurichh, Rishi; Naasz, Bo J.; Luquette, Richard J.

2007-01-01

The Formation Flying Testbed (FFTB) at the National Aeronautics and Space Administration (NASA) Goddard Space Flight Center (GSFC) provides a hardware-in-the-loop test environment for formation navigation and control. The facility is evolving as a modular, hybrid, dynamic simulation facility for end-to-end guidance, navigation and. control (GN&C) design and analysis of formation flying spacecraft. The core capabilities of the FFTB, as a platform for testing critical hardware and software algorithms in-the-loop, have expanded to include S-band Radio Frequency (RF) modems for inter-spacecraft communication and ranging. To enable realistic simulations that require RF ranging sensors for relative navigation, a mechanism is needed to buffer the RF signals exchanged between spacecraft that accurately emulates the dynamic environment through which the RF signals travel, including the effects of medium, moving platforms, and radiated power. The Path Emulator for RF Signals (PERFS), currently under development at NASA GSFC, provides this capability. The function and performance of a prototype device are presented.

CfDS attends the first meeting of the All-Party Parliamentary Astronomy and Space Environment Group

Science.gov (United States)

Mizon, B.

1999-06-01

This group first met on March 11th, 1999, as 'a forum for discussion to further parliamentary interest in astronomy and the space environment affecting terrestrial life and its climate; and to increase awareness of the social, political and philosophical implications of present and future space technologies connected with exploring and understanding the cosmos'. CfDS coordinator Bob Mizon attended the first meeting of the group.

Secondary electron emission and its role in the space environment

Science.gov (United States)

Němeček, Z.; Pavlů, J.; Richterová, I.; Šafránková, J.; Vaverka, J.

2018-01-01

The role of dust in the space environment is of increasing interest in recent years and also the fast development of fusion devices with a magnetic confinement brought new issues in the plasma-surface interaction. Among other processes, secondary electron emission plays an important role for dust charging in interplanetary space and its importance increases at and above the surfaces of airless bodies like planets, moons, comets or asteroids. A similar situation can be found in many industrial applications where the dust is a final product or an unintentional impurity. The present paper reviews the progress in laboratory investigations of the secondary emission process as well as an evolution of the modeling of the interaction of energetic electrons with dust grains of different materials and sizes. The results of the model are discussed in view of latest laboratory simulations and they are finally applied on the estimation of an interaction of the solar wind and magnetospheric plasmas with the dust attached to or levitating above the lunar surface.

Thermal System Upgrade of the Space Environment Simulation Test Chamber

Science.gov (United States)

Desai, Ashok B.

1997-01-01

The paper deals with the refurbishing and upgrade of the thermal system for the existing thermal vacuum test facility, the Space Environment Simulator, at NASA's Goddard Space Flight Center. The chamber is the largest such facility at the center. This upgrade is the third phase of the long range upgrade of the chamber that has been underway for last few years. The first phase dealt with its vacuum system, the second phase involved the GHe subsystem. The paper describes the considerations of design philosophy options for the thermal system; approaches taken and methodology applied, in the evaluation of the remaining "life" in the chamber shrouds and related equipment by conducting special tests and studies; feasibility and extent of automation, using computer interfaces and Programmable Logic Controllers in the control system and finally, matching the old components to the new ones into an integrated, highly reliable and cost effective thermal system for the facility. This is a multi-year project just started and the paper deals mainly with the plans and approaches to implement the project successfully within schedule and costs.

DEGAS: Dynamic Exascale Global Address Space Programming Environments

Energy Technology Data Exchange (ETDEWEB)

Demmel, James [Univ. of California, Berkeley, CA (United States)

2018-02-23

The Dynamic, Exascale Global Address Space programming environment (DEGAS) project will develop the next generation of programming models and runtime systems to meet the challenges of Exascale computing. The Berkeley part of the project concentrated on communication-optimal code generation to optimize speed and energy efficiency by reducing data movement. Our work developed communication lower bounds, and/or communication avoiding algorithms (that either meet the lower bound, or do much less communication than their conventional counterparts) for a variety of algorithms, including linear algebra, machine learning and genomics. The Berkeley part of the project concentrated on communication-optimal code generation to optimize speed and energy efficiency by reducing data movement. Our work developed communication lower bounds, and/or communication avoiding algorithms (that either meet the lower bound, or do much less communication than their conventional counterparts) for a variety of algorithms, including linear algebra, machine learning and genomics.

Robust free-space optical communication for indoor information environment

Science.gov (United States)

Nakada, Toyohisa; Itoh, Hideo; Kunifuji, Susumu; Nakashima, Hideyuki

2003-10-01

The purpose of our study is to establish a robust communication, while keeping security and privacy, between a handheld communicator and the surrounding information environment. From the viewpoint of low power consumption, we have been developing a reflectivity modulating communication module composed of a liquid crystal light modulator and a corner-reflecting mirror sheet. We installed a corner-reflecting sheet instead of light scattering sheet in a handheld videogame machine with a display screen with a reflection-type liquid crystal. Infrared (IR) LED illuminator attached next to the IR camera of a base station illuminates all the room, and the terminal send their data to the base station by switching ON and OFF of the reflected IR beam. Intensity of reflected light differs with the position and the direction of the terminal, and sometimes the intensity of OFF signal at a certain condition is brighter than that of ON signal at another condition. To improve the communication quality, use of machine learning technique is a possibility of the solution. In this paper, we compare various machine learning techniques for the purpose of free space optical communication, and propose a new algorithm that improves the robustness of the data link. Evaluation using an actual free-space communication system is also described.

The Revised Space Environment Models in CREME-MC: A Replacement for CREME96

Science.gov (United States)

Adams, James H., Jr.; Barghouty, Abdulnasser F.; Mendenhall, Marcus H.; Reed, Robert A.; Sierawski, Brian; Watts, John W.; Weller, Robert A.

2010-01-01

The CREME96 model has been available on the WWW for more than 10 years now. While principally for the estimation of radiation effects on spacecraft electronics, it contains space radiation environment models that have been used for instrument design calculations, estimation of instrumental background, estimation of radiation hazards and many other purposes. Because of the evolution of electronic part design we have found it necessary to revise CREME96, creating CREME-MC. As part of this revision, we are revising and extending the environmental models in CREME96. This talk will describe the revised radiation environment models that are being made available in CREME-MC

Characteristics of personal space during obstacle circumvention in physical and virtual environments.

Science.gov (United States)

Gérin-Lajoie, Martin; Richards, Carol L; Fung, Joyce; McFadyen, Bradford J

2008-02-01

It is not known how the flexible protective zone maintained around oneself during locomotion (personal space or PS; see [Gérin-Lajoie M, Richards CL, McFadyen BJ. The negotiation of stationary and moving obstructions during walking: anticipatory locomotor adaptations and preservation of personal space. Motor Control 2005;9:242-69]) is modulated with walking speed, whether both sides of the PS are symmetrical, and whether the circumvention of physical and virtual obstructions elicit the same use of such PS. Personal space was measured in ten adults as they circumvented a cylindrical obstacle that was stationary within their path. Both left and right passes were performed at natural self-selected, slow and fast walking speeds. The same circumvention task was also performed at natural speeds in an immersive virtual environment (VE) replicating the same obstruction scenario. The shape and size of PS were maintained across walking speeds, and a smaller PS was generally observed on the dominant side. The general shape and lateral bias of the PS were preserved in the VE while its size was slightly increased. The systematic behavior across walking speeds and types of environment and the lateral bias suggest that PS is used to control navigation. This study deepens our understanding of normal adaptive walking behavior and has implications for the development of better tools for the assessment and retraining of locomotor capacity in different populations, from people with walking deficits to elite athletes. Since the PS behavior was shown to be robust in the VE used for this study, the virtual reality technology is proposed as a promising platform for the development of such assessment and retraining applications.

The Joint Space Operations Center (JSpOC) Mission System (JMS) and the Advanced Research, Collaboration, and Application Development Environment (ARCADE)

Science.gov (United States)

Johnson, K.; Kim, R.; Echeverry, J.

Energy) and AFRL/RV (Space Vehicles) to create the Advanced Research, Collaboration, and Application Development Environment (ARCADE). The ARCADE formalizes capability development processes that hitherto have been ad hoc, slow to address the evolving space threat environment, and not easily repeatable. Therefore, the purpose of the ARCADE is to: (1) serve as a centralized testbed for all research and development (R&D) activities related to JMS applications, including algorithm development, data source exposure, service orchestration, and software services, and provide developers reciprocal access to relevant tools and data to accelerate technology development, (2) allow the JMS program to communicate user capability priorities and requirements to developers, (3) facilitate collaboration among developers who otherwise would not collaborate due to organizational, policy, or geographical barriers, and (4) support market research efforts by identifying outstanding performers that are available to shepherd into the formal transition process. Over the last several years Scitor Corporation has provided systems engineering support to the JMS Increment 3 Program Office, and has worked with AFRL/RV and AFRL/RD to create a high performance computing environment and SOA at both unclassified and classified levels that together allow developers to develop applications in an environment similar to the version of JMS currently in use by the JSpOC operators. Currently the ARCADE is operational in an unclassified environment via the High Performance Computing Modernization Program (HPCMP) Portal on DREN. The ARCADE also exists on SECRET and TOP SECRET environments on multiple networks. This presentation will cover the following topics: (1) Scitors role in shaping the ARCADE into its current form, (2) ARCADEs value proposition for potential technology developers, and (3) ARCADEs value proposition for the Government. These topics will be discussed by way of several case studies: a JMS

SPACE RADIATION ENVIRONMENT MONITORED BY KITSAT-1 AND KITSAT-2

Directory of Open Access Journals (Sweden)

Y. H. Shin

1996-06-01

Full Text Available The results of space radiation experiments carried out on board the first two Korean technology demonstration microsatellites are presented in this paper. The first satellite, KITSAT-1, launched in August 1992, carries a radiation monitoring payload called cosmic ray experiment(CRE for characterizing the low-earth orbit(LEO radiation environment. The CRE consists of two sub-systems: the cosmic particle experiment (CPE and the total dose experiment(TDE. In addition, single event upset(SEUrates of the program memory and the RAM disk are also monitored. The second satellite, KITSAT-2, launched in September 1993, carries a newly developed 32-bit on-board computer(OBC, KASCOM(KAIST satellite computer in addition to OBC186. SEUs ocurred in the KASCOM, as well as in the program memory and RAM disk memory, have been monitored since the beginning of the satellite operation. These two satellites, which are very similar in structures but different in orbits, provide a unique opportunity to study the effects of the radiation environment characterized by the orbit.

The Ionizing Radiation Environment on the International Space Station: Performance vs. Expectations for Avionics and Materials

Science.gov (United States)

Koontz, Steven L.; Boeder, Paul A.; Pankop, Courtney; Reddell, Brandon

2005-01-01

The role of structural shielding mass in the design, verification, and in-flight performance of International Space Station (ISS), in both the natural and induced orbital ionizing radiation (IR) environments, is reported.

The Ascent Study - Understanding the Market Environment for the Follow-on to the Space Shuttle

Science.gov (United States)

Webber, Derek

2002-01-01

The ASCENT Study - Understanding the Market Environment for the Follow-on to NASA's Marshall Space Flight Center in Huntsville, Alabama, awarded a contract (base plus option amounting to twenty months of analysis) to Futron Corporation in June 2001 to investigate the market environment, and explore the price elasticity attributes, relevant for the introduction of the Second Generation Reusable Launch Vehicle (the follow-on to the Space Shuttle) in the second decade of this century. This work is known as the ASCENT Study (Analysis of Space Concepts Enabled by New Transportation) and data collection covering a total of 42 different sectors took place during 2001. Modeling and forecasting activities for 26 of these markets (all of them international in nature) have been taking place throughout 2002, and the final results of the ASCENT Study, which include 20 year forecasts, are due by the end of January, 2003. This paper describes the markets being analyzed for the ASCENT Study, and includes some preliminary findings in terms of launch vehicle demand during the next 20 years, broken down by mass class and mission type. Amongst these markets are the potential public space travel opportunities. When completed, the final report of the ASCENT Study is expected to represent a significant reference document for all business development, financing and planning activities in the space industry for some time to come. One immediate use will be as a key factor in determining the cargo capability and launch rates to be used for designing the follow-on to the Space Shuttle. The Study will also provide NASA with a quantified indication of the extent to which the lower cost to orbit, made possible by a new class of launch vehicle, will bring into being new markets.

Solitary malignant schwanoma of para pharyngeal space-a case report and review of literature.

Science.gov (United States)

Hazarika, Produl

2003-10-01

Malignnant Schwannom is an aggressive tissue tumor that is more cnmitutnh found m assoiiatiun with Ion Recklinghausens disease. The solitary tumors although rarer have a better prognosis when compared to those associated witk tan Recklinghausens disease. Parupharyngeui tumors are rare and a majority af these are benign salivary or neurogenie tumors, A malignant Schwannoma at this site is very infrequent with only four earn reported so far. The tase of a 16 year old girl with a parapharynccal malignant Schwnnaomu is presented Jor its rarity and our experience in dealing with it. .A combined modallty oftretument with surttery, radiotherapy and chemotherapy Was used. Pertinent literature h revlewed.

Physics-based Space Weather Forecasting in the Project for Solar-Terrestrial Environment Prediction (PSTEP) in Japan

Science.gov (United States)

Kusano, K.

2016-12-01

Project for Solar-Terrestrial Environment Prediction (PSTEP) is a Japanese nation-wide research collaboration, which was recently launched. PSTEP aims to develop a synergistic interaction between predictive and scientific studies of the solar-terrestrial environment and to establish the basis for next-generation space weather forecasting using the state-of-the-art observation systems and the physics-based models. For this project, we coordinate the four research groups, which develop (1) the integration of space weather forecast system, (2) the physics-based solar storm prediction, (3) the predictive models of magnetosphere and ionosphere dynamics, and (4) the model of solar cycle activity and its impact on climate, respectively. In this project, we will build the coordinated physics-based model to answer the fundamental questions concerning the onset of solar eruptions and the mechanism for radiation belt dynamics in the Earth's magnetosphere. In this paper, we will show the strategy of PSTEP, and discuss about the role and prospect of the physics-based space weather forecasting system being developed by PSTEP.

Mitigating Stress and Supporting Health in Deprived Urban Communities: The Importance of Green Space and the Social Environment.

Science.gov (United States)

Ward Thompson, Catharine; Aspinall, Peter; Roe, Jenny; Robertson, Lynette; Miller, David

2016-04-22

Environment-health research has shown significant relationships between the quantity of green space in deprived urban neighbourhoods and people's stress levels. The focus of this paper is the nature of access to green space (i.e., its quantity or use) necessary before any health benefit is found. It draws on a cross-sectional survey of 406 adults in four communities of high urban deprivation in Scotland, United Kingdom. Self-reported measures of stress and general health were primary outcomes; physical activity and social wellbeing were also measured. A comprehensive, objective measure of green space quantity around each participant's home was also used, alongside self-report measures of use of local green space. Correlated Component Regression identified the optimal predictors for primary outcome variables in the different communities surveyed. Social isolation and place belonging were the strongest predictors of stress in three out of four communities sampled, and of poor general health in the fourth, least healthy, community. The amount of green space in the neighbourhood, and in particular access to a garden or allotment, were significant predictors of stress. Physical activity, frequency of visits to green space in winter months, and views from the home were predictors of general health. The findings have implications for public health and for planning of green infrastructure, gardens and public open space in urban environments.

Mitigating Stress and Supporting Health in Deprived Urban Communities: The Importance of Green Space and the Social Environment

Directory of Open Access Journals (Sweden)

Catharine Ward Thompson

2016-04-01

Full Text Available Environment-health research has shown significant relationships between the quantity of green space in deprived urban neighbourhoods and people’s stress levels. The focus of this paper is the nature of access to green space (i.e., its quantity or use necessary before any health benefit is found. It draws on a cross-sectional survey of 406 adults in four communities of high urban deprivation in Scotland, United Kingdom. Self-reported measures of stress and general health were primary outcomes; physical activity and social wellbeing were also measured. A comprehensive, objective measure of green space quantity around each participant’s home was also used, alongside self-report measures of use of local green space. Correlated Component Regression identified the optimal predictors for primary outcome variables in the different communities surveyed. Social isolation and place belonging were the strongest predictors of stress in three out of four communities sampled, and of poor general health in the fourth, least healthy, community. The amount of green space in the neighbourhood, and in particular access to a garden or allotment, were significant predictors of stress. Physical activity, frequency of visits to green space in winter months, and views from the home were predictors of general health. The findings have implications for public health and for planning of green infrastructure, gardens and public open space in urban environments.

Mitigating Stress and Supporting Health in Deprived Urban Communities: The Importance of Green Space and the Social Environment

Science.gov (United States)

Ward Thompson, Catharine; Aspinall, Peter; Roe, Jenny; Robertson, Lynette; Miller, David

2016-01-01

Environment-health research has shown significant relationships between the quantity of green space in deprived urban neighbourhoods and people’s stress levels. The focus of this paper is the nature of access to green space (i.e., its quantity or use) necessary before any health benefit is found. It draws on a cross-sectional survey of 406 adults in four communities of high urban deprivation in Scotland, United Kingdom. Self-reported measures of stress and general health were primary outcomes; physical activity and social wellbeing were also measured. A comprehensive, objective measure of green space quantity around each participant’s home was also used, alongside self-report measures of use of local green space. Correlated Component Regression identified the optimal predictors for primary outcome variables in the different communities surveyed. Social isolation and place belonging were the strongest predictors of stress in three out of four communities sampled, and of poor general health in the fourth, least healthy, community. The amount of green space in the neighbourhood, and in particular access to a garden or allotment, were significant predictors of stress. Physical activity, frequency of visits to green space in winter months, and views from the home were predictors of general health. The findings have implications for public health and for planning of green infrastructure, gardens and public open space in urban environments. PMID:27110803

Physics of the Space Environment

Science.gov (United States)

Vasyliünas, Vytenis M.

This book, one in the Cambridge Atmospheric and Space Science Series, joins a growing list of advanced-level textbooks in a field of study and research known under a variety of names: space plasma physics, solar-terrestrial or solar-planetary relations, space weather, or (the official name of the relevant AGU section) space physics and aeronomy. On the basis of graduate courses taught by the author in various departments at the University of Michigan, complete with problems and with appendices of physical constants and mathematical identities, this is indeed a textbook, systematic and severe in its approach. The book is divided into three parts, in length ratios of roughly 6:4:5. Part I, “Theoretical Description of Gases and Plasmas,” starts by writing down Maxwell's equations and the Lorentz transformation (no nonsense about any introductory material of a descriptive or historical nature) and proceeds through particle orbit theory, kinetics, and plasma physics with fluid and MHD approximations to waves, shocks, and energetic particle transport. Part II, “The Upper Atmosphere,” features chapters on the terrestrial upper atmosphere, airglow and aurora, and the ionosphere. Part III, “Sun-Earth Connection,” deals with the Sun, the solar wind, cosmic rays, and the terrestrial magnetosphere. The book thus covers, with two exceptions, just about all the topics of interest to Space Physics and Aeronomy scientists, and then some (the chapter on the Sun, for instance, briefly discusses also topics of the solar interior: thermonuclear energy generation, equilibrium structure, energy transfer, with a page or two on each). One exception reflects a strong geocentric bias: there is not one word in the main text on magnetospheres and ionospheres of other planets and their interaction with the solar wind (they are mentioned in a few problems). The other exception: the chapter on the terrestrial magnetosphere lacks a systematic exposition of the theory of

Space Suit Portable Life Support System (PLSS) 2.0 Unmanned Vacuum Environment Testing

Science.gov (United States)

Watts, Carly; Vogel, Matthew

2016-01-01

For the first time in more than 30 years, an advanced space suit Portable Life Support System (PLSS) design was operated inside a vacuum chamber representative of the flight operating environment. The test article, PLSS 2.0, was the second system-level integrated prototype of the advanced PLSS design, following the PLSS 1.0 Breadboard that was developed and tested throughout 2011. Whereas PLSS 1.0 included five technology development components with the balance the system simulated using commercial-off-the-shelf items, PLSS 2.0 featured first generation or later prototypes for all components less instrumentation, tubing and fittings. Developed throughout 2012, PLSS 2.0 was the first attempt to package the system into a flight-like representative volume. PLSS 2.0 testing included an extensive functional evaluation known as Pre-Installation Acceptance (PIA) testing, Human-in-the-Loop testing in which the PLSS 2.0 prototype was integrated via umbilicals to a manned prototype space suit for 19 two-hour simulated EVAs, and unmanned vacuum environment testing. Unmanned vacuum environment testing took place from 1/9/15-7/9/15 with PLSS 2.0 located inside a vacuum chamber. Test sequences included performance mapping of several components, carbon dioxide removal evaluations at simulated intravehicular activity (IVA) conditions, a regulator pressure schedule assessment, and culminated with 25 simulated extravehicular activities (EVAs). During the unmanned vacuum environment test series, PLSS 2.0 accumulated 378 hours of integrated testing including 291 hours of operation in a vacuum environment and 199 hours of simulated EVA time. The PLSS prototype performed nominally throughout the test series, with two notable exceptions including a pump failure and a Spacesuit Water Membrane Evaporator (SWME) leak, for which post-test failure investigations were performed. In addition to generating an extensive database of PLSS 2.0 performance data, achievements included requirements and

The Strategic Technologies for Automation and Robotics (STEAR) program: Protection of materials in the space environment subprogram

Science.gov (United States)

Schmidt, Lorne R.; Francoeur, J.; Aguero, Alina; Wertheimer, Michael R.; Klemberg-Sapieha, J. E.; Martinu, L.; Blezius, J. W.; Oliver, M.; Singh, A.

1995-01-01

Three projects are currently underway for the development of new coatings for the protection of materials in the space environment. These coatings are based on vacuum deposition technologies. The projects will go as far as the proof-of-concept stage when the commercial potential for the technology will be demonstrated on pilot-scale fabrication facilities in 1996. These projects are part of a subprogram to develop supporting technologies for automation and robotics technologies being developed under the Canadian Space Agency's STEAR Program, part of the Canadian Space Station Program.

Initial Efforts in Characterizing Radiation and Plasma Effects on Space Assets: Bridging the Space Environment, Engineering and User Community

Science.gov (United States)

Zheng, Y.; Ganushkina, N. Y.; Guild, T. B.; Jiggens, P.; Jun, I.; Mazur, J. E.; Meier, M. M.; Minow, J. I.; Pitchford, D. A.; O'Brien, T. P., III; Shprits, Y.; Tobiska, W. K.; Xapsos, M.; Rastaetter, L.; Jordanova, V. K.; Kellerman, A. C.; Fok, M. C. H.

2017-12-01

The Community Coordinated Modeling Center (CCMC) has been leading the community-wide model validation projects for many years. Such effort has been broadened and extended via the newly-launched International Forum for Space Weather Modeling Capabilities Assessment (https://ccmc.gsfc.nasa.gov/assessment/), Its objective is to track space weather models' progress and performance over time, which is critically needed in space weather operations. The Radiation and Plasma Effects Working Team is working on one of the many focused evaluation topics and deals with five different subtopics: Surface Charging from 10s eV to 40 keV electrons, Internal Charging due to energetic electrons from hundreds keV to several MeVs. Single Event Effects from solar energetic particles (SEPs) and galactic cosmic rays (GCRs) (several MeV to TeVs), Total Dose due to accumulation of doses from electrons (>100 KeV) and protons (> 1 MeV) in a broad energy range, and Radiation Effects from SEPs and GCRs at aviation altitudes. A unique aspect of the Radiation and Plasma Effects focus area is that it bridges the space environments, engineering and user community. This presentation will summarize the working team's progress in metrics discussion/definition and the CCMC web interface/tools to facilitate the validation efforts. As an example, tools in the areas of surface charging/internal charging will be demoed.

Characterization of a Prototype Radio Frequency Space Environment Path Emulator for Evaluating Spacecraft Ranging Hardware

Science.gov (United States)

Mitchell, Jason W.; Baldwin, Philip J.; Kurichh, Rishi; Naasz, Bo J.; Luquette, Richard J.

2007-01-01

The Formation Flying Testbed (FFTB) at the National Aeronautics and Space Administration (NASA) Goddard Space Flight Center (GSFC) provides a hardware-in-the-loop test environment for formation navigation and control. The facility is evolving as a modular, hybrid, dynamic simulation facility for end-to-end guidance, navigation and control (GN&C) design and analysis of formation flying spacecraft. The core capabilities of the FFTB, as a platform for testing critical hardware and software algorithms in-the-loop, have expanded to include S-band Radio Frequency (RF) modems for interspacecraft communication and ranging. To enable realistic simulations that require RF ranging sensors for relative navigation, a mechanism is needed to buffer the RF signals exchanged between spacecraft that accurately emulates the dynamic environment through which the RF signals travel, including the effects of the medium, moving platforms, and radiated power. The Path Emulator for Radio Frequency Signals (PERFS), currently under development at NASA GSFC, provides this capability. The function and performance of a prototype device are presented.

SPACE, COLOR AND QUALITY OF LIFE IN A NUBIAN ENVIRONMENT

Directory of Open Access Journals (Sweden)

Diana Kamel

2012-03-01

Full Text Available The Egyptian Nubians relocated after the construction of the High Dam South of Aswan to a completely different setting, adjusted with difficulty to their new environment and changed part of it to suit their needs. This paper is a longitudinal study; it deals with the issue of continuity in the patterns of lifestyle within the present Egyptian Nubian community. The aim is to seek evidence on such continuity and to explain the repercussions of previous socio-economic values on the actual residential built and lived-in environment. The methodology is based on earlier studies that were done before relocation and immediately after, also on site visits made by the authors to detect the current aspects of the built-environment. The field study focuses on changes made to the interior and exterior spaces, on the use of decorative patterns and color of the walls and on the residents’ lifestyle. The tools for data gathering are annotated photographs and semi-structured interviews. The cases are chosen from a random sample in one of the 33 villages that constitute the Kom-Ombo site – the village of Eneba (Aniba. Results show evidence of change in all investigated aspects with a slight continuity in some of the culturally related values.

The Space-Time Cube as part of a GeoVisual Analytics Environment to support the understanding of movement data

DEFF Research Database (Denmark)

Kveladze, Irma; Kraak, M. J.; van Elzakker, C. P. J. M.

2015-01-01

This paper reports the results of an empirical usability experiment on the performance of the space-time cube in a GeoVisual analytics environment. It was developed to explore movement data based on the requirements of human geographers. The interactive environment consists of multiple coordinated...

Piezoelectric PVDF materials performance and operation limits in space environments

International Nuclear Information System (INIS)

Dargaville, Tim Richard; Assink, Roger Alan; Clough, Roger Lee; Celina, Mathias Christopher

2004-01-01

Piezoelectric polymers based on polyvinylidene fluoride (PVDF) are of interest for large aperture space-based telescopes. Dimensional adjustments of adaptive polymer films are achieved via charge deposition and require a detailed understanding of the piezoelectric material responses which are expected to suffer due to strong vacuum UV, gamma, X-ray, energetic particles and atomic oxygen under low earth orbit exposure conditions. The degradation of PVDF and its copolymers under various stress environments has been investigated. Initial radiation aging studies using gamma- and e-beam irradiation have shown complex material changes with significant crosslinking, lowered melting and Curie points (where observable), effects on crystallinity, but little influence on overall piezoelectric properties. Surprisingly, complex aging processes have also been observed in elevated temperature environments with annealing phenomena and cyclic stresses resulting in thermal depoling of domains. Overall materials performance appears to be governed by a combination of chemical and physical degradation processes. Molecular changes are primarily induced via radiative damage, and physical damage from temperature and AO exposure is evident as depoling and surface erosion. Major differences between individual copolymers have been observed providing feedback on material selection strategies

Design and Implementation of a Space Environment Simulation Toolbox for Small Satellites

DEFF Research Database (Denmark)

Amini, Rouzbeh; Larsen, Jesper A.; Izadi-Zamanabadi, Roozbeh

2005-01-01

This paper presents a developed toolbox for space environment model in SIMULINK that facilitates development and design of Attitude Determination and Control Systems (ADCS) for a Low Earth Orbit (LEO) spacecraft. The toolbox includes, among others, models of orbit propagators, disturbances, Earth...... gravity field, Earth magnetic field and eclipse. The structure and facilities within the toolbox are described and exemplified using a student satellite case (AAUSAT-II). The validity of developed models is confirmed by comparing the simulation results with the realistic data obtained from the Danish...

Studying the Association between Green Space Characteristics and Land Surface Temperature for Sustainable Urban Environments: An Analysis of Beijing and Islamabad

Directory of Open Access Journals (Sweden)

Shahid Naeem

2018-01-01

Full Text Available Increasing trends of urbanization lead to vegetation degradation in big cities and affect the urban thermal environment. This study investigated (1 the cooling effect of urban green space spatial patterns on Land Surface Temperature (LST; (2 how the surrounding environment influences the green space cool islands (GCI, and vice versa. The study was conducted in two Asian capitals: Beijing, China and Islamabad, Pakistan by utilizing Gaofen-1 (GF-1 and Landsat-8 satellite imagery. Pearson’s correlation and normalized mutual information (NMI were applied to investigate the relationship between green space characteristics and LST. Landscape metrics of green spaces including Percentage of Landscape (PLAND, Patch Density (PD, Edge Density (ED, and Landscape Shape Index (LSI were selected to calculate the spatial patterns of green spaces, whereas GCI indicators were defined by Green Space Range (GR, Temperature Difference (TD, and Temperature Gradient (TG. The results indicate that both vegetation composition and configuration influence LST distributions; however, vegetation composition appeared to have a slightly greater effect. The cooling effect can be produced more effectively by increasing green space percentage, planting trees in large patches with equal distribution, and avoiding complex-shaped green spaces. The GCI principle indicates that LST can be decreased by increasing the green space area, increasing the water body fraction, or by decreasing the fraction of impervious surfaces. GCI can also be strengthened by decreasing the fraction of impervious surfaces and increasing the fraction of water body or vegetation in the surrounding environment. The cooling effect of vegetation and water could be explained based on their thermal properties. Beijing has already enacted the green-wedge initiative to increase the vegetation canopy. While designing the future urban layout of Islamabad, the construction of artificial lakes within the urban green

Proposed Pharmacological Countermeasures Against Apoptotic Cell Death in Experimental Models Mimicking Space Environment Damage

Science.gov (United States)

Lulli, Matteo; Papucci, Laura; Witort, Ewa; Donnini, Martino; Lapucci, Andrea; Lazzarano, Stefano; Mazzoni, Tiziano; Simoncini, Madine; Falciani, Piergiuseppe; Capaccioli, Sergio

2008-06-01

Several damaging agents have been suggested to affect human vision during long term space travels. Recently, apoptosis induced by DNA-damaging agents has emerged as frequent pathogenetic mechanism of ophthalmologic pathologies. Here, we propose two countermeasures: coenzyme Q10 and bcl-2 downregulation preventing antisense oligoribonucleotides (ORNs), aimed to inhibit cellular apoptotic death. Our studies have been carried out on retina and neuronal cultured cells treated with the following apoptotic stimuli mimicking space environment: a several-day exposure to either 3H-labeled tymidine or to the genotoxic drug doxorubicin, UV irradiation, hypoxia and glucose/growth factor starvation (Locke medium). The preliminary results clearly indicate that CoQ10, as well as bcl-2 down-regulation preventing ORNs, significantly counteract apoptosis in response to different DNA damaging agents in cultured eye and in neuronal cells. This supports the possibility that both could be optimal countermeasures against ophthalmologic lesions during space explorations.

Planning, Implementation and Optimization of Future space Missions using an Immersive Visualization Environement (IVE) Machine

Science.gov (United States)

Harris, E.

Planning, Implementation and Optimization of Future Space Missions using an Immersive Visualization Environment (IVE) Machine E. N. Harris, Lockheed Martin Space Systems, Denver, CO and George.W. Morgenthaler, U. of Colorado at Boulder History: A team of 3-D engineering visualization experts at the Lockheed Martin Space Systems Company have developed innovative virtual prototyping simulation solutions for ground processing and real-time visualization of design and planning of aerospace missions over the past 6 years. At the University of Colorado, a team of 3-D visualization experts are developing the science of 3-D visualization and immersive visualization at the newly founded BP Center for Visualization, which began operations in October, 2001. (See IAF/IAA-01-13.2.09, "The Use of 3-D Immersive Visualization Environments (IVEs) to Plan Space Missions," G. A. Dorn and G. W. Morgenthaler.) Progressing from Today's 3-D Engineering Simulations to Tomorrow's 3-D IVE Mission Planning, Simulation and Optimization Techniques: 3-D (IVEs) and visualization simulation tools can be combined for efficient planning and design engineering of future aerospace exploration and commercial missions. This technology is currently being developed and will be demonstrated by Lockheed Martin in the (IVE) at the BP Center using virtual simulation for clearance checks, collision detection, ergonomics and reach-ability analyses to develop fabrication and processing flows for spacecraft and launch vehicle ground support operations and to optimize mission architecture and vehicle design subject to realistic constraints. Demonstrations: Immediate aerospace applications to be demonstrated include developing streamlined processing flows for Reusable Space Transportation Systems and Atlas Launch Vehicle operations and Mars Polar Lander visual work instructions. Long-range goals include future international human and robotic space exploration missions such as the development of a Mars

Real-time on-line space research laboratory environment monitoring with off-line trend and prediction analysis

Science.gov (United States)

Jules, Kenol; Lin, Paul P.

2007-06-01

With the International Space Station currently operational, a significant amount of acceleration data is being down-linked, processed and analyzed daily on the ground on a continuous basis for the space station reduced gravity environment characterization, the vehicle design requirements verification and science data collection. To help understand the impact of the unique spacecraft environment on the science data, an artificial intelligence monitoring system was developed, which detects in near real time any change in the reduced gravity environment susceptible to affect the on-going experiments. Using a dynamic graphical display, the monitoring system allows science teams, at any time and any location, to see the active vibration disturbances, such as pumps, fans, compressor, crew exercise, re-boost and extra-vehicular activities that might impact the reduced gravity environment the experiments are exposed to. The monitoring system can detect both known and unknown vibratory disturbance activities. It can also perform trend analysis and prediction by analyzing past data over many increments (an increment usually lasts 6 months) collected onboard the station for selected disturbances. This feature can be used to monitor the health of onboard mechanical systems to detect and prevent potential systems failures. The monitoring system has two operating modes: online and offline. Both near real-time on-line vibratory disturbance detection and off-line detection and trend analysis are discussed in this paper.

Thin film heat flux sensor for Space Shuttle Main Engine turbine environment

Science.gov (United States)

Will, Herbert

1991-01-01

The Space Shuttle Main Engine (SSME) turbine environment stresses engine components to their design limits and beyond. The extremely high temperatures and rapid temperature cycling can easily cause parts to fail if they are not properly designed. Thin film heat flux sensors can provide heat loading information with almost no disturbance of gas flows or of the blade. These sensors can provide steady state and transient heat flux information. A thin film heat flux sensor is described which makes it easier to measure small temperature differences across very thin insulating layers.

Peripersonal Space: An Index of Multisensory Body–Environment Interactions in Real, Virtual, and Mixed Realities

Directory of Open Access Journals (Sweden)

Andrea Serino

2018-01-01

Full Text Available Human–environment interactions normally occur in the physical milieu and thus by medium of the body and within the space immediately adjacent to and surrounding the body, the peripersonal space (PPS. However, human interactions increasingly occur with or within virtual environments, and hence novel approaches and metrics must be developed to index human–environment interactions in virtual reality (VR. Here, we present a multisensory task that measures the spatial extent of human PPS in real, virtual, and augmented realities. We validated it in a mixed reality (MR ecosystem in which real environment and virtual objects are blended together in order to administer and control visual, auditory, and tactile stimuli in ecologically valid conditions. Within this mixed-reality environment, participants are asked to respond as fast as possible to tactile stimuli on their body, while task-irrelevant visual or audiovisual stimuli approach their body. Results demonstrate that, in analogy with observations derived from monkey electrophysiology and in real environmental surroundings, tactile detection is enhanced when visual or auditory stimuli are close to the body, and not when far from it. We then calculate the location where this multisensory facilitation occurs as a proxy of the boundary of PPS. We observe that mapping of PPS via audiovisual, as opposed to visual alone, looming stimuli results in sigmoidal fits—allowing for the bifurcation between near and far space—with greater goodness of fit. In sum, our approach is able to capture the boundaries of PPS on a spatial continuum, at the individual-subject level, and within a fully controlled and previously laboratory-validated setup, while maintaining the richness and ecological validity of real-life events. The task can therefore be applied to study the properties of PPS in humans and to index the features governing human–environment interactions in virtual or MR. We propose PPS as an

Implications for space radiation environment models from CREAM and CREDO measurements over half a solar cycle

International Nuclear Information System (INIS)

Dyer, C.S.; Truscott, P.R.; Peerless, C.L.; Watson, C.J.; Evans, H.E.; Knight, P.; Cosby, M.; Underwood, C.; Cousins, T.; Noulty, R.; Maag, C.

1999-01-01

Flight data obtained between 1990 and 1997 from the Cosmic Radiation Environment Monitors CREAM and CREDO carried on UoSAT-3, Space Shuttle, STRV-1a (Space Technology Research Vehicle) and APEX (Advanced Photovoltaic and Electronics Experiment Spacecraft) provide coverage over half a solar cycle. The modulation of cosmic rays and evolution of the South Atlantic Anomaly are observed, the former comprising a factor of three increase at high latitudes and the latter a general increase accompanied by a north-westward drift. Comparison of particle fluxes and linear energy transfer (LET) spectra is made with improved environment and radiation transport calculations which account for shield distributions and secondary particles. While there is an encouraging convergence between predictions and observations, significant improvements are still required, particularly in the treatment of locally produced secondary particles. Solar-particle events during this time period have LET spectra significantly below the October 1989 event which has been proposed as a worst case model

Biopan-survival I: exposure of the osmophiles synechococcus sp. (Nageli) and haloarcula sp. to the space environment

Science.gov (United States)

Mancinelli, R. L.; White, M. R.; Rothschild, L. J.

The objective of this study was to determine the survivability of osmophilic microorganisms in space, as well as examine the DNA breakage in osmophilic cells exposed to solar UV-radiation plus vacuum and to vacuum only. The organisms used were an unidentified species of Synechococcus (Nägeli) that inhabits the evaporitic gypsum-halite crusts that form along the marine intertidal, and an unidentified species of the extremely halophilic genus Haloarcula (designated as isolate G) isolated from a evaporitic NaCl crystal. Because these organisms are desiccation resistant and gypsum-halite as well as NaCl attenuate UV-radiation, we hypothesized that these organisms would survive in the space environment, better than most others. The organisms were exposed to the space environment for 2 weeks while in earth orbit aboard the Biopan facility. Ground controls were tested in a space simulation facility. All samples were compared to unexposed samples. Survivability was determined by plate counts and the most probable number technique. DNA breakage was determined by labeling breaks in the DNA with ^32P followed by translation. Results indicate that the osmophilic microbes survived the 2 week exposure. The major cause of cell death was DNA damage. The number of strand breaks in the DNA from vacuum UV exposed cells was greater than the vacuum only exposed cells.

Public open spaces and walking for recreation: moderation by attributes of pedestrian environments.

Science.gov (United States)

Sugiyama, Takemi; Paquet, Catherine; Howard, Natasha J; Coffee, Neil T; Taylor, Anne W; Adams, Robert J; Daniel, Mark

2014-05-01

This study examined whether attributes of pedestrian environments moderate the relationships between access to public open spaces (POS) and adults' recreational walking. Data were collected from participants of the North West Adelaide Health Study in 2007. Recreational walking was determined using self-reported walking frequency. Measures of POS access (presence, count, and distance to the nearest POS) were assessed using a Geographic Information System. Pedestrian environmental attributes included aesthetics, walking infrastructure, barrier/traffic, crime concern, intersection density, and access to walking trails. Regression analyses examined whether associations between POS access and recreational walking were moderated by pedestrian environmental attributes. The sample included 1574 participants (45% men, mean age: 55). POS access measures were not associated with recreational walking. However, aesthetics, walking infrastructure, and access to walking trail were found to moderate the POS-walking relationships. The presence of POS was associated with walking among participants with aesthetically pleasing pedestrian environments. Counter-intuitively, better access to POS was associated with recreational walking for those with poorer walking infrastructure or no access to walking trails. Local pedestrian environments moderate the relationships between access to POS and recreational walking. Our findings suggest the presence of complex relationships between POS availability and pedestrian environments. Copyright © 2014 Elsevier Inc. All rights reserved.

Predictors of Behavior and Performance in Extreme Environments: The Antarctic Space Analogue Program

Science.gov (United States)

Palinkas, Lawrence A.; Gunderson, E K. Eric; Holland, A. W.; Miller, Christopher; Johnson, Jeffrey C.

2000-01-01

To determine which, if any, characteristics should be incorporated into a select-in approach to screening personnel for long-duration spaceflight, we examined the influence of crewmember social/ demographic characteristics, personality traits, interpersonal needs, and characteristics of station physical environments on performance measures in 657 American men who spent an austral winter in Antarctica between 1963 and 1974. During screening, subjects completed a Personal History Questionnaire which obtained information on social and demographic characteristics, the Deep Freeze Opinion Survey which assessed 5 different personality traits, and the Fundamental Interpersonal Relations Orientation-Behavior (FIRO-B) Scale which measured 6 dimensions of interpersonal needs. Station environment included measures of crew size and severity of physical environment. Performance was assessed on the basis of combined peer-supervisor evaluations of overall performance, peer nominations of fellow crewmembers who made ideal winter-over candidates, and self-reported depressive symptoms. Social/demographic characteristics, personality traits, interpersonal needs, and characteristics of station environments collectively accounted for 9-17% of the variance in performance measures. The following characteristics were significant independent predictors of more than one performance measure: military service, low levels of neuroticism, extraversion and conscientiousness, and a low desire for affection from others. These results represent an important first step in the development of select-in criteria for personnel on long-duration missions in space and other extreme environments. These criteria must take into consideration the characteristics of the environment and the limitations they place on meeting needs for interpersonal relations and task performance, as well as the characteristics of the individuals and groups who live and work in these environments.

Space Power Theory: Controlling the Medium Without Weapons in Space

National Research Council Canada - National Science Library

Wilkerson, Don L

2008-01-01

.... strategic space assets and the ability to negate enemy space systems is essential to U.S. space strategy in controlling the geographical environment of space, predominately in the Lower Earth Orbit (LEO...

ORF Sequence: NC_002937 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available tase, alpha subunit [Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough] MQQAPRSIVIGGEAGQGLVTIGDMLVRT...LIRSGYGVLVAQHYMSRVRGGHNTYNIRVGAGDVLAPTDDVHVLVALDQRTVTEQGPRLGDGLLILDERLDPGSLNALRVPFAALAGRPLYENIAALGVLAALLGLER

Space Launch System Base Heating Test: Environments and Base Flow Physics

Science.gov (United States)

Mehta, Manish; Knox, Kyle S.; Seaford, C. Mark; Dufrene, Aaron T.

2016-01-01

The NASA Space Launch System (SLS) vehicle is composed of four RS-25 liquid oxygen- hydrogen rocket engines in the core-stage and two 5-segment solid rocket boosters and as a result six hot supersonic plumes interact within the aft section of the vehicle during ight. Due to the complex nature of rocket plume-induced ows within the launch vehicle base during ascent and a new vehicle con guration, sub-scale wind tunnel testing is required to reduce SLS base convective environment uncertainty and design risk levels. This hot- re test program was conducted at the CUBRC Large Energy National Shock (LENS) II short-duration test facility to simulate ight from altitudes of 50 kft to 210 kft. The test program is a challenging and innovative e ort that has not been attempted in 40+ years for a NASA vehicle. This presentation discusses the various trends of base convective heat ux and pressure as a function of altitude at various locations within the core-stage and booster base regions of the two-percent SLS wind tunnel model. In-depth understanding of the base ow physics is presented using the test data, infrared high-speed imaging and theory. The normalized test design environments are compared to various NASA semi- empirical numerical models to determine exceedance and conservatism of the ight scaled test-derived base design environments. Brief discussion of thermal impact to the launch vehicle base components is also presented.

Role of co-occurring competition and facilitation in plant spacing hydrodynamics in water-limited environments

Science.gov (United States)

2017-01-01

Plant performance (i.e., fecundity, growth, survival) depends on an individual’s access to space and resources. At the community level, plant performance is reflected in observable vegetation patterning (i.e., spacing distance, density) often controlled by limiting resources. Resource availability is, in turn, strongly dependent on plant patterning mediated by competitive and facilitative plant–plant interactions. Co-occurring competition and facilitation has never been specifically investigated from a hydrodynamic perspective. To address this knowledge gap, and to overcome limitations of field studies, three intermediate-scale laboratory experiments were conducted using a climate-controlled wind tunnel–porous media test facility to simulate the soil–plant–atmosphere continuum. The spacing between two synthetic plants, a design consideration introduced by the authors in a recent publication, was varied between experiments; edaphic and mean atmospheric conditions were held constant. The strength of the above- and belowground plant–plant interactions changed with spacing distance, allowing the creation of a hydrodynamic conceptual model based on established ecological theories. Greatest soil water loss was observed for the experiment with the smallest spacing where competition dominated. Facilitation dominated at the intermediate spacing; little to no interactions were observed for the largest plant spacing. Results suggest that there exists an optimal spacing distance range that lowers plant environmental stress, thus improving plant performance through reduced atmospheric demand and conservation of available soil water. These findings may provide a foundation for improving our understanding of many climatological, ecohydrological, and hydrological problems pertaining to the hydrodynamics of water-limited environments where plant–plant interactions and community self-organization are important. PMID:28807999

Space Environmental Effects Testing Capability at the Marshall Space Flight Center

Science.gov (United States)

DeWittBurns, H.; Craven, Paul; Finckenor, Miria; Nehls, Mary; Schneider, Todd; Vaughn, Jason

2012-01-01

Understanding the effects of the space environment on materials and systems is fundamental and essential for mission success. If not properly understood and designed for, the effects of the environment can lead to degradation of materials, reduction of functional lifetime, and system failure. In response to this need, the Marshall Space Flight Center has developed world class Space Environmental Effects (SEE) expertise and test facilities to simulate the space environment. Capabilities include multiple unique test systems comprising the most complete SEE testing capability available. These test capabilities include charged particle radiation (electrons, protons, ions), ultraviolet radiation (UV), vacuum ultraviolet radiation (VUV), atomic oxygen, plasma effects, space craft charging, lunar surface and planetary effects, vacuum effects, and hypervelocity impacts as well as the combination of these capabilities. In addition to the uniqueness of the individual test capabilities, MSFC is the only NASA facility where the effects of the different space environments can be tested in one location. Combined with additional analytical capabilities for pre- and post-test evaluation, MSFC is a one-stop shop for materials testing and analysis. The SEE testing and analysis are performed by a team of award winning experts nationally recognized for their contributions in the study of the effects of the space environment on materials and systems. With this broad expertise in space environmental effects and the variety of test systems and equipment available, MSFC is able to customize tests with a demonstrated ability to rapidly adapt and reconfigure systems to meet customers needs. Extensive flight experiment experience bolsters this simulation and analysis capability with a comprehensive understanding of space environmental effects.

Free-space optical channel characterization in a coastal environment

KAUST Repository

Alheadary, Wael Ghazy

2017-12-28

Recently, FSO (Free-Space Optical Communication) has received a lot of attention thanks to its high data-rate transmission via unbounded unlicensed bandwidth. However, some weather conditions lead to significant degradation of the FSO link performance. Based on this context and in order to have a better understanding of the capabilities of FSO communication in a coastal environment, the effects of temperature and humidity on an FSO system are investigated in this study. An experiment is conducted using an open source FSO system that achieves a transmission rate of 1 Gbit/s at a distance of 70 m. Two new mathematical models are proposed to represent the effects of temperature and humidity on our developed FSO system operating at a wavelength of 1 550 nm. The first model links the FSO attenuation coeffcient to the air temperature in coastal regions, while the second model links the FSO attenuation coeffcient to the humidity and the dew-point temperature. The key finding of this study is that FSO links can achieve maximum availability in a coastal city with normal variations in temperature and humidity.

Comparing long-term projections of the space debris environment to real world data - Looking back to 1990

Science.gov (United States)

Radtke, Jonas; Stoll, Enrico

2016-10-01

Long-term projections of the space debris environment are commonly used to assess the trends within different scenarios for the assumed future development of spacefaring. General scenarios investigated include business-as-usual cases in which spaceflight is performed as today and mitigation scenarios, assuming the implementation of Space Debris Mitigation Guidelines at different advances or the effectiveness of more drastic measures, such as active debris removal. One problem that always goes along with the projection of a system's behaviour in the future is that affecting parameters, such as the launch rate, are unpredictable. It is common to look backwards and re-model the past in other fields of research. This is a rather difficult task for spaceflight as it is still quite young, and furthermore mostly influenced by drastic politic changes, as the break-down of the Soviet Union in the end of the 1980s. Furthermore, one major driver of the evolution of the number of on-orbit objects turn out to be collisions between objects. As of today, these collisions are, fortunately, very rare and therefore, a real-world-data modelling approach is difficult. Nevertheless, since the end of the cold war more than 20 years of a comparably stable evolution of spaceflight activities have passed. For this study, this period is used in a comparison between the real evolution of the space debris environment and that one projected using the Institute of Space System's in-house tool for long-term assessment LUCA (Long-Term Utility for Collision Analysis). Four different scenarios are investigated in this comparison; all of them have the common starting point of using an initial population for 1st May 1989. The first scenario, which serves as reference, is simply taken from MASTER-2009. All launch and mission related objects from the Two Line Elements (TLE) catalogue and other available sources are included. All events such as explosion and collision events have been re-modelled as

Women's Health Issues in the Space Environment

Science.gov (United States)

Jennings, Richard T.

1999-01-01

Women have been an integral part of US space crews since Sally Ride's mission in 1983, and a total of 40 women have been selected as US astronauts. The first Russian female cosmonaut flew in 1963. This presentation examines the health care and reproductive aspects of flying women in space. In addition, the reproductive implications of delaying one's childbearing for an astronaut career and the impact of new technology such as assisted reproductive techniques are examined. The reproductive outcomes of the US female astronauts who have become pregnant following space flight exposure are also presented. Since women have gained considerable operational experience on the Shuttle, Mir and during EVA, the unique operational considerations for preflight certification, menstruation control and hygiene, contraception, and urination are discussed. Medical and surgical implications for women on long-duration missions to remote locations are still evolving, and enabling technologies for health care delivery are being developed. There has been considerable progress in the development of microgravity surgical techniques, including laparoscopy, thoracoscopy, and laparotomy. The concepts of prevention of illness, conversion of surgical conditions to medically treatable conditions and surgical intervention for women on long duration space flights are considered.

Effects of space environment on chlorophyll fluorescence and photosynthesis characteristics of wheat

International Nuclear Information System (INIS)

Lu Li; Lv Jinyin; Gong Qingzhu; Gao Junfeng

2006-01-01

The effects of the space environment on the chlorophyll fluorescence parameters and photosynthesis characteristics of wheat cultivars, Xinong 1043 M1 and Shaan253 M 1 , were studied. The results showed that the decrement of contents of PS II primary photochemical efficiency (F v /F m ), potential activity (F v /F 0 ), photochemical quenching coefficient (qP) and photosynthesis rate (Pn) were less than that of control, increment of non-photochemical quenching coefficient (qN) were more than that of control. The results suggested that photosynthetic apparatus were damaged, photosynthetic electron transport, photosynthetic primary reaction were inhibited, rate of photosynthesis decreased and growth of M 1 plant were retarded, which leading to thousand kernel weights decreased. (authors)

Characterization of System Level Single Event Upset (SEU) Responses using SEU Data, Classical Reliability Models, and Space Environment Data

Science.gov (United States)

Berg, Melanie; Label, Kenneth; Campola, Michael; Xapsos, Michael

2017-01-01

We propose a method for the application of single event upset (SEU) data towards the analysis of complex systems using transformed reliability models (from the time domain to the particle fluence domain) and space environment data.

Space radiation effects

International Nuclear Information System (INIS)

Li Shiqing; Yan Heping

1995-01-01

The authors briefly discusses the radiation environment in near-earth space and it's influences on material, and electronic devices using in space airship, also, the research developments in space radiation effects are introduced

Physiological Disorders in Closed Environment-Grown Crops for Space Life Support

Science.gov (United States)

Wheeler, Raymond; Morrow, Robert

Crop production for life support systems in space will require controlled environments where temperature, humidity, CO2, and light might differ from natural environments where plants evolved. Physiological disorders, i.e., abnormal plant growth and development, can occur under these controlled environments. Among the most common of these disorders are Ca deficiency injuries such as leaf tipburn (e.g., lettuce), blossom-end-rot in fruits (e.g., tomato and pepper), and internal tissue necrosis in fruits or tubers (e.g., cucumber and potato). Increased Ca nutrition to the plants typically has little effect on these disorders, but slowing overall growth or providing better air circulation to increase transpiration can be effective. A second common disorder is oedema or intumescence, which appears as callus-like growth or galls on leaves (e.g., sweetpotato, potato, pepper, and tomato). This disorder can be reduced by increasing the near UV radiation ( 300-400 nm) to the plants. Leaf injury and necrosis can occur under long photoperiods (e.g., tomato, potato, and pepper) and at super-elevated (i.e., ¿ than 4000 mol mol-1) CO2 concentrations (e.g., soybean, potato, and radish), and these can be managed by reducing the photoperiod and CO2 concentration, respectively. Lack of blue light in the spectrum (e.g., under red LEDs or LPS lamps) can result in leggy growth and/or leaves lacking in chlorophyll (e.g., wheat, bean, and radish). Volatile organic compounds (VOCs), most commonly ethylene, can accumulate in tightly closed systems and result in a variety of negative responses. Most of these disorders can be mitigated by altering the environmental set-points or by using more resistant cultivars.

Analysis of the Metal Oxide Space Clouds (MOSC) HF Propagation Environment

Science.gov (United States)

Jackson-Booth, N.; Selzer, L.

2015-12-01

Artificial Ionospheric Modification (AIM) attempts to modify the ionosphere in order to alter the high frequency (HF) propagation environment. It can be achieved through injections of aerosols, chemicals or radio (RF) signals into the ionosphere. The Metal Oxide Space Clouds (MOSC) experiment was undertaken in April/May 2013 to investigate chemical AIM. Two sounding rockets were launched from the Kwajalein Atoll (part of the Marshall Islands) and each released a cloud of vaporized samarium (Sm). The samarium created a localized plasma cloud, with increased electron density, which formed an additional ionospheric layer. The ionospheric effects were measured by a wide range of ground based instrumentation which included a network of high frequency (HF) sounders. Chirp transmissions were made from three atolls and received at five sites within the Marshall Islands. One of the receive sites consisted of an 18 antenna phased array, which was used for direction finding. The ionograms have shown that as well as generating a new layer the clouds created anomalous RF propagation paths, which interact with both the cloud and the F-layer, resulting in 'ghost traces'. To fully understand the propagation environment a 3D numerical ray trace has been undertaken, using a variety of background ionospheric and cloud models, to find the paths through the electron density grid for a given fan of elevation and azimuth firing angles. Synthetic ionograms were then produced using the ratio of ray path length to speed of light as an estimation of the delay between transmission and observation for a given frequency of radio wave. This paper reports on the latest analysis of the MOSC propagation environment, comparing theory with observations, to further understanding of AIM.

Using the Moon as a high-fidelity analogue environment to study biological and behavioral effects of long-duration space exploration

Science.gov (United States)

Goswami, Nandu; Roma, Peter G.; De Boever, Patrick; Clément, Gilles; Hargens, Alan R.; Loeppky, Jack A.; Evans, Joyce M.; Peter Stein, T.; Blaber, Andrew P.; Van Loon, Jack J. W. A.; Mano, Tadaaki; Iwase, Satoshi; Reitz, Guenther; Hinghofer-Szalkay, Helmut G.

2012-12-01

Due to its proximity to Earth, the Moon is a promising candidate for the location of an extra-terrestrial human colony. In addition to being a high-fidelity platform for research on reduced gravity, radiation risk, and circadian disruption, the Moon qualifies as an isolated, confined, and extreme (ICE) environment suitable as an analog for studying the psychosocial effects of long-duration human space exploration missions and understanding these processes. In contrast, the various Antarctic research outposts such as Concordia and McMurdo serve as valuable platforms for studying biobehavioral adaptations to ICE environments, but are still Earth-bound, and thus lack the low-gravity and radiation risks of space. The International Space Station (ISS), itself now considered an analog environment for long-duration missions, better approximates the habitable infrastructure limitations of a lunar colony than most Antarctic settlements in an altered gravity setting. However, the ISS is still protected against cosmic radiation by the Earth magnetic field, which prevents high exposures due to solar particle events and reduces exposures to galactic cosmic radiation. On Moon the ICE environments are strengthened, radiations of all energies are present capable of inducing performance degradation, as well as reduced gravity and lunar dust. The interaction of reduced gravity, radiation exposure, and ICE conditions may affect biology and behavior - and ultimately mission success - in ways the scientific and operational communities have yet to appreciate, therefore a long-term or permanent human presence on the Moon would ultimately provide invaluable high-fidelity opportunities for integrated multidisciplinary research and for preparations of a manned mission to Mars.

Investigation on high efficiency volume Bragg gratings performances for spectrometry in space environment

Science.gov (United States)

Loicq, Jérôme; Stockman, Y.; Georges, Marc; Gaspar Venancio, Luis M.

2017-11-01

The special properties of Volume Bragg Gratings (VBGs) make them good candidates for spectrometry applications where high spectral resolution, low level of straylight and low polarisation sensitivity are required. Therefore it is of interest to assess the maturity and suitability of VBGs as enabling technology for future ESA missions with demanding requirements for spectrometry. The VBGs suitability for space application is being investigated in the frame of a project led by CSL and funded by the European Space Agency. The goal of this work is twofold: first the theoretical advantages and drawbacks of VBGs with respect to other technologies with identical functionalities are assessed, and second the performances of VBG samples in a representative space environment are experimentally evaluated. The performances of samples of two VBGs technologies, the Photo-Thermo-Refractive (PTR) glass and the DiChromated Gelatine (DCG), are assessed and compared in the Hα, O2-B and NIR bands. The tests are performed under vacuum condition combined with temperature cycling in the range of 200 K to 300K. A dedicated test bench experiment is designed to evaluate the impact of temperature on the spectral efficiency and to determine the optical wavefront error of the diffracted beam. Furthermore the diffraction efficiency degradation under gamma irradiation is assessed. Finally the straylight, the diffraction efficiency under conical incidence and the polarisation sensitivity is evaluated.

Centralized vs. decentralized nursing stations: effects on nurses' functional use of space and work environment.

Science.gov (United States)

Zborowsky, Terri; Bunker-Hellmich, Lou; Morelli, Agneta; O'Neill, Mike

2010-01-01

Evidence-based findings of the effects of nursing station design on nurses' work environment and work behavior are essential to improve conditions and increase retention among these fundamental members of the healthcare delivery team. The purpose of this exploratory study was to investigate how nursing station design (i.e., centralized and decentralized nursing station layouts) affected nurses' use of space, patient visibility, noise levels, and perceptions of the work environment. Advances in information technology have enabled nurses to move away from traditional centralized paper-charting stations to smaller decentralized work stations and charting substations located closer to, or inside of, patient rooms. Improved understanding of the trade-offs presented by centralized and decentralized nursing station design has the potential to provide useful information for future nursing station layouts. This information will be critical for understanding the nurse environment "fit." The study used an exploratory design with both qualitative and quantitative methods. Qualitative data regarding the effects of nursing station design on nurses' health and work environment were gathered by means of focus group interviews. Quantitative data-gathering techniques included place- and person-centered space use observations, patient visibility assessments, sound level measurements, and an online questionnaire regarding perceptions of the work environment. Nurses on all units were observed most frequently performing telephone, computer, and administrative duties. Time spent using telephones, computers, and performing other administrative duties was significantly higher in the centralized nursing stations. Consultations with medical staff and social interactions were significantly less frequent in decentralized nursing stations. There were no indications that either centralized or decentralized nursing station designs resulted in superior visibility. Sound levels measured in all

Hardware-in-the-Loop environment for testing and commissioning of space controllers; Hardware-in-the-Loop Umgebung zum Test und zur Inbetriebnahme von Raumreglern

Energy Technology Data Exchange (ETDEWEB)

Adlhoch, Alexander; Becker, Martin [Hochschule Biberach (Germany). Inst. fuer Gebaeude- und Energiesysteme

2012-07-01

The energy-efficient and optimal functioning of room controllers in terms of indoor air climates is influenced mainly by the control algorithm and the optimal adjustment of the parameters of controllers used in terms of space requirements. In the practical operation, deficits in the function or parameters of the controller are hardly or only with great effort metrological detectable, but have a significant impact on the energy consumption and / or the indoor climate comfort. In a hardware-in-the-loop (HIL) environment, room controllers can be examined in terms of the function under defined conditions, and different controllers can be evaluated comparatively. It is also possible to adjust the parameters of the controller before the commissioning. The HiL environment presented in the contribution under consideration consists of a model of the controlled system, a hardware coupler and a real controller to be tested. Among the spatial models, it can be selected from a plurality of different types of space which in turn can be assigned by means of different spatial parameters and environmental models. These combinations enable a replication of a test scenario corresponding to the later application. The hardware coupler provides a selection of physical inputs and outputs as well as interfaces to different bus systems (for example KNX, LON, EnOcean) for connecting different types of controllers. The construction and operation of a HIL test stand for space controller is presented based on first practical control tests. At this, the focus is on the suitability of this test environment for a variety of different controllers as well as development assistance and assistance for the adjustment of parameters. The HiL environments developed in the joint research project HiL RHK1 for the testing of space controllers, controllers for HVAC systems and refrigeration technology controllers have been developed so that the HiL environments can be coupled to a multi-HIL environment. This

The Space Physics of Life: Searching for Biosignatures on Habitable Icy Worlds Affected by Space Weathering

Science.gov (United States)

Cooper, John F.

2006-01-01

Accessible surfaces of the most likely astrobiological habitats (Mars, Europa, Titan) in the solar system beyond Earth are exposed to various chemical and hydrologic weathering processes directly or indirectly induced by interaction with the overlying space environment. These processes can be both beneficial, through provision of chemical compounds and energy, and destructive, through chemical dissociation or burial, to detectable presence of biosignatures. Orbital, suborbital, and surface platforms carrying astrobiological instrumentation must survive, and preferably exploit, space environment interactions to reach these habitats and search for evidence of life or its precursors. Experience from Mars suggests that any detection of biosignatures must be accompanied by characterization of the local chemical environment and energy sources including irradiation by solar ultraviolet photons and energetic particles from the space environment. Orbital and suborbital surveys of surface chemistry and astrobiological potential in the context of the space environment should precede targeted in-situ measurements to maximize probability of biosignature detection through site selection. The Space Physics of Life (SPOL) investigation has recently been proposed to the NASA Astrobiology Institute and is briefly described in this presentation. SPOL is the astrobiologically relevant study of the interactions and relationships of potentially? or previously inhabited, bodies of the solar system with the surrounding environments. This requires an interdisciplinary effort in space physics, planetary science, and radiation biology. The proposed investigation addresses the search for habitable environments, chemical resources to support life, and techniques for detection of organic and inorganic signs of life in the context of the space environment.

ERATOSTHENES: excellence research Centre for Earth surveillance and space-based monitoring of the environment, the EXCELSIOR Horizon 2020 teaming project

Science.gov (United States)

Hadjimitsis, Diofantos G.; Kontoes, Haris; Schreier, Gunter; Ansmann, Albert; Komodromos, George; Themistocleous, Kyriacos; Mamouri, Rodanthi; Michaelides, Silas; Nisantzi, Argyro; Papoutsa, Christiana; Neocleous, Kyriacos; Mettas, Christodoulos; Tzouvaras, Marios; Evagorou, Evagoras; Christofe, Andreas; Melillos, George; Papoutsis, Ioannis

2017-10-01

The aim of this paper is to present the strategy and vision to upgrade the existing ERATOSTHENES Research Centre (ERC) established within the Cyprus University of Technology (CUT) into a sustainable, viable and autonomous Centre of Excellence (CoE) for Earth Surveillance and Space-Based Monitoring of the Environment, which will provide the highest quality of related services on the National, European and International levels. EXCELSIOR is a Horizon 2020 Teaming project which addresses a specific challenge defined by the work program, namely, the reduction of substantial disparities in the European Union by supporting research and innovation activities and systems in low performing countries. It also aims at establishing long-term and strategic partnerships between the Teaming partners, thus reducing internal research and innovation disparities within European Research and Innovation landscape. The proposed CoE envisions the upgrading of the existing ERC into an inspiring environment for conducting basic and applied research and innovation in the areas of the integrated use of remote sensing and space-based techniques for monitoring the environment. Environment has been recognized by the Smart Specialization Strategy of Cyprus as the first horizontal priority for future growth of the island. The foreseen upgrade will regard the expansion of this vision to systematic monitoring of the environment using Earth Observation, space and ground based integrated technologies. Such an approach will lead to the systematic monitoring of all three domains of the Environment (Air, Land, Water). Five partners have united to upgrade the existing ERC into a CoE, with the common vision to become a world-class innovation, research and education centre, actively contributing to the European Research Area (ERA). More specifically, the Teaming project is a team effort between the Cyprus University of Technology (CUT, acting as the coordinator), the German Aerospace Centre (DLR), the

Improvement of the equivalent sphere model for better estimates of skin or eye dose in space radiation environments

International Nuclear Information System (INIS)

Lin, Z.W.

2011-01-01

It is often useful to get a quick estimate of the dose or dose equivalent of an organ, such as blood-forming organs, the eye or the skin, in a radiation field. Sometimes an equivalent sphere is used to represent the organ for this purpose. For space radiation environments, recently it has been shown that the equivalent sphere model does not work for the eye or the skin in solar particle event environments. In this study, we improve the representation of the eye and the skin using a two-component equivalent sphere model. Motivated by the two-peak structure of the body organ shielding distribution for the eye and the skin, we use an equivalent sphere with two radius parameters, for example a partial spherical shell of a smaller thickness over a proper fraction of the full solid angle combined with a concentric partial spherical shell of a larger thickness over the rest of the full solid angle, to represent the eye or the skin. We find that using an equivalent sphere with two radius parameters instead of one drastically improves the accuracy of the estimates of dose and dose equivalent in space radiation environments. For example, in solar particle event environments the average error in the estimate of the skin dose equivalent using an equivalent sphere with two radius parameters is about 8%, while the average error of the conventional equivalent sphere model using one radius parameter is around 100%.

Humans in space the psychological hurdles

CERN Document Server

Kanas, Nick

2015-01-01

Using anecdotal reports from astronauts and cosmonauts, and the results from studies conducted in space analog environments on Earth and in the actual space environment, this book broadly reviews the various psychosocial issues that affect space travelers.  Unlike other books that are more technical in format, this text is targeted for the general public.  With the advent of space tourism and the increasing involvement of private enterprise in space, there is now a need to explore the impact of space missions on the human psyche and on the interpersonal relationships of the crewmembers. Separate chapters of the book deal with psychosocial stressors in space and in space analog environments; psychological, psychiatric, interpersonal, and cultural issues pertaining to space missions; positive growth-enhancing aspects of space travel; the crew-ground interaction; space tourism; countermeasures for dealing with space; and unique aspects of a trip to Mars, the outer solar system, and interstellar travel. .

2004 Space Report: Environment and Strategy for Space Research at NATO's Research and Technology Organisation (RTO)

Science.gov (United States)

Woods-Vedeler, Jessica A.

2007-01-01

This report describes the motivation for and a strategy to enhance the NATO Research and Technology Organisation's (RTO) current space research effort to reflect NATO's growing military dependence on space systems. Such systems and services provided by these systems are critical elements of military operations. NATO uses space systems for operational planning and support, communication, radio navigation, multi-sensor and multi-domain demonstrations. Such systems are also used to promote regional stability. A quantitative analysis of work related to space in the NATO RTO showed that during the period of 1998 - 2004, 5% of the research pursued in the NATO RTO has been clearly focused on space applications. Challenging environmental and organizational barriers for increasing RTO space research were identified. In part, these include lack of sufficient space expertise representation on panels, the military sensitivity of space, current panel work loads and the need for specific technical recommendations from peers. A strategy for enhancing space research in the RTO is to create a limited-life Space Advisory Group (SAG) composed of Space Expert Consultants who are panel members with appropriate expertise and additional expertise from the nations. The SAG will recommend and find support in the nations for specific technical activities related to space in the areas of Space Science, Remote Sensing Data Analysis, Spacecraft Systems, Surveillance and Early Warning, Training and Simulation and Policy. An RTO Space Advisory Group will provide an organizational mechanism to gain recognition of RTO as a forum for trans-Atlantic defence space research and to enhance space research activities.

Space Shuttle and Space Station Radio Frequency (RF) Exposure Analysis

Science.gov (United States)

Hwu, Shian U.; Loh, Yin-Chung; Sham, Catherine C.; Kroll, Quin D.

2005-01-01

This paper outlines the modeling techniques and important parameters to define a rigorous but practical procedure that can verify the compliance of RF exposure to the NASA standards for astronauts and electronic equipment. The electromagnetic modeling techniques are applied to analyze RF exposure in Space Shuttle and Space Station environments with reasonable computing time and resources. The modeling techniques are capable of taking into account the field interactions with Space Shuttle and Space Station structures. The obtained results illustrate the multipath effects due to the presence of the space vehicle structures. It's necessary to include the field interactions with the space vehicle in the analysis for an accurate assessment of the RF exposure. Based on the obtained results, the RF keep out zones are identified for appropriate operational scenarios, flight rules and necessary RF transmitter constraints to ensure a safe operating environment and mission success.

Taking SiC Power Devices to the Final Frontier: Addressing Challenges of the Space Radiation Environment

Science.gov (United States)

Lauenstein, Jean-Marie; Casey, Megan

2017-01-01

Silicon carbide power device technology has the potential to enable a new generation of aerospace power systems that demand high efficiency, rapid switching, and reduced mass and volume in order to expand space-based capabilities. For this potential to be realized, SiC devices must be capable of withstanding the harsh space radiation environment. Commercial SiC components exhibit high tolerance to total ionizing dose but to date, have not performed well under exposure to heavy ion radiation representative of the on-orbit galactic cosmic rays. Insertion of SiC power device technology into space applications to achieve breakthrough performance gains will require intentional development of components hardened to the effects of these highly-energetic heavy ions. This work presents heavy-ion test data obtained by the authors over the past several years for discrete SiC power MOSFETs, JFETs, and diodes in order to increase the body of knowledge and understanding that will facilitate hardening of this technology to space radiation effects. Specifically, heavy-ion irradiation data taken under different bias, temperature, and ion beam conditions is presented for devices from different manufacturers, and the emerging patterns discussed.

Commercial opportunities utilizing the International Space Station

Science.gov (United States)

Kearney, Michael E.; Mongan, Phil; Overmyer, Carolyn M.; Jackson, Kenneth

1998-01-01

The International Space Station (ISS) has the unique capability of providing a low-g environment for both short- and long-duration experimentation. This environment can provide a unique and competitive research capability to industry; but until recently, utilization of this environment by the private sector has been limited if not totally unavailable. NASA has recently expressed an interest in the commercial development of space and this is now an integral part of the Agency's enabling legislation through the Space Act. NASA's objective is to foster the use of the space environment for the development of commercial products and processes. Through alliances and agreements with several commercial companies and universities, SPACEHAB, Inc., has built a comprehensive package of services designed to provide low-cost reliable access to space for experimenters. These services provide opportunities to support engineering test beds for materials exposure analysis, to mitigate structural failures as observed on the Hubble Space Telescope; materials processing, remote sensing; space environment definition; and electronic experiments. The intent of this paper is to identify commercial opportunities for utilizing the International Space Station and provide examples of several facilities currently being designed and manufactured by commercial companies with the purpose of providing access to the space environment for commercial users.

Legal Consequences of the Pollution of Outer Space with Space Debris

Science.gov (United States)

Stubbe, Peter

2017-07-01

Space debris has grown to be a significant problem for outer space activities. The remnants of human activities in space are very diverse; they can be tiny paint flakes, all sorts of fragments, or entirely intact—but otherwise nonfunctional spacecraft and rocket bodies. The amount of debris is increasing at a growing pace, thus raising the risk of collision with operational satellites. Due to the relative high velocities involved in on-orbit collisions, their consequences are severe; collisions lead to significant damage or the complete destruction of the affected spacecraft. Protective measures and collision avoidance have thus become a major concern for spacecraft operators. The pollution of space with debris must, however, not only be seen as an unfavorable circumstance that accompanies space activities and increases the costs and complexity of outer space activities. Beyond this rather technical perspective, the presence of man-made, nonfunctional objects in space represents a global environmental concern. Similar to the patterns of other environmental problems on Earth, debris generation appears to have surpassed the absorption capacity of the space environment. Studies indicate that the evolution of the space object environment has crossed the tipping point to a runaway situation in which an increasing number of collisions―mostly among debris―leads to an uncontrolled population growth. It is thus in the interest of all mankind to address the debris problem in order to preserve the space environment for future generations. International space law protects the space environment. Article IX of the Outer Space Treaty obligates States to avoid the harmful contamination of outer space. The provision corresponds to the obligation to protect the environment in areas beyond national jurisdiction under the customary "no harm" rule of general environmental law. These norms are applicable to space debris and establish the duty not to pollute outer space by limiting

An efficient annotation and gene-expression derivation tool for Illumina Solexa datasets.

Science.gov (United States)

Hosseini, Parsa; Tremblay, Arianne; Matthews, Benjamin F; Alkharouf, Nadim W

2010-07-02

The data produced by an Illumina flow cell with all eight lanes occupied, produces well over a terabyte worth of images with gigabytes of reads following sequence alignment. The ability to translate such reads into meaningful annotation is therefore of great concern and importance. Very easily, one can get flooded with such a great volume of textual, unannotated data irrespective of read quality or size. CASAVA, a optional analysis tool for Illumina sequencing experiments, enables the ability to understand INDEL detection, SNP information, and allele calling. To not only extract from such analysis, a measure of gene expression in the form of tag-counts, but furthermore to annotate such reads is therefore of significant value. We developed TASE (Tag counting and Analysis of Solexa Experiments), a rapid tag-counting and annotation software tool specifically designed for Illumina CASAVA sequencing datasets. Developed in Java and deployed using jTDS JDBC driver and a SQL Server backend, TASE provides an extremely fast means of calculating gene expression through tag-counts while annotating sequenced reads with the gene's presumed function, from any given CASAVA-build. Such a build is generated for both DNA and RNA sequencing. Analysis is broken into two distinct components: DNA sequence or read concatenation, followed by tag-counting and annotation. The end result produces output containing the homology-based functional annotation and respective gene expression measure signifying how many times sequenced reads were found within the genomic ranges of functional annotations. TASE is a powerful tool to facilitate the process of annotating a given Illumina Solexa sequencing dataset. Our results indicate that both homology-based annotation and tag-count analysis are achieved in very efficient times, providing researchers to delve deep in a given CASAVA-build and maximize information extraction from a sequencing dataset. TASE is specially designed to translate sequence data

Design of Compact Particle Detector System Using FPGA for Space Particle Environment Measurement

Directory of Open Access Journals (Sweden)

K. Ryu

2007-06-01

Full Text Available We have designed a high resolution proton and electron telescope for the detection of high energy particles, which constitute a major part of the space environment. The flux of the particles, in the satellite orbits, can vary abruptly according to the position and solar activities. In this study, a conceptual design of the detector, for adapting these variations with a high energy resolution, was made and the performance was estimated. In addition, a parallel processing algorithm was devised and embodied using FPGA for the high speed data processing, capable of detecting high flux without losing energy resolution, on board a satellite.

Preservation of Near-Earth Space for Future Generations

Science.gov (United States)

Simpson, John A.

2007-05-01

List of contributors; Preface; Part I. Introduction: 1. Introduction J. A. Simpson; Part II. Defining the Problem: 2. The Earth satellite population: official growth and constituents Nicholas L. Johnson; 3. The current and future environment: an overall assessment Donald J. Kessler; 4. The current and future space debris environment as assessed in Europe Dietrich Rex; 5. Human survivability issues in the low Earth orbit space debris environment Bernard Bloom; 6. Protecting the space environment for astronomy Joel R. Primack; 7. Effects of space debris on commercial spacecraft - the RADARSAT example H. Robert Warren and M. J. Yelle; 8. Potential effects of the space debris environment on military space systems Albert E. Reinhardt; Part III. Mitigation of and Adaptation to the Space Environment: Techniques and Practices: 9. Precluding post-launch fragmentation of delta stages Irvin J. Webster and T. Y. Kawamura; 10. US international and interagency cooperation in orbital debris Daniel V. Jacobs; 11. ESA concepts for space debris mitigation and risk reduction Heiner Klinkrad; 12. Space debris: how France handles mitigation and adaptation Jean-Louis Marcé; 13. Facing seriously the issue of protection of the outer space environment Qi Yong Liang; 14. Space debris - mitigation and adaptation U. R. Rao; 15. Near Earth space contamination and counteractions Vladimir F. Utkin and S. V. Chekalin; 16. The current and future space debris environment as assessed in Japan Susumu Toda; 17. Orbital debris minimization and mitigation techniques Joseph P. Loftus Jr, Philip D. Anz-Meador and Robert Reynolds; Part IV. Economic Issues: 18. In pursuit of a sustainable space environment: economic issues in regulating space debris Molly K. Macauley; 19. The economics of space operations: insurance aspects Christopher T. W. Kunstadter; Part V. Legal Issues: 20. Environmental treatymaking: lessons learned for controlling pollution of outer space Winfried Lang; 21. Regulation of orbital

The simplified spherical harmonics (SPL) methodology with space and moment decomposition in parallel environments

International Nuclear Information System (INIS)

Gianluca, Longoni; Alireza, Haghighat

2003-01-01

In recent years, the SP L (simplified spherical harmonics) equations have received renewed interest for the simulation of nuclear systems. We have derived the SP L equations starting from the even-parity form of the S N equations. The SP L equations form a system of (L+1)/2 second order partial differential equations that can be solved with standard iterative techniques such as the Conjugate Gradient (CG). We discretized the SP L equations with the finite-volume approach in a 3-D Cartesian space. We developed a new 3-D general code, Pensp L (Parallel Environment Neutral-particle SP L ). Pensp L solves both fixed source and criticality eigenvalue problems. In order to optimize the memory management, we implemented a Compressed Diagonal Storage (CDS) to store the SP L matrices. Pensp L includes parallel algorithms for space and moment domain decomposition. The computational load is distributed on different processors, using a mapping function, which maps the 3-D Cartesian space and moments onto processors. The code is written in Fortran 90 using the Message Passing Interface (MPI) libraries for the parallel implementation of the algorithm. The code has been tested on the Pcpen cluster and the parallel performance has been assessed in terms of speed-up and parallel efficiency. (author)

Human Factors Virtual Analysis Techniques for NASA's Space Launch System Ground Support using MSFC's Virtual Environments Lab (VEL)

Science.gov (United States)

Searcy, Brittani

2017-01-01

Using virtual environments to assess complex large scale human tasks provides timely and cost effective results to evaluate designs and to reduce operational risks during assembly and integration of the Space Launch System (SLS). NASA's Marshall Space Flight Center (MSFC) uses a suite of tools to conduct integrated virtual analysis during the design phase of the SLS Program. Siemens Jack is a simulation tool that allows engineers to analyze human interaction with CAD designs by placing a digital human model into the environment to test different scenarios and assess the design's compliance to human factors requirements. Engineers at MSFC are using Jack in conjunction with motion capture and virtual reality systems in MSFC's Virtual Environments Lab (VEL). The VEL provides additional capability beyond standalone Jack to record and analyze a person performing a planned task to assemble the SLS at Kennedy Space Center (KSC). The VEL integrates Vicon Blade motion capture system, Siemens Jack, Oculus Rift, and other virtual tools to perform human factors assessments. By using motion capture and virtual reality, a more accurate breakdown and understanding of how an operator will perform a task can be gained. By virtual analysis, engineers are able to determine if a specific task is capable of being safely performed by both a 5% (approx. 5ft) female and a 95% (approx. 6'1) male. In addition, the analysis will help identify any tools or other accommodations that may to help complete the task. These assessments are critical for the safety of ground support engineers and keeping launch operations on schedule. Motion capture allows engineers to save and examine human movements on a frame by frame basis, while virtual reality gives the actor (person performing a task in the VEL) an immersive view of the task environment. This presentation will discuss the need of human factors for SLS and the benefits of analyzing tasks in NASA MSFC's VEL.

A Milestone in Commercial Space Weather: USTAR Center for Space Weather

Science.gov (United States)

Tobiska, W.; Schunk, R. W.; Sojka, J. J.; Thompson, D. C.; Scherliess, L.; Zhu, L.; Gardner, L. C.

2009-12-01

As of 2009, Utah State University (USU) hosts a new organization to develop commercial space weather applications using funding that has been provided by the State of Utah’s Utah Science Technology and Research (USTAR) initiative. The USTAR Center for Space Weather (UCSW) is located on the USU campus in Logan, Utah and is developing innovative applications for mitigating adverse space weather effects in technological systems. Space weather’s effects upon the near-Earth environment are due to dynamic changes in the Sun’s photons, particles, and fields. Of the space environment domains that are affected by space weather, the ionosphere is the key region that affects communication and navigation systems. The UCSW has developed products for users of systems that are affected by space weather-driven ionospheric changes. For example, on September 1, 2009 USCW released, in conjunction with Space Environment Technologies, the world’s first real-time space weather via an iPhone app. Space WX displays the real-time, current global ionosphere total electron content along with its space weather drivers; it is available through the Apple iTunes store and is used around the planet. The Global Assimilation of Ionospheric Measurements (GAIM) system is now being run operationally in real-time at UCSW with the continuous ingestion of hundreds of global data streams to dramatically improve the ionosphere’s characterization. We discuss not only funding and technical advances that have led to current products but also describe the direction for UCSW that includes partnering opportunities for moving commercial space weather into fully automated specification and forecasting over the next half decade.

Space Environmental Effects (SEE) Testing Capability: NASA/Marshall Space Flight Center

Science.gov (United States)

DeWittBurns, H.; Crave, Paul; Finckenor, Miria; Finchum, Charles; Nehls, Mary; Schneider, Todd; Vaughn, Jason

2012-01-01

Understanding the effects of the space environment on materials and systems is fundamental and essential for mission success. If not properly understood and designed for, the space environment can lead to materials degradation, reduction of functional lifetime, and system failure. Ground based testing is critical in predicting performance NASA/MSFC's expertise and capabilities make up the most complete SEE testing capability available.

Human–environment interactions in urban green spaces — A systematic review of contemporary issues and prospects for future research

Energy Technology Data Exchange (ETDEWEB)

Kabisch, Nadja, E-mail: nadja.kabisch@geo.hu-berlin.de [Institute of Geography, Humboldt-University Berlin, Unter den Linden 6, 10099 Berlin (Germany); Department of Urban and Environmental Sociology, Helmholtz Centre for Environmental Research — UFZ, 04318 Leipzig (Germany); Qureshi, Salman [Institute of Geography, Humboldt-University Berlin, Unter den Linden 6, 10099 Berlin (Germany); School of Architecture, Birmingham Institute of Art and Design, Birmingham City University, The Parkside Building, 5 Cardigan Street, Birmingham B4 7BD (United Kingdom); Haase, Dagmar [Institute of Geography, Humboldt-University Berlin, Unter den Linden 6, 10099 Berlin (Germany); Department of Computational Landscape Ecology, Helmholtz Centre for Environmental Research — UFZ, 04318 Leipzig (Germany)

2015-01-15

Scientific papers on landscape planning underline the importance of maintaining and developing green spaces because of their multiple environmental and social benefits for city residents. However, a general understanding of contemporary human–environment interaction issues in urban green space is still incomplete and lacks orientation for urban planners. This review examines 219 publications to (1) provide an overview of the current state of research on the relationship between humans and urban green space, (2) group the different research approaches by identifying the main research areas, methods, and target groups, and (3) highlight important future prospects in urban green space research. - Highlights: • Reviewed literature on urban green pins down a dearth of comparative studies. • Case studies in Africa and Russia are marginalized – the Europe and US dominate. • Questionnaires are used as major tool followed by GIS and quantitative approaches. • Developing countries should contribute in building an urban green space agenda. • Interdisciplinary, adaptable and pluralistic approaches can satiate a knowledge gap.

Human–environment interactions in urban green spaces — A systematic review of contemporary issues and prospects for future research

International Nuclear Information System (INIS)

Kabisch, Nadja; Qureshi, Salman; Haase, Dagmar

2015-01-01

Scientific papers on landscape planning underline the importance of maintaining and developing green spaces because of their multiple environmental and social benefits for city residents. However, a general understanding of contemporary human–environment interaction issues in urban green space is still incomplete and lacks orientation for urban planners. This review examines 219 publications to (1) provide an overview of the current state of research on the relationship between humans and urban green space, (2) group the different research approaches by identifying the main research areas, methods, and target groups, and (3) highlight important future prospects in urban green space research. - Highlights: • Reviewed literature on urban green pins down a dearth of comparative studies. • Case studies in Africa and Russia are marginalized – the Europe and US dominate. • Questionnaires are used as major tool followed by GIS and quantitative approaches. • Developing countries should contribute in building an urban green space agenda. • Interdisciplinary, adaptable and pluralistic approaches can satiate a knowledge gap

Strategies for "minimal growth maintenance" of cell cultures: a perspective on management for extended duration experimentation in the microgravity environment of a Space station

Science.gov (United States)

Krikorian, A. D.

1996-01-01

How cells manage without gravity and how they change in the absence of gravity are basic questions that only prolonged life on a Space station will enable us to answer. We know from investigations carried out on various kinds of Space vehicles and stations that profound physiological effects can and often to occur. We need to know more of the basic biochemistry and biophysics both of cells and of whole organisms in conditions of reduced gravity. The unique environment of Space affords plant scientists an unusual opportunity to carry out experiments in microgravity, but some major challenges must be faced before this can be done with confidence. Various laboratory activities that are routine on Earth take on special significance and offer problems that need imaginative resolution before even a relatively simple experiment can be reliably executed on a Space station. For example, scientists might wish to investigate whether adaptive or other changes that have occurred in the environment of Space are retained after return to Earth-normal conditions. Investigators seeking to carry out experiments in the low-gravity environment of Space using cultured cells will need to solve the problem of keeping cultures quiescent for protracted periods before an experiment is initiated, after periodic sampling is carried out, and after the experiment is completed. This review gives an evaluation of a range of strategies that can enable one to manipulate cell physiology and curtail growth dramatically toward this end. These strategies include cryopreservation, chilling, reduced oxygen, gel entrapment strategies, osmotic adjustment, nutrient starvation, pH manipulation, and the use of mitotic inhibitors and growth-retarding chemicals. Cells not only need to be rendered quiescent for protracted periods but they also must be recoverable and further grown if it is so desired. Elaboration of satisfactory procedures for management of cells and tissues at "near zero or minimal growth" will

Analyzing Test-As-You-Fly Single Event Upset (SEU) Responses using SEU Data, Classical Reliability Models, and Space Environment Data

Science.gov (United States)

Berg, Melanie; Label, Kenneth; Campola, Michael; Xapsos, Michael

2017-01-01

We propose a method for the application of single event upset (SEU) data towards the analysis of complex systems using transformed reliability models (from the time domain to the particle fluence domain) and space environment data.

Ionizing Radiation Environment on the International Space Station: Performance vs. Expectations for Avionics and Material

Science.gov (United States)

Koontz, Steven L.; Boeder, Paul A.; Pankop, Courtney; Reddell, Brandon

2005-01-01

The role of structural shielding mass in the design, verification, and in-flight performance of International Space Station (ISS), in both the natural and induced orbital ionizing radiation (IR) environments, is reported. Detailed consideration of the effects of both the natural and induced ionizing radiation environment during ISS design, development, and flight operations has produced a safe, efficient manned space platform that is largely immune to deleterious effects of the LEO ionizing radiation environment. The assumption of a small shielding mass for purposes of design and verification has been shown to be a valid worst-case approximation approach to design for reliability, though predicted dependences of single event effect (SEE) effects on latitude, longitude, SEP events, and spacecraft structural shielding mass are not observed. The Figure of Merit (FOM) method over predicts the rate for median shielding masses of about 10g/cm(exp 2) by only a factor of 3, while the Scott Effective Flux Approach (SEFA) method overestimated by about one order of magnitude as expected. The Integral Rectangular Parallelepiped (IRPP), SEFA, and FOM methods for estimating on-orbit (Single Event Upsets) SEU rates all utilize some version of the CREME-96 treatment of energetic particle interaction with structural shielding, which has been shown to underestimate the production of secondary particles in heavily shielded manned spacecraft. The need for more work directed to development of a practical understanding of secondary particle production in massive structural shielding for SEE design and verification is indicated. In contrast, total dose estimates using CAD based shielding mass distributions functions and the Shieldose Code provided a reasonable accurate estimate of accumulated dose in Grays internal to the ISS pressurized elements, albeit as a result of using worst-on-worst case assumptions (500 km altitude x 2) that compensate for ignoring both GCR and secondary particle

Individual thermal profiles as a basis for comfort improvement in space and other environments

Science.gov (United States)

Koscheyev, V. S.; Coca, A.; Leon, G. R.; Dancisak, M. J.

2002-01-01

BACKGROUND: The development of individualized countermeasures to address problems in thermoregulation is of considerable importance for humans in space and other extreme environments. A methodology is presented for evaluating minimal/maximal heat flux from the total human body and specific body zones, and for assessing individual differences in the efficiency of heat exchange from these body areas. The goal is to apply this information to the design of individualized protective equipment. METHODS: A multi-compartment conductive plastic tubing liquid cooling/warming garment (LCWG) was developed. Inlet water temperatures of 8-45 degrees C were imposed sequentially to specific body areas while the remainder of the garment was maintained at 33 degrees C. RESULTS: There were significant differences in heat exchange level among body zones in both the 8 degrees and 45 degrees C temperature conditions (p thermal profiles is feasible for better comfort of astronauts on long-duration missions and personnel in other extreme environments.

Dark current spectroscopy of space and nuclear environment induced displacement damage defects in pinned photodiode based CMOS image sensors

International Nuclear Information System (INIS)

Belloir, Jean-Marc

2016-01-01

CMOS image sensors are envisioned for an increasing number of high-end scientific imaging applications such as space imaging or nuclear experiments. Indeed, the performance of high-end CMOS image sensors has dramatically increased in the past years thanks to the unceasing improvements of microelectronics, and these image sensors have substantial advantages over CCDs which make them great candidates to replace CCDs in future space missions. However, in space and nuclear environments, CMOS image sensors must face harsh radiation which can rapidly degrade their electro-optical performances. In particular, the protons, electrons and ions travelling in space or the fusion neutrons from nuclear experiments can displace silicon atoms in the pixels and break the crystalline structure. These displacement damage effects lead to the formation of stable defects and to the introduction of states in the forbidden bandgap of silicon, which can allow the thermal generation of electron-hole pairs. Consequently, non ionizing radiation leads to a permanent increase of the dark current of the pixels and thus a decrease of the image sensor sensitivity and dynamic range. The aim of the present work is to extend the understanding of the effect of displacement damage on the dark current increase of CMOS image sensors. In particular, this work focuses on the shape of the dark current distribution depending on the particle type, energy and fluence but also on the image sensor physical parameters. Thanks to the many conditions tested, an empirical model for the prediction of the dark current distribution induced by displacement damage in nuclear or space environments is experimentally validated and physically justified. Another central part of this work consists in using the dark current spectroscopy technique for the first time on irradiated CMOS image sensors to detect and characterize radiation-induced silicon bulk defects. Many types of defects are detected and two of them are identified

A facility for training Space Station astronauts

Science.gov (United States)

Hajare, Ankur R.; Schmidt, James R.

1992-01-01

The Space Station Training Facility (SSTF) will be the primary facility for training the Space Station Freedom astronauts and the Space Station Control Center ground support personnel. Conceptually, the SSTF will consist of two parts: a Student Environment and an Author Environment. The Student Environment will contain trainers, instructor stations, computers and other equipment necessary for training. The Author Environment will contain the systems that will be used to manage, develop, integrate, test and verify, operate and maintain the equipment and software in the Student Environment.

The NASA/National Space Science Data Center trapped radiation environment model program, 1964 - 1991

International Nuclear Information System (INIS)

Vette, J.I.

1991-11-01

The major effort that NASA, initially with the help of the United States Air Force (USAF), carried out for 27 years to synthesize the experimental and theoretical results of space research related to energetic charged particles into a quantitative description of the terrestrial trapped radiation environment in the form of model environments is detailed. The effort is called the Trapped Radiation Environment Modeling Program (TREMP). In chapter 2 the historical background leading to the establishment of this program is given. Also, the purpose of this modeling program as established by the founders of the program is discussed. This is followed in chapter 3 by the philosophy and approach that was applied in this program throughout its lifetime. As will be seen, this philosophy led to the continuation of the program long after it would have expired. The highlights of the accomplishments are presented in chapter 4. A view to future possible efforts in this arena is given in chapter 5, mainly to pass on to future workers the differences that are perceived from these many years of experience. Chapter 6 is an appendix that details the chronology of the development of TREMP. Finally, the references, which document the work accomplished over these years, are presented in chapter 7

The impact of long-term exposure to space environment on adult mammalian organisms: a study on mouse thyroid and testis.

Directory of Open Access Journals (Sweden)

Maria Angela Masini

Full Text Available Hormonal changes in humans during spaceflight have been demonstrated but the underlying mechanisms are still unknown. To clarify this point thyroid and testis/epididymis, both regulated by anterior pituitary gland, have been analyzed on long-term space-exposed male C57BL/10 mice, either wild type or pleiotrophin transgenic, overexpressing osteoblast stimulating factor-1. Glands were submitted to morphological and functional analysis.In thyroids, volumetric ratios between thyrocytes and colloid were measured. cAMP production in 10(-7M and 10(-8M thyrotropin-treated samples was studied. Thyrotropin receptor and caveolin-1 were quantitized by immunoblotting and localized by immunofluorescence. In space-exposed animals, both basal and thyrotropin-stimulated cAMP production were always higher. Also, the structure of thyroid follicles appeared more organized, while thyrotropin receptor and caveolin-1 were overexpressed. Unlike the control samples, in the space samples thyrotropin receptor and caveolin-1 were both observed at the intracellular junctions, suggesting their interaction in specific cell membrane microdomains.In testes, immunofluorescent reaction for 3β- steroid dehydrogenase was performed and the relative expressions of hormone receptors and interleukin-1β were quantified by RT-PCR. Epididymal sperm number was counted. In space-exposed animals, the presence of 3β and 17β steroid dehydrogenase was reduced. Also, the expression of androgen and follicle stimulating hormone receptors increased while lutenizing hormone receptor levels were not affected. The interleukin 1 β expression was upregulated. The tubular architecture was altered and the sperm cell number was significantly reduced in spaceflight mouse epididymis (approx. -90% vs. laboratory and ground controls, indicating that the space environment may lead to degenerative changes in seminiferous tubules.Space-induced changes of structure and function of thyroid and testis

Management of outer space

Science.gov (United States)

Perek, Lubos

1993-10-01

Various aspects of space-environment management are discussed. Attention is called to the fact that, while space radio communications are already under an adequate management by the International Communications Union, the use of nuclear power sources is regulated by the recently adopted set of principles, and space debris will be discussed in the near future at the UN COPUOS, other aspects of management of outer space received little or no attention of the international community. These include the competency of crews and technical equipment of spacecraft launched by newcomers to space exploration; monitoring of locations and motions of space objects (now in national hands), with relevant data made accessible through a computer network; and the requirement to use space only for beneficial purposes and not for promoting narrow and debatable interests damaging the outer space environment and impeding on astronomical observations. It is suggested that some of these tasks would be best performed by an international space agency within the UN system of organizations.

Space Biology and Medicine. Volume 4; Health, Performance, and Safety of Space Crews

Science.gov (United States)

Dietlein, Lawrence F. (Editor); Pestov, Igor D. (Editor)

2004-01-01

Volume IV is devoted to examining the medical and associated organizational measures used to maintain the health of space crews and to support their performance before, during, and after space flight. These measures, collectively known as the medical flight support system, are important contributors to the safety and success of space flight. The contributions of space hardware and the spacecraft environment to flight safety and mission success are covered in previous volumes of the Space Biology and Medicine series. In Volume IV, we address means of improving the reliability of people who are required to function in the unfamiliar environment of space flight as well as the importance of those who support the crew. Please note that the extensive collaboration between Russian and American teams for this volume of work resulted in a timeframe of publication longer than originally anticipated. Therefore, new research or insights may have emerged since the authors composed their chapters and references. This volume includes a list of authors' names and addresses should readers seek specifics on new information. At least three groups of factors act to perturb human physiological homeostasis during space flight. All have significant influence on health, psychological, and emotional status, tolerance, and work capacity. The first and most important of these factors is weightlessness, the most specific and radical change in the ambient environment; it causes a variety of functional and structural changes in human physiology. The second group of factors precludes the constraints associated with living in the sealed, confined environment of spacecraft. Although these factors are not unique to space flight, the limitations they entail in terms of an uncomfortable environment can diminish the well-being and performance of crewmembers in space. The third group of factors includes the occupational and social factors associated with the difficult, critical nature of the

Integration of Space Weather Forecasts into Space Protection

Science.gov (United States)

Reeves, G.

2012-09-01

How would the US respond to a clandestine attack that disabled one of our satellites? How would we know that it was an attack, not a natural failure? The goal of space weather programs as applied to space protection are simple: Provide a rapid and reliable assessment of the probability that satellite or system failure was caused by the space environment. Achieving that goal is not as simple. However, great strides are being made on a number of fronts. We will report on recent successes in providing rapid, automated anomaly/attack assessment for the penetrating radiation environment in the Earth's radiation belts. We have previously reported on the Dynamic Radiation Environment Assimilation Model (DREAM) that was developed at Los Alamos National Laboratory to assess hazards posed by the natural and by nuclear radiation belts. This year we will report on recent developments that are moving this program from the research, test, and evaluation phases to real-time implementation and application. We will discuss the challenges of leveraging space environment data sets for applications that are beyond the scope of mission requirements, the challenges of moving data from where they exist to where they are needed, the challenges of turning data into actionable information, and how those challenges were overcome. We will discuss the state-of-the-art as it exists in 2012 including the new capabilities that have been enabled and the limitations that still exist. We will also discuss how currently untapped data resources could advance the state-of-the-art and the future steps for implementing automatic real-time anomaly forensics.

Mapping the space radiation environment in LEO orbit by the SATRAM Timepix payload on board the Proba-V satellite

Energy Technology Data Exchange (ETDEWEB)

Granja, Carlos, E-mail: carlos.granja@utef.cvut.cz; Polansky, Stepan

2016-07-07

Detailed spatial- and time-correlated maps of the space radiation environment in Low Earth Orbit (LEO) are produced by the spacecraft payload SATRAM operating in open space on board the Proba-V satellite from the European Space Agency (ESA). Equipped with the hybrid semiconductor pixel detector Timepix, the compact radiation monitor payload provides the composition and spectral characterization of the mixed radiation field with quantum-counting and imaging dosimetry sensitivity, energetic charged particle tracking, directionality and energy loss response in wide dynamic range in terms of particle types, dose rates and particle fluxes. With a polar orbit (sun synchronous, 98° inclination) at the altitude of 820 km the payload samples the space radiation field at LEO covering basically the whole planet. First results of long-period data evaluation in the form of time-and spatially-correlated maps of total dose rate (all particles) are given.

ISS Local Environment Spectrometers (ISLES)

Science.gov (United States)

Krause, Linda Habash; Gilchrist, Brian E.

2014-01-01

In order to study the complex interactions between the space environment surrounding the ISS and the ISS surface materials, we propose to use lowcost, high-TRL plasma sensors on the ISS robotic arm to probe the ISS space environment. During many years of ISS operation, we have been able to condut effective (but not perfect) extravehicular activities (both human and robotic) within the perturbed local ISS space environment. Because of the complexity of the interaction between the ISS and the LEO space environment, there remain important questions, such as differential charging at solar panel junctions (the so-called "triple point" between conductor, dielectric, and space plasma), increased chemical contamination due to ISS surface charging and/or thruster activation, water dumps, etc, and "bootstrap" charging of insulating surfaces. Some compelling questions could synergistically draw upon a common sensor suite, which also leverages previous and current MSFC investments. Specific questions address ISS surface charging, plasma contactor plume expansion in a magnetized drifting plasma, and possible localized contamination effects across the ISS.

Construction and Evaluation of an Integrated Formal/Informal Learning Environment for Foreign Language Learning across Real and Virtual Spaces

Science.gov (United States)

Waragai, Ikumi; Ohta, Tatsuya; Kurabayashi, Shuichi; Kiyoki, Yasushi; Sato, Yukiko; Brückner, Stefan

2017-01-01

This paper presents the prototype of a foreign language learning space, based on the construction of an integrated formal/informal learning environment. Before the background of the continued innovation of information technology that places conventional learning styles and educational methods into new contexts based on new value-standards,…

Investigation of Secondary Neutron Production in Large Space Vehicles for Deep Space

Science.gov (United States)

Rojdev, Kristina; Koontz, Steve; Reddell, Brandon; Atwell, William; Boeder, Paul

2016-01-01

Future NASA missions will focus on deep space and Mars surface operations with large structures necessary for transportation of crew and cargo. In addition to the challenges of manufacturing these large structures, there are added challenges from the space radiation environment and its impacts on the crew, electronics, and vehicle materials. Primary radiation from the sun (solar particle events) and from outside the solar system (galactic cosmic rays) interact with materials of the vehicle and the elements inside the vehicle. These interactions lead to the primary radiation being absorbed or producing secondary radiation (primarily neutrons). With all vehicles, the high-energy primary radiation is of most concern. However, with larger vehicles, there is more opportunity for secondary radiation production, which can be significant enough to cause concern. In a previous paper, we embarked upon our first steps toward studying neutron production from large vehicles by validating our radiation transport codes for neutron environments against flight data. The following paper will extend the previous work to focus on the deep space environment and the resulting neutron flux from large vehicles in this deep space environment.

Contemporary state of spacecraft/environment interaction research

CERN Document Server

Novikov, L S

1999-01-01

Various space environment effects on spacecraft materials and equipment, and the reverse effects of spacecrafts and rockets on space environment are considered. The necessity of permanent updating and perfection of our knowledge on spacecraft/environment interaction processes is noted. Requirements imposed on models of space environment in theoretical and experimental researches of various aspects of the spacecraft/environment interaction problem are formulated. In this field, main problems which need to be solved today and in the nearest future are specified. The conclusion is made that the joint analysis of both aspects of spacecraft/environment interaction problem promotes the most effective solution of the problem.

Smart space technology innovations

CERN Document Server

Chen, Mu-Yen

2013-01-01

Recently, ad hoc and wireless communication technologies have made available the device, service and information rich environment for users. Smart Space and ubiquitous computing extend the ""Living Lab"" vision of everyday objects and provide context-awareness services to users in smart living environments. This ebook investigates smart space technology and its innovations around the Living Labs. The final goal is to build context-awareness smart space and location-based service applications that integrate information from independent systems which autonomously and securely support human activ

Performances of Kevlar and Polyethylene as radiation shielding on-board the International Space Station in high latitude radiation environment.

Science.gov (United States)

Narici, Livio; Casolino, Marco; Di Fino, Luca; Larosa, Marianna; Picozza, Piergiorgio; Rizzo, Alessandro; Zaconte, Veronica

2017-05-10

Passive radiation shielding is a mandatory element in the design of an integrated solution to mitigate the effects of radiation during long deep space voyages for human exploration. Understanding and exploiting the characteristics of materials suitable for radiation shielding in space flights is, therefore, of primary importance. We present here the results of the first space-test on Kevlar and Polyethylene radiation shielding capabilities including direct measurements of the background baseline (no shield). Measurements are performed on-board of the International Space Station (Columbus modulus) during the ALTEA-shield ESA sponsored program. For the first time the shielding capability of such materials has been tested in a radiation environment similar to the deep-space one, thanks to the feature of the ALTEA system, which allows to select only high latitude orbital tracts of the International Space Station. Polyethylene is widely used for radiation shielding in space and therefore it is an excellent benchmark material to be used in comparative investigations. In this work we show that Kevlar has radiation shielding performances comparable to the Polyethylene ones, reaching a dose rate reduction of 32 ± 2% and a dose equivalent rate reduction of 55 ± 4% (for a shield of 10 g/cm 2 ).

Space Biology Model Organism Research on the Deep Space Gateway to Pioneer Discovery and Advance Human Space Exploration

Science.gov (United States)

Sato, K. Y.; Tomko, D. L.; Levine, H. G.; Quincy, C. D.; Rayl, N. A.; Sowa, M. B.; Taylor, E. M.; Sun, S. C.; Kundrot, C. E.

2018-02-01

Model organisms are foundational for conducting physiological and systems biology research to define how life responds to the deep space environment. The organisms, areas of research, and Deep Space Gateway capabilities needed will be presented.

Space and crime in Dutch built environments : Macro and micro scale spatial conditions for residential burglaries and thefts from cars

NARCIS (Netherlands)

Lopez, M.J.J.; Van Nes, A.

2007-01-01

At this moment, more knowledge is available on the physical characteristics of the built environment and their relationship to criminal opportunity rather than the spatial characteristics of potential targets and the public and private space between them. To improve this situation, a research

Looking toward to the next-generation space weather forecast system. Comments former a former space weather forecaster

International Nuclear Information System (INIS)

Tomita, Fumihiko

1999-01-01

In the 21st century, man's space-based activities will increase significantly and many kinds of space utilization technologies will assume a vital role in the infrastructure, creating new businesses, securing the global environment, contributing much to human welfare in the world. Communications Research Laboratory (CRL) has been contributing to the safety of human activity in space and to the further understanding of the solar terrestrial environment through the study of space weather, including the upper atmosphere, magnetosphere, interplanetary space, and the sun. The next-generation Space Weather Integrated Monitoring System (SWIMS) for future space activities based on the present international space weather forecasting system is introduced in this paper. (author)

Problema ne v korruptsii, no v jevrobjurokratii / Dmitri Kulikov

Index Scriptorium Estoniae

Kulikov, Dmitri

2005-01-01

Eesti korrumpeerumise madal tase - 31. koht 145 riigi seas organisatsiooni Transparency International aruandes - tagab riigi konkurentsivõime ning välisinvestorite huvi. Konjunktuuriinstituudi uuring suhtumisest korruptsiooni

Bio-Inspired Space Environment-Resistant Polymer Composite

Data.gov (United States)

National Aeronautics and Space Administration — Use of inorganic nanoparticles which have been recently explored for therapeutic purposes in the treatment of oxidative stress disorder, cancer and heart diseases...

Laboratory Investigation of Space and Planetary Dust Grains

Science.gov (United States)

Spann, James

2005-01-01

Dust in space is ubiquitous and impacts diverse observed phenomena in various ways. Understanding the dominant mechanisms that control dust grain properties and its impact on surrounding environments is basic to improving our understanding observed processes at work in space. There is a substantial body of work on the theory and modeling of dust in space and dusty plasmas. To substantiate and validate theory and models, laboratory investigations and space borne observations have been conducted. Laboratory investigations are largely confined to an assembly of dust grains immersed in a plasma environment. Frequently the behaviors of these complex dusty plasmas in the laboratory have raised more questions than verified theories. Space borne observations have helped us characterize planetary environments. The complex behavior of dust grains in space indicates the need to understand the microphysics of individual grains immersed in a plasma or space environment.

Occupational Space Medicine

Science.gov (United States)

Tarver, William J.

2012-01-01

Learning Objectives are: (1) Understand the unique work environment of astronauts. (2) Understand the effect microgravity has on human physiology (3) Understand how NASA Space Medicine Division is mitigating the health risks of space missions.

Free-space optical channel characterization and experimental validation in a coastal environment

KAUST Repository

Alheadary, Wael Ghazy

2018-03-05

Over the years, free-space optical (FSO) communication has attracted considerable research interest owing to its high transmission rates via the unbounded and unlicensed bandwidths. Nevertheless, various weather conditions lead to significant deterioration of the FSO link capabilities. In this context, we report on the modelling of the channel attenuation coefficient (β) for a coastal environment and related ambient, considering the effect of coastal air temperature (T), relative humidity (RH) and dew point (TD) by employing a mobile FSO communication system capable of achieving a transmission rate of 1 Gbps at an outdoor distance of 70 m for optical beam wavelengths of 1310 nm and 1550 nm. For further validation of the proposed models, an indoor measurement over a 1.5 m distance utilizing 1310 nm, 1550 nm, and 1064 nm lasers was also performed. The first model provides a general link between T and β, while the second model provides a relation between β, RH as well as TD. By validating our attenuation coefficient model with actual outdoor and indoor experiments, we obtained a scaling parameter x and decaying parameter c values of 19.94, 40.02, 45.82 and 0.03015, 0.04096, 0.0428 for wavelengths of 1550, 1310, 1064 nm, respectively. The proposed models are well validated over the large variation of temperature and humidity over the FSO link in a coastal region and emulated indoor environment.

Free-space optical channel characterization and experimental validation in a coastal environment

KAUST Repository

Alheadary, Wael Ghazy; Park, Kihong; Alfaraj, Nasir; Guo, Yujian; Stegenburgs, Edgars; Ng, Tien Khee; Ooi, Boon S.; Alouini, Mohamed-Slim

2018-01-01

Over the years, free-space optical (FSO) communication has attracted considerable research interest owing to its high transmission rates via the unbounded and unlicensed bandwidths. Nevertheless, various weather conditions lead to significant deterioration of the FSO link capabilities. In this context, we report on the modelling of the channel attenuation coefficient (β) for a coastal environment and related ambient, considering the effect of coastal air temperature (T), relative humidity (RH) and dew point (TD) by employing a mobile FSO communication system capable of achieving a transmission rate of 1 Gbps at an outdoor distance of 70 m for optical beam wavelengths of 1310 nm and 1550 nm. For further validation of the proposed models, an indoor measurement over a 1.5 m distance utilizing 1310 nm, 1550 nm, and 1064 nm lasers was also performed. The first model provides a general link between T and β, while the second model provides a relation between β, RH as well as TD. By validating our attenuation coefficient model with actual outdoor and indoor experiments, we obtained a scaling parameter x and decaying parameter c values of 19.94, 40.02, 45.82 and 0.03015, 0.04096, 0.0428 for wavelengths of 1550, 1310, 1064 nm, respectively. The proposed models are well validated over the large variation of temperature and humidity over the FSO link in a coastal region and emulated indoor environment.

Cognitive Neuroscience in Space

Directory of Open Access Journals (Sweden)

Gabriel G. De la Torre

2014-07-01

Full Text Available Humans are the most adaptable species on this planet, able to live in vastly different environments on Earth. Space represents the ultimate frontier and a true challenge to human adaptive capabilities. As a group, astronauts and cosmonauts are selected for their ability to work in the highly perilous environment of space, giving their best. Terrestrial research has shown that human cognitive and perceptual motor performances deteriorate under stress. We would expect to observe these effects in space, which currently represents an exceptionally stressful environment for humans. Understanding the neurocognitive and neuropsychological parameters influencing space flight is of high relevance to neuroscientists, as well as psychologists. Many of the environmental characteristics specific to space missions, some of which are also present in space flight simulations, may affect neurocognitive performance. Previous work in space has shown that various psychomotor functions degrade during space flight, including central postural functions, the speed and accuracy of aimed movements, internal timekeeping, attentional processes, sensing of limb position and the central management of concurrent tasks. Other factors that might affect neurocognitive performance in space are illness, injury, toxic exposure, decompression accidents, medication side effects and excessive exposure to radiation. Different tools have been developed to assess and counteract these deficits and problems, including computerized tests and physical exercise devices. It is yet unknown how the brain will adapt to long-term space travel to the asteroids, Mars and beyond. This work represents a comprehensive review of the current knowledge and future challenges of cognitive neuroscience in space from simulations and analog missions to low Earth orbit and beyond.

Cosmogenic radionuclides. Theory and applications in the terrestrial and space environments

International Nuclear Information System (INIS)

Beer, Juerg; Steiger, Rudolf von; McCracken, Ken

2012-01-01

Cosmogenic radionuclides are radioactive isotopes which are produced by natural processes and distributed within the Earth system. With a holistic view of the environment the authors show in this book how cosmogenic radionuclides can be used to trace and to reconstruct the history of a large variety of processes. They discuss the way in which cosmogenic radionuclides can assist in the quantification of complex processes in the present-day environment. The book aims to demonstrate to the reader the strength of analytic tools based on cosmogenic radionuclides, their contribution to almost any field of modern science, and how these tools may assist in the solution of many present and future problems that we face here on Earth. The book provides a comprehensive discussion of the basic principles behind the applications of cosmogenic (and other) radionuclides as environmental tracers and dating tools. The second section of the book discusses in some detail the production of radionuclides by cosmic radiation, their transport and distribution in the atmosphere and the hydrosphere, their storage in natural archives, and how they are measured. The third section of the book presents a number of examples selected to illustrate typical tracer and dating applications in a number of different spheres (atmosphere, hydrosphere, geosphere, biosphere, solar physics and astronomy). At the same time the authors have outlined the limitations of the use of cosmogenic radionuclides. Written on a level understandable by graduate students without specialist skills in physics or mathematics, the book addresses a wide audience, ranging from archaeology, biophysics, and geophysics, to atmospheric physics, hydrology, astrophysics and space science.

Cosmogenic radionuclides. Theory and applications in the terrestrial and space environments

Energy Technology Data Exchange (ETDEWEB)

Beer, Juerg [Eidgenoessische Anstalt fuer Wasserversorgung, Abwasserreinigung und Gewaesserschutz, Duebendorf (Switzerland); Steiger, Rudolf von [International Space Science Insitute, Bern (Switzerland); McCracken, Ken [Maryland Univ., College Park (United States). IPST

2012-07-01

Cosmogenic radionuclides are radioactive isotopes which are produced by natural processes and distributed within the Earth system. With a holistic view of the environment the authors show in this book how cosmogenic radionuclides can be used to trace and to reconstruct the history of a large variety of processes. They discuss the way in which cosmogenic radionuclides can assist in the quantification of complex processes in the present-day environment. The book aims to demonstrate to the reader the strength of analytic tools based on cosmogenic radionuclides, their contribution to almost any field of modern science, and how these tools may assist in the solution of many present and future problems that we face here on Earth. The book provides a comprehensive discussion of the basic principles behind the applications of cosmogenic (and other) radionuclides as environmental tracers and dating tools. The second section of the book discusses in some detail the production of radionuclides by cosmic radiation, their transport and distribution in the atmosphere and the hydrosphere, their storage in natural archives, and how they are measured. The third section of the book presents a number of examples selected to illustrate typical tracer and dating applications in a number of different spheres (atmosphere, hydrosphere, geosphere, biosphere, solar physics and astronomy). At the same time the authors have outlined the limitations of the use of cosmogenic radionuclides. Written on a level understandable by graduate students without specialist skills in physics or mathematics, the book addresses a wide audience, ranging from archaeology, biophysics, and geophysics, to atmospheric physics, hydrology, astrophysics and space science.

Cryogenic explosion environment modeling and testing of space shuttle and light-weight radioisotope heater unit interactions

International Nuclear Information System (INIS)

Johnson, E.W.

1985-10-01

In order to assess the risk to the world's populace in the event of a Space Shuttle accident when radioisotope-containing heat sources are on board, testing of that system must be performed to determine release point, environments required, and the size distribution of the released fuel. To evaluate the performance of the Light-Weight Radioisotope Heater Unit (LWRHU) (101 of these 1-W items are placed on the Galileo spacecraft which will be launched from the Space Shuttle), some high-velocity impact and flyer plate testing was carried out. The results showed that a bare urania-fueled LWRHU clad (approximately 1-mm thick platinum-30 wt % rhodium alloy) will withstand 1100 m/s flyer plate (3.5-mm thick aluminum) impacts and 330 m/s impacts upon the Space Shuttle floor (approximately 12-mm thick aluminum) without rupture or fuel release. Velocities in the order of 600 m/s on a steel surface will cause clad failure with fuel release. The fuel breakup patterns were characterized as to quantity in a specific size range. These data were employed in the formal Safety Analysis Report for the LWRHU to support the planned 1986 Galileo launch. 19 figs

On Space Warfare: A Space Power Doctrine

National Research Council Canada - National Science Library

Lupton, David

1998-01-01

.... Nevertheless, the speech was promptly dubbed "Star Wars" because the space environment seems to be the most likely place to deploy a ballistic missile defense system, and several administration...

Radiation dosimetry onboard the International Space Station ISS

International Nuclear Information System (INIS)

Berger, Thomas

2008-01-01

Besides the effects of the microgravity environment, and the psychological and psychosocial problems encountered in confined spaces, radiation is the main health detriment for long duration human space missions. The radiation environment encountered in space differs in nature front that on earth, consisting mostly of high energetic ions from protons up to iron, resulting in radiation levels far exceeding the ones encountered on earth for occupational radiation workers. Therefore the determination and the control of the radiation load on astronauts is a moral obligation of the space faring nations. The requirements for radiation detectors in space are very different to that on earth. Limitations in mass, power consumption and the complex nature of the space radiation environment define and limit the overall construction of radiation detectors. Radiation dosimetry onboard the International Space Station (ISS) is accomplished to one part as ''operational'' dosimetry aiming for area monitoring of the radiation environment as well as astronaut surveillance. Another part focuses on ''scientific'' dosimetry aiming for a better understanding of the radiation environment and its constitutes. Various research activities for a more detailed quantification of the radiation environment as well as its distribution in and outside the space station have been accomplished in the last years onboard the ISS. The paper will focus on the current radiation detectors onboard the ISS, their results, as well as on future planned activities. (orig.)

Real-time maneuver optimization of space-based robots in a dynamic environment: Theory and on-orbit experiments

Science.gov (United States)

Chamitoff, Gregory E.; Saenz-Otero, Alvar; Katz, Jacob G.; Ulrich, Steve; Morrell, Benjamin J.; Gibbens, Peter W.

2018-01-01

This paper presents the development of a real-time path-planning optimization approach to controlling the motion of space-based robots. The algorithm is capable of planning three dimensional trajectories for a robot to navigate within complex surroundings that include numerous static and dynamic obstacles, path constraints and performance limitations. The methodology employs a unique transformation that enables rapid generation of feasible solutions for complex geometries, making it suitable for application to real-time operations and dynamic environments. This strategy was implemented on the Synchronized Position Hold Engage Reorient Experimental Satellite (SPHERES) test-bed on the International Space Station (ISS), and experimental testing was conducted onboard the ISS during Expedition 17 by the first author. Lessons learned from the on-orbit tests were used to further refine the algorithm for future implementations.

Weightless environment simulation test; Mujuryo simulation shiken

Energy Technology Data Exchange (ETDEWEB)

Kobayashi, K.; Yamamoto, T.; Kato, F. [Kawasaki Heavy Industries, Ltd., Kobe (Japan)

1997-07-20

Kawasaki Heavy Industries, Ltd., delivered a Weightless Environment Test System (WETS) to National Space Development Agency of Japan in 1994. This system creates a weightless environment similar to that in space by balancing gravity and buoyancy in the water, and is constituted of a large water tank, facilities to supply air and cooling water to space suits worn in the water, etc. In this report, a weightless environment simulation test and the facilities to supply air and cooling water are described. In the weightless environment simulation test, the astronaut to undergo tests and training wears a space suit quite similar to the suit worn on the orbit, and performs EVA/IVA (extravehicular activities/intravehicular activities) around a JEM (Japanese Experimental Module) mockup installed in the water verifying JEM design specifications, preparing manuals for operations on the orbit, or receives basic space-related drill and training. An EVA weightless environment simulation test No. 3 was accomplished with success in January, 1997, when the supply of breathing water and cooling water to the space suit, etc., were carried out with safety and reliability. 2 refs., 8 figs., 2 tabs.

Assessing hydrodynamic space use of brown trout, Salmo trutta, in a complex flow environment: a return to first principles.

Science.gov (United States)

Kerr, James R; Manes, Costantino; Kemp, Paul S

2016-11-01

It is commonly assumed that stream-dwelling fish should select positions where they can reduce energetic costs relative to benefits gained and enhance fitness. However, the selection of appropriate hydrodynamic metrics that predict space use is the subject of recent debate and a cause of controversy. This is for three reasons: (1) flow characteristics are often oversimplified, (2) confounding variables are not always controlled and (3) there is limited understanding of the explanatory mechanisms that underpin the biophysical interactions between fish and their hydrodynamic environment. This study investigated the space use of brown trout, Salmo trutta, in a complex hydrodynamic flow field created using an array of different sized vertically oriented cylinders in a large open-channel flume in which confounding variables were controlled. A hydrodynamic drag function (D) based on single-point time-averaged velocity statistics that incorporates the influence of turbulent fluctuations was used to infer the energetic cost of steady swimming. Novel hydrodynamic preference curves were developed and used to assess the appropriateness of D as a descriptor of space use compared with other commonly used metrics. Zones in which performance-enhancing swimming behaviours (e.g. Kármán gaiting, entraining and bow riding) that enable fish to hold position while reducing energetic costs (termed 'specialised behaviours') were identified and occupancy was recorded. We demonstrate that energy conservation strategies play a key role in space use in an energetically taxing environment with the majority of trout groups choosing to frequently occupy areas in which specialised behaviours may be adopted or by selecting low-drag regions. © 2016. Published by The Company of Biologists Ltd.

Inventorying the molecular potential of Cupriavidus and Ralstonia strains surviving harsh space-related environments

Science.gov (United States)

Mijnendonckx, Kristel; van Houdt, Rob; Provoost, Ann; Bossus, Albert; Ott, C. Mark; Venkateswaran, Kasthuri; Leys, Natalie

The craving of modern man to explore life beyond earth presents a lot of challenges. The control of microbial contamination of the confined manned spacecraft is an important aspect that has to be taken into account in this journey. Because the human body contains a huge amount of microorganisms, the crew itself is the most important contamination source. But contamination can also originate from residing environmental microorganisms or from materials that are supplied from the Earth. These microbial contaminations can cause problems for the astronauts -well documented to have a decreased immunity -and the infrastructure of the space station. In this study, 14 different Cupriavidus metallidurans and Ralstonia pickettii strains, isolated from such space-related environments, where characterised in detail. These unique strains were isolated from drinking water that returned from ISS (3), from the cooling water system of the American ISS segment (4), from a swab sample of the Mars Odyssey Orbitor surface prior to flight (4), and from an air sample taken in the space assembly facility PHSF during Mars exploration Rover assembly (3). Their resistance to heavy metals and antibiotics was screened. The C. metallidurans isolates were more resistant to Zn2+ and Hg+ but more sensitive to Ni2+ than the R. pickettii strains. The MIC values for Cu2+ ranged from 1,5mM to 12mM, for Co2+ from 1,58mM to 12,63mM and for Cd2+ from 0,25mM to 1mM. For Ni2+ , the MIC values were between 2 and 8mM, except for the strain C. metallidurans IV (0502478) that was able to grow on Ni+2 concentrations up to 48mM. A metal of special interest was Ag+ because it is used to sanitize ISS drinking water. The strains isolated from air and surface samples showed a MIC value ranging from 0,35µM to 4µM. The isolates from the water samples had MIC values from 0,3µM to 2µM, which is lower than (or comparable with) the lowest limit of the silver concentration used in the ISS (1,9µM -4,6µM). However, all

Scientific projection paper for space radiobiological research

International Nuclear Information System (INIS)

Vinograd, S.P.

1980-01-01

A nationale for the radiobiological research requirements for space is rooted in a national commitment to the exploration of space, mandated in the form of the National Space Act. This research is almost entirely centered on man; more specifically, on the effects of the space radiation environment on man and his protection from them. The research needs discussed in this presentation include the space radiation environment; dosimetry; radiation biology-high LET particles (dose/response); and operational countermeasures

Automation of closed environments in space for human comfort and safety

Science.gov (United States)

1992-01-01

This report culminates the work accomplished during a three year design project on the automation of an Environmental Control and Life Support System (ECLSS) suitable for space travel and colonization. The system would provide a comfortable living environment in space that is fully functional with limited human supervision. A completely automated ECLSS would increase astronaut productivity while contributing to their safety and comfort. The first section of this report, section 1.0, briefly explains the project, its goals, and the scheduling used by the team in meeting these goals. Section 2.0 presents an in-depth look at each of the component subsystems. Each subsection describes the mathematical modeling and computer simulation used to represent that portion of the system. The individual models have been integrated into a complete computer simulation of the CO2 removal process. In section 3.0, the two simulation control schemes are described. The classical control approach uses traditional methods to control the mechanical equipment. The expert control system uses fuzzy logic and artificial intelligence to control the system. By integrating the two control systems with the mathematical computer simulation, the effectiveness of the two schemes can be compared. The results are then used as proof of concept in considering new control schemes for the entire ECLSS. Section 4.0 covers the results and trends observed when the model was subjected to different test situations. These results provide insight into the operating procedures of the model and the different control schemes. The appendix, section 5.0, contains summaries of lectures presented during the past year, homework assignments, and the completed source code used for the computer simulation and control system.

USA Space Debris Environment, Operations, and Research Updates

Science.gov (United States)

Liou, J.-C.

2018-01-01

Space Missions in 2017 Earth Satellite Population Collision Avoidance Maneuvers Post mission Disposal of U.S.A. Spacecraft Space Situational Awareness (SSA) and the Space Debris Sensor (SDS) A total of 86 space launches placed more than 400 spacecraft into Earth orbits during 2017, following the trend of increase over the past decade NASA has established conjunction assessment processes for its human spaceflight and uncrewed spacecraft to avoid accidental collisions with objects tracked by the U.S. Space Surveillance Network - NASA also assists other U.S. government spacecraft owners with conjunction assessments and subsequent maneuvers The ISS has conducted 25 debris collision avoidance maneuvers since 1999 - None in 2016-2017, but an ISS visiting vehicle had one collision avoidance maneuver in 2017 During 2017 NASA executed or assisted in the execution of 21 collision avoidance maneuvers by uncrewed spacecraft - Four maneuvers were conducted to avoid debris from Fengyun-1C - Two maneuvers were conducted to avoid debris from the collision of Cosmos 2251 and Iridium 33 - One maneuver was conducted to avoid the ISS NASA has established conjunction assessment processes for its human spaceflight and uncrewed spacecraft to avoid accidental collisions with objects tracked by the U.S. Space Surveillance Network - NASA also assists other U.S. government spacecraft owners with conjunction assessments and subsequent maneuvers The ISS has conducted 25 debris collision avoidance maneuvers since 1999 - None in 2016-2017, but an ISS visiting vehicle had one collision avoidance maneuver in 2017 During 2017 NASA executed or assisted in the execution of 21 collision avoidance maneuvers by uncrewed spacecraft - Four maneuvers were conducted to avoid debris from Fengyun-1C - Two maneuvers were conducted to avoid debris from the collision of Cosmos 2251 and Iridium 33 The 2014-15 NASA Engineering and Safety Center (NESC) study on the micrometeoroid and orbital debris (MMOD

CONTROLLING VIRTUAL CLOUDS AND MAKING IT RAIN PARTICLE SYSTEMS IN REAL SPACES USING SITUATED AUGMENTED SIMULATION AND PORTABLE VIRTUAL ENVIRONMENTS

Directory of Open Access Journals (Sweden)

N. Hedley

2012-07-01

Full Text Available The research described in this paper reports on the design, rationale, development and implementation of a set of new geospatial interfaces that combine multi-touch interaction, portable virtual environments, 'geosimulation gaming', and mobile augmented reality. The result is a set of new ways for us to combine the capabilities of geospatial virtual environments, augmented realitiy and geosimulation. These new hybrid interfaces deliver new geospatial information experiences – new ways of connecting spatial data, simulations, and abstract concepts to real spaces. Their potential to enhance environmental perception and learning must be explored.

Space Weather Studies at Istanbul Technical University

Science.gov (United States)

Kaymaz, Zerefsan

2016-07-01

This presentation will introduce the Upper Atmosphere and Space Weather Laboratory of Istanbul Technical University (ITU). It has been established to support the educational needs of the Faculty of Aeronautics and Astronautics in 2011 to conduct scientific research in Space Weather, Space Environment, Space Environment-Spacecraft Interactions, Space instrumentation and Upper Atmospheric studies. Currently the laboratory has some essential infrastructure and the most instrumentation for ionospheric observations and ground induced currents from the magnetosphere. The laboratory has two subunits: SWIFT dealing with Space Weather Instrumentation and Forecasting unit and SWDPA dealing with Space Weather Data Processing and Analysis. The research area covers wide range of upper atmospheric and space science studies from ionosphere, ionosphere-magnetosphere coupling, magnetic storms and magnetospheric substorms, distant magnetotail, magnetopause and bow shock studies, as well as solar and solar wind disturbances and their interaction with the Earth's space environment. We also study the spacecraft environment interaction and novel plasma instrument design. Several scientific projects have been carried out in the laboratory. Operational objectives of our laboratory will be carried out with the collaboration of NASA's Space Weather Laboratory and the facilities are in the process of integration to their prediction services. Educational and research objectives, as well as the examples from the research carried out in our laboratory will be demonstrated in this presentation.

Space Power Facility (SPF)

Data.gov (United States)

Federal Laboratory Consortium — The Space Power Facility (SPF) houses the world's largest space environment simulation chamber, measuring 100 ft. in diameter by 122 ft. high. In this chamber, large...

Screening and identification of tillering dwarf mutant of rice induced by space environment

International Nuclear Information System (INIS)

Xu Jianlong; Li Chunshou; Wang Junmin; Luo Rongting; Zhang Mingxian

2003-01-01

Major agronomic traits and dwarfism of the tiller dwarf mutant, R955, induced by space environment from rice variety Bing 95-503 were identified. The results indicated that the traits including days from sowing to heading, 1000-grain weight, grain volume, plant type and awn-growing character were obviously different from those of the 5 tiller dwarfs such as ID-3, which were known for their dwarfing genes. R955 was insensitive to response of GA3, and its dwarfing gene was controlled by recessive gene(s), nonallelic to the tiller dwarfing genes d 3 , d 10 , d 14 , d 17 and d 27 . R955 had good plant type with the plant height near semidwarfism, normal grain size, and as many as 68 productive panicles per plant

Evaluating Space Weather Architecture Options to Support Human Deep Space Exploration of the Moon and Mars

Science.gov (United States)

Parker, L.; Minow, J.; Pulkkinen, A.; Fry, D.; Semones, E.; Allen, J.; St Cyr, C.; Mertens, C.; Jun, I.; Onsager, T.; Hock, R.

2018-02-01

NASA's Engineering and Space Center (NESC) is conducting an independent technical assessment of space environment monitoring and forecasting architecture options to support human and robotic deep space exploration.

Sacred space and the healing journey.

Science.gov (United States)

Alt, Paul L

2017-07-01

Sacred space and spirituality have long been used to heal the mind, body, and spirit. This article illuminates the origins of sacred space and its role as a healing environment from the first human construct, the burial mound, to the 5th Century BCE Greek healing city of Epidaurus. It then examines the role of spirituality as one of the necessary human institutions for a healthy society, according to the Italian philosopher Giambattista Vico. The conclusion then surveys three contemporary healing environments' architecture, the Department of Veteran Affairs Healing Environment Design Guideline (VAHEDG), and how these sacred spaces mend individual and community ailments.

The Alpha-Helix Concept: Innovative utilization of the Space Station Program. A report to the National Aeronautical and Space Administration requesting establishment of a Sensory Physiology Laboratory on the Space Station

Science.gov (United States)

Bandurski, R. S.; Singh, N.

1983-01-01

A major laboratory dedicated to biological-medical research is proposed for the Space Platform. The laboratory would focus on sensor physiology and biochemistry since sensory physiology represents the first impact of the new space environment on living organisms. Microgravity and the high radiation environment of space would be used to help solve the problems of prolonged sojourns in space but, more importantly, to help solve terrestrial problems of human health and agricultural productivity. The emphasis would be on experimental use of microorganisms and small plants and small animals to minimize the space and time required to use the Space Platform for maximum human betterment. The Alpha Helix Concept, that is, the use of the Space Platform to bring experimental biomedicine to a new and extreme frontier is introduced so as to better understand the worldly environment. Staffing and instrumenting the Space Platform biomedical laboratory in a manner patterned after successful terrestrial sensory physiology laboratories is also proposed.

Space Sciences Focus Area

Energy Technology Data Exchange (ETDEWEB)

Reeves, Geoffrey D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2017-08-10

To advance our understanding of the space environment (from the Sun to the Earth and beyond) and to advance our ability to operate systems in space that protect life and society. Space Science is distinct from other field, such as astrophysics or cosmology, in that Space Science utilizes in-situ measurements from high altitude rockets, balloons and spacecraft or ground-based measurements of objects and conditions in space.

ISS External Payload Platform - a new opportunity for research in the space environment

Science.gov (United States)

Steimle, Christian; Pape, Uwe

The International Space Station (ISS) is a widely accepted platform for research activities in low Earth orbit. To a wide extent these activities are conducted in the pressurised laboratories of the station and less in the outside environment. Suitable locations outside the ISS are rare, existing facilities fully booked for the coming years. To overcome this limitation, an external payload platform accessible for small size payloads on a commercial basis will be launched to the ISS and installed on the Japanese Experiment Module External Facility (JEM-EF) in the third quarter of 2014 and will be ready to be used by the scientific community on a fully commercial basis. The new External Payload Platform (EPP) and its opportunities and constraints assessed regarding future research activities on-board the ISS. The small size platform is realised in a cooperation between the companies NanoRacks, Astrium North America in the United States, and Airbus Defence and Space in Germany. The hardware allows the fully robotic installation and operation of payloads. In the nominal mission scenario payload items are installed not later than one year after the signature of the contract, stay in operation for 15 weeks, and can be returned to the scientist thereafter. Payload items are transported among the pressurised cargo usually delivered to the station with various supply vehicles. Due to the high frequency of flights and the flexibility of the vehicle manifests the risk of a delay in the payload readiness can be mitigated by delaying to the next flight opportunity which on average is available not more than two months later. The mission is extra-ordinarily fast and of low cost in comparison to traditional research conducted on-board the ISS and can fit into short-term funding cycles available on national and multi-national levels. The size of the payload items is limited by handling constraints on-board the ISS. Therefore, the standard experiment payload size is a multiple of a

Creating a Space for Creativity

DEFF Research Database (Denmark)

Bøjer, Bodil

2017-01-01

Space shapes us but is also shaped by the way we interact with and act within the space. In recent years many schools are being built or rebuilt based on student-centred learning with smaller classrooms and large innovative learning environments (ILEs), expected to foster collaboration and creati......Space shapes us but is also shaped by the way we interact with and act within the space. In recent years many schools are being built or rebuilt based on student-centred learning with smaller classrooms and large innovative learning environments (ILEs), expected to foster collaboration...... teacher), space (the designer) and organisation (management). With my research, I would like to contribute to the understanding of the relationship between the physical learning environment and creative learning processes and the potential of the space as a tool to stimulate creativity. In my poster...... presentation at ‘Educational Architecture’ I will present a case study from my PhD-project where I developed a new ILE at a Danish municipal school in collaboration with the design agency Rune Fjord Studio. A starting point for the project was to examine if and how involving teachers and management...

Space Environmental Effects on Colored Coatings and Anodizes

Science.gov (United States)

Kamenetzky, Rachel R.; Finckenor, Miria M.; Vaughn, Jason A.

1999-01-01

Colored coatings and anodizes are used on spacecraft as markers and astronaut visual aids. These materials must be stable in the space environment and withstand atomic oxygen, ultraviolet radiation, particulate radiation, thermal cycling, and high vacuum without significant change in optical and mechanical properties. A variety of colored coatings and anodizes have been exposed to simulated space environments at Marshall Space Flight Center and also actual space environment as part of the Passive Optical Sample Assembly (POSA) - I flight experiment. Colored coatings were developed by AZ Technology, Huntsville, AL, under a NASA contract for International Space Station (ISS). These include yellow, red, blue, and black paints suitable for Extra-Vehicular Activity (EVA) visual aids and ISS emblems. AaChron, Inc., Minneapolis, MN, developed stable colored anodizes, also in yellow, red, blue, and black, for astronaut visual aids. These coatings were exposed in the laboratory to approximately 550 equivalent sun-hours of solar ultraviolet radiation and approximately 1 x 10(exp 21) atoms/sq cm of atomic oxygen in vacuum. The AZ Technology yellow colored coating, designated TMS800IY, and all four AaChron colored anodizes were flown on POSA-I. POSA-I was a Risk Mitigation Experiment for ISS. It was attached to the exterior of the Mir space station docking module by EVA and was exposed for 18 months. The laboratory-simulated space environment, the natural space environment and the unique environment of an orbiting, active space station and their effects on these developmental materials are discussed.

Radiation dosimetry onboard the International Space Station ISS

Energy Technology Data Exchange (ETDEWEB)

Berger, Thomas [German Aerospace Center - DLR, Inst. of Aerospace Medicine, Radiation Biology, Cologne (Germany)

2008-07-01

Besides the effects of the microgravity environment, and the psychological and psychosocial problems encountered in confined spaces, radiation is the main health detriment for long duration human space missions. The radiation environment encountered in space differs in nature front that on earth, consisting mostly of high energetic ions from protons up to iron, resulting in radiation levels far exceeding the ones encountered on earth for occupational radiation workers. Therefore the determination and the control of the radiation load on astronauts is a moral obligation of the space faring nations. The requirements for radiation detectors in space are very different to that on earth. Limitations in mass, power consumption and the complex nature of the space radiation environment define and limit the overall construction of radiation detectors. Radiation dosimetry onboard the International Space Station (ISS) is accomplished to one part as 'operational' dosimetry aiming for area monitoring of the radiation environment as well as astronaut surveillance. Another part focuses on 'scientific' dosimetry aiming for a better understanding of the radiation environment and its constitutes. Various research activities for a more detailed quantification of the radiation environment as well as its distribution in and outside the space station have been accomplished in the last years onboard the ISS. The paper will focus on the current radiation detectors onboard the ISS, their results, as well as on future planned activities. (orig.)

Design spaces

DEFF Research Database (Denmark)

2005-01-01

Digital technologies and media are becoming increasingly embodied and entangled in the spaces and places at work and at home. However, our material environment is more than a geometric abstractions of space: it contains familiar places, social arenas for human action. For designers, the integration...... of digital technology with space poses new challenges that call for new approaches. Creative alternatives to traditional systems methodologies are called for when designers use digital media to create new possibilities for action in space. Design Spaces explores how design and media art can provide creative...... alternatives for integrating digital technology with space. Connecting practical design work with conceptual development and theorizing, art with technology, and usesr-centered methods with social sciences, Design Spaces provides a useful research paradigm for designing ubiquitous computing. This book...

The environment, not space, dominantly structures the landscape patterns of the richness and composition of the tropical understory vegetation.

Directory of Open Access Journals (Sweden)

Yue-Hua Hu

Full Text Available The mechanisms driving the spatial patterns of species richness and composition are essential to the understanding of biodiversity. Numerous studies separately identify the contributions of the environment (niche process and space (neutral process to the species richness or composition at different scales, but few studies have investigated the contributions of both types of processes in the two types of data at the landscape scale. In this study, we partitioned the spatial variations in all, exotic and native understory plant species richness and composition constrained by environmental variables and space in 134 plots that were spread across 10 counties in Hainan Island in southern China. The 134 plots included 70 rubber (Hevea brasiliensis plantation plots, 50 eucalyptus (Eucalyptus urophylla plantation plots, and 14 secondary forest plots. RDA based variation partitioning was run to assess the contribution of environment and space to species richness and composition. The results showed that the environmental variables alone explained a large proportion of the variations in both the species richness and composition of all, native, and exotic species. The RDA results indicated that overstory composition (forest type here plays a leading role in determining species richness and composition patterns. The alpha and beta diversities of the secondary forest plots were markedly higher than that of the two plantations. In conclusion, niche differentiation processes are the principal mechanisms that shape the alpha and beta diversities of understory plant species in Hainan Island.

Space in Space: Designing for Privacy in the Workplace

Science.gov (United States)

Akin, Jonie

2015-01-01

Privacy is cultural, socially embedded in the spatial, temporal, and material aspects of the lived experience. Definitions of privacy are as varied among scholars as they are among those who fight for their personal rights in the home and the workplace. Privacy in the workplace has become a topic of interest in recent years, as evident in discussions on Big Data as well as the shrinking office spaces in which people work. An article in The New York Times published in February of this year noted that "many companies are looking to cut costs, and one way to do that is by trimming personal space". Increasingly, organizations ranging from tech start-ups to large corporations are downsizing square footage and opting for open-office floorplans hoping to trim the budget and spark creative, productive communication among their employees. The question of how much is too much to trim when it comes to privacy, is one that is being actively addressed by the National Aeronautics and Space Administration (NASA) as they explore habitat designs for future space missions. NASA recognizes privacy as a design-related stressor impacting human health and performance. Given the challenges of sustaining life in an isolated, confined, and extreme environment such as Mars, NASA deems it necessary to determine the acceptable minimal amount for habitable volume for activities requiring at least some level of privacy in order to support optimal crew performance. Ethnographic research was conducted in 2013 to explore perceptions of privacy and privacy needs among astronauts living and working in space as part of a long-distance, long-duration mission. The allocation of space, or habitable volume, becomes an increasingly complex issue in outer space due to the costs associated with maintaining an artificial, confined environment bounded by limitations of mass while located in an extreme environment. Privacy in space, or space in space, provides a unique case study of the complex notions of

Ionospheric Response to Extremes in the Space Environment: Establishing Benchmarks for the Space Weather Action Plan.

Science.gov (United States)

Viereck, R. A.; Azeem, S. I.

2017-12-01

One of the goals of the National Space Weather Action Plan is to establish extreme event benchmarks. These benchmarks are estimates of environmental parameters that impact technologies and systems during extreme space weather events. Quantitative assessment of anticipated conditions during these extreme space weather event will enable operators and users of affected technologies to develop plans for mitigating space weather risks and improve preparedness. The ionosphere is one of the most important regions of space because so many applications either depend on ionospheric space weather for their operation (HF communication, over-the-horizon radars), or can be deleteriously affected by ionospheric conditions (e.g. GNSS navigation and timing, UHF satellite communications, synthetic aperture radar, HF communications). Since the processes that influence the ionosphere vary over time scales from seconds to years, it continues to be a challenge to adequately predict its behavior in many circumstances. Estimates with large uncertainties, in excess of 100%, may result in operators of impacted technologies over or under preparing for such events. The goal of the next phase of the benchmarking activity is to reduce these uncertainties. In this presentation, we will focus on the sources of uncertainty in the ionospheric response to extreme geomagnetic storms. We will then discuss various research efforts required to better understand the underlying processes of ionospheric variability and how the uncertainties in ionospheric response to extreme space weather could be reduced and the estimates improved.

Space station operations management

Science.gov (United States)

Cannon, Kathleen V.

1989-01-01

Space Station Freedom operations management concepts must be responsive to the unique challenges presented by the permanently manned international laboratory. Space Station Freedom will be assembled over a three year period where the operational environment will change as significant capability plateaus are reached. First Element Launch, Man-Tended Capability, and Permanent Manned Capability, represent milestones in operational capability that is increasing toward mature operations capability. Operations management concepts are being developed to accomodate the varying operational capabilities during assembly, as well as the mature operational environment. This paper describes operations management concepts designed to accomodate the uniqueness of Space Station Freedoom, utilizing tools and processes that seek to control operations costs.

EVALUATION OF MICROBIAL SURVIVAL IN EXTRATERRESTRIAL ENVIRONMENTS

Directory of Open Access Journals (Sweden)

Betül BULUÇ

2012-08-01

Full Text Available In this paper, the space environments where microbial terrestrial life could form and evolve in, were evaluted with the base of the physical and chemical properties. In addition, Earthial microbial life formation conditions in the interstellar medium and the other planets are investigated and the survival of microorganisms in the space environments are questioned. As a result, considering the aspects of terrestrial microbial life, we suggest that the space environment and other planets could not be a habitat for Earthial microorganisms.

Biotechnology opportunities on Space Station

Science.gov (United States)

Deming, Jess; Henderson, Keith; Phillips, Robert W.; Dickey, Bernistine; Grounds, Phyllis

1987-01-01

Biotechnology applications which could be implemented on the Space Station are examined. The advances possible in biotechnology due to the favorable microgravity environment are discussed. The objectives of the Space Station Life Sciences Program are: (1) the study of human diseases, (2) biopolymer processing, and (3) the development of cryoprocessing and cryopreservation methods. The use of the microgravity environment for crystal growth, cell culturing, and the separation of biological materials is considered. The proposed Space Station research could provide benefits to the fields of medicine, pharmaceuticals, genetics, agriculture, and industrial waste management.

Contamination Effects Due to Space Environmental Interactions

Science.gov (United States)

Chen, Philip T.; Paquin, Krista C. (Technical Monitor)

2001-01-01

Molecular and particulate contaminants are commonly generated from the orbital spacecraft operations that are under the influence of the space environment. Once generated, these contaminants may attach to the surfaces of the spacecraft or may remain in the vicinity of the spacecraft. In the event these contaminants come to rest on the surfaces of the spacecraft or situated in the line-of-sight of the observation path, they will create various degrees of contamination effect which may cause undesirable effects for normal spacecraft operations, There will be circumstances in which the spacecraft may be subjected to special space environment due to operational conditions. Interactions between contaminants and special space environment may alter or greatly increase the contamination effect due to the synergistic effect. This paper will address the various types of contamination generation on orbit, the general effects of the contamination on spacecraft systems, and the typical impacts on the spacecraft operations due to the contamination effect. In addition, this paper will explain the contamination effect induced by the space environment and will discuss the intensified contamination effect resulting from the synergistic effect with the special space environment.

Regionaalsed erinevused Eesti sotsiaalmajanduslikus arengus / Anneli Kaasa

Index Scriptorium Estoniae

Kaasa, Anneli, 1975-

2003-01-01

Regionaalsetest erinevustest Eestis üldise heaolu osas; sissetulekute erinevuste võrdlus; analüüs, kuidas mõjutavad nii sissetuleku kui ka üldise heaolu tase piirkonna populaarsust elukohana. Tabelid. Graafikud

Food environment, walkability, and public open spaces are associated with incident development of cardio-metabolic risk factors in a biomedical cohort.

Science.gov (United States)

Paquet, Catherine; Coffee, Neil T; Haren, Matthew T; Howard, Natasha J; Adams, Robert J; Taylor, Anne W; Daniel, Mark

2014-07-01

We investigated whether residential environment characteristics related to food (unhealthful/healthful food sources ratio), walkability and public open spaces (POS; number, median size, greenness and type) were associated with incidence of four cardio-metabolic risk factors (pre-diabetes/diabetes, hypertension, dyslipidaemia, abdominal obesity) in a biomedical cohort (n=3205). Results revealed that the risk of developing pre-diabetes/diabetes was lower for participants in areas with larger POS and greater walkability. Incident abdominal obesity was positively associated with the unhealthful food environment index. No associations were found with hypertension or dyslipidaemia. Results provide new evidence for specific, prospective associations between the built environment and cardio-metabolic risk factors. Copyright © 2014 Elsevier Ltd. All rights reserved.

Micropropulsion Systems for Precision Controlled Space Flight

DEFF Research Database (Denmark)

Larsen, Jack

. This project is thus concentrating on developing a method by which an entire, ecient, control system compensating for the disturbances from the space environment and thereby enabling precision formation flight can be realized. The space environment is initially studied and the knowledge gained is used......Space science is subject to a constantly increasing demand for larger coherence lengths or apertures of the space observation systems, which in turn translates into a demand for increased dimensions and subsequently cost and complexity of the systems. When this increasing demand reaches...... the pratical limitations of increasing the physical dimensions of the spacecrafts, the observation platforms will have to be distributed on more spacecrafts flying in very accurate formations. Consequently, the observation platform becomes much more sensitive to disturbances from the space environment...

What makes a space invader? Passenger perceptions of personal space invasion in aircraft travel.

Science.gov (United States)

Lewis, Laura; Patel, Harshada; D'Cruz, Mirabelle; Cobb, Sue

2017-11-01

The invasion of personal space is often a contributory factor to the experience of discomfort in aircraft passengers. This paper presents a questionnaire study which investigated how air travellers are affected by invasions of personal space and how they attempt to adapt to, or counter, these invasions. In support of recent findings on the factors influencing air passenger comfort, the results of this study indicate that the invasion of personal space is not only caused by physical factors (e.g. physical contact with humans or objects), but also other sensory factors such as noise, smells or unwanted eye contact. The findings of this study have implications for the design of shared spaces. Practitioner Summary: This paper presents a questionnaire study which investigated personal space in an aircraft environment. The results highlight the factors which affect the perception of personal space invasion in aircraft and can therefore inform the design of aircraft cabin environments to enhance the passenger experience.

Reproduction in the space environment: Part II. Concerns for human reproduction

Science.gov (United States)

Jennings, R. T.; Santy, P. A.

1990-01-01

Long-duration space flight and eventual colonization of our solar system will require successful control of reproductive function and a thorough understanding of factors unique to space flight and their impact on gynecologic and obstetric parameters. Part II of this paper examines the specific environmental factors associated with space flight and the implications for human reproduction. Space environmental hazards discussed include radiation, alteration in atmospheric pressure and breathing gas partial pressures, prolonged toxicological exposure, and microgravity. The effects of countermeasures necessary to reduce cardiovascular deconditioning, calcium loss, muscle wasting, and neurovestibular problems are also considered. In addition, the impact of microgravity on male fertility and gamete quality is explored. Due to current constraints, human pregnancy is now contraindicated for space flight. However, a program to explore effective countermeasures to current constraints and develop the required health care delivery capability for extended-duration space flight is suggested. A program of Earth- and space-based research to provide further answers to reproductive questions is suggested.

Haridusvabadus / ajakirjast "The Freeman" tlk. Riinu Pall

Index Scriptorium Estoniae

2000-01-01

Praegune haridussüsteem on vastuolus individuaalse vabaduse ja vastutuse põhimõtetega vabas ühiskonnas, hariduse kvaliteedi tõstmise asemel on süsteemis madal tase ja ebatõhus vahendite kasutamine

Characterization of System on a Chip (SoC) Single Event Upset (SEU) Responses Using SEU Data, Classical Reliability Models, and Space Environment Data

Science.gov (United States)

Berg, Melanie; Label, Kenneth; Campola, Michael; Xapsos, Michael

2017-01-01

We propose a method for the application of single event upset (SEU) data towards the analysis of complex systems using transformed reliability models (from the time domain to the particle fluence domain) and space environment data.

The fluidities of digital learning environments and resources

DEFF Research Database (Denmark)

Hansbøl, Mikala

2012-01-01

The research project “Educational cultures and serious games on a global market place” (2009-2011) dealt with the challenge of the digital learning environment and hence it’s educational development space always existing outside the present space and hence scope of activities. With a reference...... and establishments of the virtual universe called Mingoville.com, the research shows a need to include in researchers’ conceptualizations of digital learning environments and resources, their shifting materialities and platformations and hence emerging (often unpredictable) agencies and educational development...... spaces. Keywords: Fluidity, digital learning environment, digital learning resource, educational development space...

Creating a Space for Creativity

DEFF Research Database (Denmark)

Bøjer, Bodil

2017-01-01

and creativity. But the relational dependence between the physical space, pedagogics and organisation is widely overlooked when designing these new learning environments as a new spatial design in itself is expected to change the way we teach and learn. Simply changing the space is not enough (Imms & Byers, 2017......) and the intentions of the space can only be fully realised if the inhabitants of the schools completely understand and support the pedagogical principles informing the provision of these spaces (Burke, 2016). This is why three things should be aligned in order for an ILE to work intendedly: creative teaching (the...... teacher), space (the designer) and organisation (management). With my research, I would like to contribute to the understanding of the relationship between the physical learning environment and creative learning processes and the potential of the space as a tool to stimulate creativity. In my poster...

Large size space construction for space exploitation

Science.gov (United States)

Kondyurin, Alexey

2016-07-01

Space exploitation is impossible without large space structures. We need to make sufficient large volume of pressurized protecting frames for crew, passengers, space processing equipment, & etc. We have to be unlimited in space. Now the size and mass of space constructions are limited by possibility of a launch vehicle. It limits our future in exploitation of space by humans and in development of space industry. Large-size space construction can be made with using of the curing technology of the fibers-filled composites and a reactionable matrix applied directly in free space. For curing the fabric impregnated with a liquid matrix (prepreg) is prepared in terrestrial conditions and shipped in a container to orbit. In due time the prepreg is unfolded by inflating. After polymerization reaction, the durable construction can be fitted out with air, apparatus and life support systems. Our experimental studies of the curing processes in the simulated free space environment showed that the curing of composite in free space is possible. The large-size space construction can be developed. A project of space station, Moon base, Mars base, mining station, interplanet space ship, telecommunication station, space observatory, space factory, antenna dish, radiation shield, solar sail is proposed and overviewed. The study was supported by Humboldt Foundation, ESA (contract 17083/03/NL/SFe), NASA program of the stratospheric balloons and RFBR grants (05-08-18277, 12-08-00970 and 14-08-96011).

Extreme environment electronics

CERN Document Server

Cressler, John D

2012-01-01

Unfriendly to conventional electronic devices, circuits, and systems, extreme environments represent a serious challenge to designers and mission architects. The first truly comprehensive guide to this specialized field, Extreme Environment Electronics explains the essential aspects of designing and using devices, circuits, and electronic systems intended to operate in extreme environments, including across wide temperature ranges and in radiation-intense scenarios such as space. The Definitive Guide to Extreme Environment Electronics Featuring contributions by some of the world's foremost exp

Space operations and the human factor

Science.gov (United States)

Brody, Adam R.

1993-10-01

Although space flight does not put the public at high risk, billions of dollars in hardware are destroyed and the space program halted when an accident occurs. Researchers are therefore applying human-factors techniques similar to those used in the aircraft industry, albeit at a greatly reduced level, to the spacecraft environment. The intent is to reduce the likelihood of catastrophic failure. To increase safety and efficiency, space human factors researchers have simulated spacecraft docking and extravehicular activity rescue. Engineers have also studied EVA suit mobility and aids. Other basic human-factors issues that have been applied to the space environment include antropometry, biomechanics, and ergonomics. Workstation design, workload, and task analysis currently receive much attention, as do habitability and other aspects of confined environments. Much work also focuses on individual payloads, as each presents its own complexities.

Thermal Space in Architecture

DEFF Research Database (Denmark)

Petersen, Mads Dines

Present research is revolving around the design process and the use of digital applications to support the design process among architects. This work is made in relation to the current discussions about sustainable architecture and the increased focus on energy consumption and the comfort in our...... and understanding of spaces in buildings can change significantly and instead of the creation of frozen geometrical spaces, thermal spaces can be created as it is suggested in meteorological architecture where functions are distributed in relation to temperature gradients. This creates an interesting contrast......-introducing an increased adaptability in the architecture can be a part of re-defining the environmental agenda and re-establish a link between the environment of the site and the environment of the architecture and through that an increased appreciation of the sensuous space here framed in discussions about thermal...

Monitoring the Microgravity Environment Quality On-board the International Space Station Using Soft Computing Techniques. Part 2; Preliminary System Performance Results

Science.gov (United States)

Jules, Kenol; Lin, Paul P.; Weiss, Daniel S.

2002-01-01

This paper presents the preliminary performance results of the artificial intelligence monitoring system in full operational mode using near real time acceleration data downlinked from the International Space Station. Preliminary microgravity environment characterization analysis result for the International Space Station (Increment-2), using the monitoring system is presented. Also, comparison between the system predicted performance based on ground test data for the US laboratory "Destiny" module and actual on-orbit performance, using measured acceleration data from the U.S. laboratory module of the International Space Station is presented. Finally, preliminary on-orbit disturbance magnitude levels are presented for the Experiment of Physics of Colloids in Space, which are compared with on ground test data. The ground test data for the Experiment of Physics of Colloids in Space were acquired from the Microgravity Emission Laboratory, located at the NASA Glenn Research Center, Cleveland, Ohio. The artificial intelligence was developed by the NASA Glenn Principal Investigator Microgravity Services Project to help the principal investigator teams identify the primary vibratory disturbance sources that are active, at any moment of time, on-board the International Space Station, which might impact the microgravity environment their experiments are exposed to. From the Principal Investigator Microgravity Services' web site, the principal investigator teams can monitor via a dynamic graphical display, implemented in Java, in near real time, which event(s) is/are on, such as crew activities, pumps, fans, centrifuges, compressor, crew exercise, structural modes, etc., and decide whether or not to run their experiments, whenever that is an option, based on the acceleration magnitude and frequency sensitivity associated with that experiment. This monitoring system detects primarily the vibratory disturbance sources. The system has built-in capability to detect both known

Measurements of indoor thermal environment and energy analysis in a large space building in typical seasons

Energy Technology Data Exchange (ETDEWEB)

Huang, Chen; Zou, Zhijun; Li, Meiling; Wang, Xin; Huang, Wugang; Yang, Jiangang [University of Shanghai for Science and Technology, Shanghai (China); Li, Wei; Xiao, Xueqin [Shanghai International Gymnastics Stadium, Shanghai (China)

2007-05-15

Shanghai International Gymnastics Stadium is the selected object for site-measurement. The site-measurements have been carried out during summer, winter, and the transitional seasons. Their indoor thermal environments were controlled by continuous air-conditioning, intermittent air-conditioning and natural ventilation, respectively. The site-measurement includes outdoor environment (the weather conditions and peripheral hallway), indoor air temperature distribution (the occupant zone temperature, radial temperature near upper openings and the vertical temperature distributions, etc.), and the heat balance of air-conditioning system, etc. It is found that temperature stratification in winter with air-conditioning is most obvious. The maximum difference of vertical temperature is 15{sup o}C in winter. The second largest one is 12{sup o}C in summer, and less than 2{sup o}C in the transitional season. The results of measurements indicate that it is different in the characteristics on energy saving of upper openings during the different seasons. With heat balance measurements, it is discovered that the roof load and ventilated and infiltrated load account for larger percentages in terms of cooling and heating load. In this paper, many discussions on the results of site measurements show some characteristics and regulations of indoor thermal environment in large space building. (author)

Collective space of high-rise housing complex

Directory of Open Access Journals (Sweden)

Bakaeva Tatyana

2018-01-01

Full Text Available The article considers the problems of support of citizens a comfortable living environment in the conditions of the limited territory of the megalopolis, the typological principles of formation of space-planning structure high-rise residence complexes with public space. The collective space for residents of high-rise housing estates on the example of international experience of design and construction is in detail considered. The collective space and the area of the standard apartment are analysed on comfort classes: a social - complex Pinnacle @ Duxton, a business - Monde Condos and an elite - Hamilton Scotts. Interdependence the area of the standard flat and the total area of housing collective space, in addiction on the comfort level, is revealed. In the conditions of high-density urban development, the collective space allows to form the comfortable environment for accommodation. The recommendations for achievement of integrity and improvement of quality of the city environment are made. The convenient collective space makes a contribution to civil policy, it creates the socializing sense of interaction of residents, coagulates social effect.

Collective space of high-rise housing complex

Science.gov (United States)

Bakaeva, Tatyana

2018-03-01

The article considers the problems of support of citizens a comfortable living environment in the conditions of the limited territory of the megalopolis, the typological principles of formation of space-planning structure high-rise residence complexes with public space. The collective space for residents of high-rise housing estates on the example of international experience of design and construction is in detail considered. The collective space and the area of the standard apartment are analysed on comfort classes: a social - complex Pinnacle @ Duxton, a business - Monde Condos and an elite - Hamilton Scotts. Interdependence the area of the standard flat and the total area of housing collective space, in addiction on the comfort level, is revealed. In the conditions of high-density urban development, the collective space allows to form the comfortable environment for accommodation. The recommendations for achievement of integrity and improvement of quality of the city environment are made. The convenient collective space makes a contribution to civil policy, it creates the socializing sense of interaction of residents, coagulates social effect.

Jaapanlastele teeb muret stress / Harli Uljas

Index Scriptorium Estoniae

Uljas, Harli

2002-01-01

Jaapani tervishoiuministeeriumi andmetel oli möödunud aastal 143 karoshi juhtumit - kõrgeim tase alates 1987. aastast, mil probleemi esimest korda teadvustati. Karoshi - äkksurm ületöötamise tõttu

Kutsega raamatukoguhoidjate read täienevad : kokkuvõte kutse taotlemisest 2016. a / Krista Talvi

Index Scriptorium Estoniae

Talvi, Krista, 1948-

2016-01-01

Raamatukoguhoidja kutsestandardi tase 8 omistati Tiiu Reimole, kes on töötanud raamatukogus ja olnud õppejõud ning töötab praegu Tallinna Ülikooli Akadeemilises Raamatukogus Eesti retrospektiivse rahvusbibliograafia keskuses

Space debris: modeling and detectability

Science.gov (United States)

Wiedemann, C.; Lorenz, J.; Radtke, J.; Kebschull, C.; Horstmann, A.; Stoll, E.

2017-01-01

High precision orbit determination is required for the detection and removal of space debris. Knowledge of the distribution of debris objects in orbit is necessary for orbit determination by active or passive sensors. The results can be used to investigate the orbits on which objects of a certain size at a certain frequency can be found. The knowledge of the orbital distribution of the objects as well as their properties in accordance with sensor performance models provide the basis for estimating the expected detection rates. Comprehensive modeling of the space debris environment is required for this. This paper provides an overview of the current state of knowledge about the space debris environment. In particular non-cataloged small objects are evaluated. Furthermore, improvements concerning the update of the current space debris model are addressed. The model of the space debris environment is based on the simulation of historical events, such as fragmentations due to explosions and collisions that actually occurred in Earth orbits. The orbital distribution of debris is simulated by propagating the orbits considering all perturbing forces up to a reference epoch. The modeled object population is compared with measured data and validated. The model provides a statistical distribution of space objects, according to their size and number. This distribution is based on the correct consideration of orbital mechanics. This allows for a realistic description of the space debris environment. Subsequently, a realistic prediction can be provided concerning the question, how many pieces of debris can be expected on certain orbits. To validate the model, a software tool has been developed which allows the simulation of the observation behavior of ground-based or space-based sensors. Thus, it is possible to compare the results of published measurement data with simulated detections. This tool can also be used for the simulation of sensor measurement campaigns. It is

Astronaut exposure to space radiation - Space Shuttle experience

International Nuclear Information System (INIS)

Atwell, W.

1990-01-01

Space Shuttle astronauts are exposed to both the trapped radiation and the galactic cosmic radiation environments. In addition, the sun periodically emits high-energy particles which could pose a serious threat to flight crews. NASA adheres to federal regulations and recommended exposure limits for radiation protection and has established a radiological health and risk assessment program. Using models of the space radiation environment, a Shuttle shielding model, and an anatomical human model, crew exposure estimates are made for each Shuttle flight. The various models are reviewed. Dosimeters are worn by each astronaut and are flown at several fixed locations to obtain inflight measurements. The dosimetry complement is discussed in detail. A comparison between the premission calculations and measurements is presented. Extrapolation of Shuttle experience to long-duration exposure is explored. 14 refs

The simplified spherical harmonics (SP{sub L}) methodology with space and moment decomposition in parallel environments

Energy Technology Data Exchange (ETDEWEB)

Gianluca, Longoni; Alireza, Haghighat [Florida University, Nuclear and Radiological Engineering Department, Gainesville, FL (United States)

2003-07-01

In recent years, the SP{sub L} (simplified spherical harmonics) equations have received renewed interest for the simulation of nuclear systems. We have derived the SP{sub L} equations starting from the even-parity form of the S{sub N} equations. The SP{sub L} equations form a system of (L+1)/2 second order partial differential equations that can be solved with standard iterative techniques such as the Conjugate Gradient (CG). We discretized the SP{sub L} equations with the finite-volume approach in a 3-D Cartesian space. We developed a new 3-D general code, Pensp{sub L} (Parallel Environment Neutral-particle SP{sub L}). Pensp{sub L} solves both fixed source and criticality eigenvalue problems. In order to optimize the memory management, we implemented a Compressed Diagonal Storage (CDS) to store the SP{sub L} matrices. Pensp{sub L} includes parallel algorithms for space and moment domain decomposition. The computational load is distributed on different processors, using a mapping function, which maps the 3-D Cartesian space and moments onto processors. The code is written in Fortran 90 using the Message Passing Interface (MPI) libraries for the parallel implementation of the algorithm. The code has been tested on the Pcpen cluster and the parallel performance has been assessed in terms of speed-up and parallel efficiency. (author)

AF-GEOSpace Version 2.0: Space Environment Software Products for 2002

Science.gov (United States)

Hilmer, R. V.; Ginet, G. P.; Hall, T.; Holeman, E.; Tautz, M.

2002-05-01

AF-GEOSpace Version 2.0 (release 2002 on WindowsNT/2000/XP) is a graphics-intensive software program developed by AFRL with space environment models and applications. It has grown steadily to become a development tool for automated space weather visualization products and helps with a variety of tasks: orbit specification for radiation hazard avoidance; satellite design assessment and post-event analysis; solar disturbance effects forecasting; frequency and antenna management for radar and HF communications; determination of link outage regions for active ionospheric conditions; and physics research and education. The object-oriented C++ code is divided into five module classes. Science Modules control science models to give output data on user-specified grids. Application Modules manipulate these data and provide orbit generation and magnetic field line tracing capabilities. Data Modules read and assist with the analysis of user-generated data sets. Graphics Modules enable the display of features such as plane slices, magnetic field lines, line plots, axes, the Earth, stars, and satellites. Worksheet Modules provide commonly requested coordinate transformations and calendar conversion tools. Common input data archive sets, application modules, and 1-, 2-, and 3-D visualization tools are provided to all models. The code documentation includes detailed examples with click-by-click instructions for investigating phenomena that have well known effects on communications and spacecraft systems. AF-GEOSpace Version 2.0 builds on the success of its predecessors. The first release (Version 1.21, 1996/IRIX on SGI) contained radiation belt particle flux and dose models derived from CRRES satellite data, an aurora model, an ionosphere model, and ionospheric HF ray tracing capabilities. Next (Version 1.4, 1999/IRIX on SGI) science modules were added related to cosmic rays and solar protons, low-Earth orbit radiation dosages, single event effects probability maps, ionospheric

A study of System Interface Sets (SIS) for the host, target and integration environments of the Space Station Program (SSP)

Science.gov (United States)

Mckay, Charles; Auty, David; Rogers, Kathy

1987-01-01

System interface sets (SIS) for large, complex, non-stop, distributed systems are examined. The SIS of the Space Station Program (SSP) was selected as the focus of this study because an appropriate virtual interface specification of the SIS is believed to have the most potential to free the project from four life cycle tyrannies which are rooted in a dependance on either a proprietary or particular instance of: operating systems, data management systems, communications systems, and instruction set architectures. The static perspective of the common Ada programming support environment interface set (CAIS) and the portable common execution environment (PCEE) activities are discussed. Also, the dynamic perspective of the PCEE is addressed.

Radiations in space and global environment

International Nuclear Information System (INIS)

Oguti, Takasi

1994-01-01

It has been well known that the global environment of the earth is basically determined by the radiation equilibrium of the earth atmosphere system embedded in the solar radiation. However, the surface temperature of about 15 degC on average is much higher than that determined by the radiation equilibrium. This is due to the so-called greenhouse gases in the atmosphere such as carbon dioxide, water vapor, methane and others. Also the global environment has evolved by interacting with the living things on the earth, for example, tree oxygen by photosynthesis, and a small amount of ozone protecting living things from the fetal damage due to solar ultraviolet radiation. The solar radiation of short wavelength, that is, ultraviolet to X-ray influences atmospheric constituents, and the thermal structure and dynamics of the atmosphere through chemical reaction. The solar energetic particles produced by solar flares precipitate in the polar regions, and the nitric oxides are produced by auroral X-ray. Auroral activities accelerate particles in the magnetosphere. All these radiations cause significant global changes. Human activities increase greenhouse gases rapidly and cause global warming, and atmospheric chloro-fluoro-carbon (CFC) makes the ozone hole. Now, human activities must be modified to match the natural cycle of materials. (K.I.)

LDPC concatenated space-time block coded system in multipath fading environment: Analysis and evaluation

Directory of Open Access Journals (Sweden)

Surbhi Sharma

2011-06-01

Full Text Available Irregular low-density parity-check (LDPC codes have been found to show exceptionally good performance for single antenna systems over a wide class of channels. In this paper, the performance of LDPC codes with multiple antenna systems is investigated in flat Rayleigh and Rician fading channels for different modulation schemes. The focus of attention is mainly on the concatenation of irregular LDPC codes with complex orthogonal space-time codes. Iterative decoding is carried out with a density evolution method that sets a threshold above which the code performs well. For the proposed concatenated system, the simulation results show that the QAM technique achieves a higher coding gain of 8.8 dB and 3.2 dB over the QPSK technique in Rician (LOS and Rayleigh (NLOS faded environments respectively.

Thermoluminescent measurement in space radiation dosimetry

International Nuclear Information System (INIS)

Chen Mei; Qi Zhangnian; Li Xianggao; Huang Zengxin; Jia Xianghong; Wang Genliang

1999-01-01

The author introduced the space radiation environment and the application of thermoluminescent measurement in space radiation dosimetry. Space ionization radiation is charged particles radiation. Space radiation dosimetry was developed for protecting astronauts against space radiation. Thermoluminescent measurement is an excellent method used in the spaceship cabin. Also the authors mentioned the recent works here

FOREWORD: Tackling inverse problems in a Banach space environment: from theory to applications Tackling inverse problems in a Banach space environment: from theory to applications

Science.gov (United States)

Schuster, Thomas; Hofmann, Bernd; Kaltenbacher, Barbara

2012-10-01

Inverse problems can usually be modelled as operator equations in infinite-dimensional spaces with a forward operator acting between Hilbert or Banach spaces—a formulation which quite often also serves as the basis for defining and analyzing solution methods. The additional amount of structure and geometric interpretability provided by the concept of an inner product has rendered these methods amenable to a convergence analysis, a fact which has led to a rigorous and comprehensive study of regularization methods in Hilbert spaces over the last three decades. However, for numerous problems such as x-ray diffractometry, certain inverse scattering problems and a number of parameter identification problems in PDEs, the reasons for using a Hilbert space setting seem to be based on conventions rather than an appropriate and realistic model choice, so often a Banach space setting would be closer to reality. Furthermore, non-Hilbertian regularization and data fidelity terms incorporating a priori information on solution and noise, such as general Lp-norms, TV-type norms, or the Kullback-Leibler divergence, have recently become very popular. These facts have motivated intensive investigations on regularization methods in Banach spaces, a topic which has emerged as a highly active research field within the area of inverse problems. Meanwhile some of the most well-known regularization approaches, such as Tikhonov-type methods requiring the solution of extremal problems, and iterative ones like the Landweber method, the Gauss-Newton method, as well as the approximate inverse method, have been investigated for linear and nonlinear operator equations in Banach spaces. Convergence with rates has been proven and conditions on the solution smoothness and on the structure of nonlinearity have been formulated. Still, beyond the existing results a large number of challenging open questions have arisen, due to the more involved handling of general Banach spaces and the larger variety

Õigusrikkumised [1997] = Violation of jurisdiction

Index Scriptorium Estoniae

1998-01-01

Politseis registreeritud kuriteod, 1997, kuritegevuse tase 10 000 elaniku kohta 1993-1997, kuriteod liikide lõikes, 1997, väljaselgitatud kuritegudes süüdistatavad isikud Tallinnas, 1997, kuritegevus ja selle avastamine Tallinna asumites

Final Report from The University of Texas at Austin for DEGAS: Dynamic Global Address Space programming environments

Energy Technology Data Exchange (ETDEWEB)

Erez, Mattan

2018-02-21

The Dynamic, Exascale Global Address Space programming environment (DEGAS) project will develop the next generation of programming models and runtime systems to meet the challenges of Exascale computing. Our approach is to provide an efficient and scalable programming model that can be adapted to application needs through the use of dynamic runtime features and domain-specific languages for computational kernels. We address the following technical challenges: Programmability: Rich set of programming constructs based on a Hierarchical Partitioned Global Address Space (HPGAS) model, demonstrated in UPC++. Scalability: Hierarchical locality control, lightweight communication (extended GASNet), and ef- ficient synchronization mechanisms (Phasers). Performance Portability: Just-in-time specialization (SEJITS) for generating hardware-specific code and scheduling libraries for domain-specific adaptive runtimes (Habanero). Energy Efficiency: Communication-optimal code generation to optimize energy efficiency by re- ducing data movement. Resilience: Containment Domains for flexible, domain-specific resilience, using state capture mechanisms and lightweight, asynchronous recovery mechanisms. Interoperability: Runtime and language interoperability with MPI and OpenMP to encourage broad adoption.

Fundamentals of Space Medicine

Science.gov (United States)

Clément, Gilles

2005-03-01

A total of more than 240 human space flights have been completed to date, involving about 450 astronauts from various countries, for a combined total presence in space of more than 70 years. The seventh long-duration expedition crew is currently in residence aboard the International Space Station, continuing a permanent presence in space that began in October 2000. During that time, investigations have been conducted on both humans and animal models to study the bone demineralization and muscle deconditioning, space motion sickness, the causes and possible treatment of postflight orthostatic intolerance, the changes in immune function, crew and crew-ground interactions, and the medical issues of living in a space environment, such as the effects of radiation or the risk of developing kidney stones. Some results of these investigations have led to fundamental discoveries about the adaptation of the human body to the space environment. Gilles Clément has been active in this research. This readable text presents the findings from the life science experiments conducted during and after space missions. Topics discussed in this book include: adaptation of sensory-motor, cardio-vascular, bone, and muscle systems to the microgravity of spaceflight; psychological and sociological issues of living in a confined, isolated, and stressful environment; operational space medicine, such as crew selection, training and in-flight health monitoring, countermeasures and support; results of space biology experiments on individual cells, plants, and animal models; and the impact of long-duration missions such as the human mission to Mars. The author also provides a detailed description of how to fly a space experiment, based on his own experience with research projects conducted onboard Salyut-7, Mir, Spacelab, and the Space Shuttle. Now is the time to look at the future of human spaceflight and what comes next. The future human exploration of Mars captures the imagination of both the

Selection of a Data Acquisition and Controls System Communications and Software Architecture for Johnson Space Center's Space Environment Simulation Laboratory Thermal and Vacuum Test Facilities

Science.gov (United States)

Jordan, Eric A.

2004-01-01

Upgrade of data acquisition and controls systems software at Johnson Space Center's Space Environment Simulation Laboratory (SESL) involved the definition, evaluation and selection of a system communication architecture and software components. A brief discussion of the background of the SESL and its data acquisition and controls systems provides a context for discussion of the requirements for each selection. Further framework is provided as upgrades to these systems accomplished in the 1990s and in 2003 are compared to demonstrate the role that technological advances have had in their improvement. Both of the selections were similar in their three phases; 1) definition of requirements, 2) identification of candidate products and their evaluation and testing and 3) selection by comparison of requirement fulfillment. The candidates for the communication architecture selection embraced several different methodologies which are explained and contrasted. Requirements for this selection are presented and the selection process is described. Several candidates for the software component of the data acquisition and controls system are identified, requirements for evaluation and selection are presented, and the evaluation process is described.

Pluto's interaction with its space environment: Solar wind, energetic particles, and dust.

Science.gov (United States)

Bagenal, F; Horányi, M; McComas, D J; McNutt, R L; Elliott, H A; Hill, M E; Brown, L E; Delamere, P A; Kollmann, P; Krimigis, S M; Kusterer, M; Lisse, C M; Mitchell, D G; Piquette, M; Poppe, A R; Strobel, D F; Szalay, J R; Valek, P; Vandegriff, J; Weidner, S; Zirnstein, E J; Stern, S A; Ennico, K; Olkin, C B; Weaver, H A; Young, L A

2016-03-18

The New Horizons spacecraft carried three instruments that measured the space environment near Pluto as it flew by on 14 July 2015. The Solar Wind Around Pluto (SWAP) instrument revealed an interaction region confined sunward of Pluto to within about 6 Pluto radii. The region's surprisingly small size is consistent with a reduced atmospheric escape rate, as well as a particularly high solar wind flux. Observations from the Pluto Energetic Particle Spectrometer Science Investigation (PEPSSI) instrument suggest that ions are accelerated and/or deflected around Pluto. In the wake of the interaction region, PEPSSI observed suprathermal particle fluxes equal to about 1/10 of the flux in the interplanetary medium and increasing with distance downstream. The Venetia Burney Student Dust Counter, which measures grains with radii larger than 1.4 micrometers, detected one candidate impact in ±5 days around New Horizons' closest approach, indicating an upper limit of <4.6 kilometers(-3) for the dust density in the Pluto system. Copyright © 2016, American Association for the Advancement of Science.

FPGAs operating in a radiation environment: lessons learned from FPGAs in space

International Nuclear Information System (INIS)

Wirthlin, M J

2013-01-01

Field Programmable Gate Arrays (FPGAs) are increasingly being used as a key component of digital systems because of their in-field reprogrammability, low non-recurring engineering costs (NRE), and relatively short design cycle. Recently, there has been great interest in using FPGAs within spacecraft. FPGAs, like all semiconductor devices, are susceptible to the effects of radiation. There is an active research community investigating the effects of radiation on FPGAs and developing methods to mitigate against these effects. There has been significant progress over the last decade in the understanding and developing FPGA technology that is resistant to the effects of radiation. The success of FPGAs within spacecraft suggests that FPGAs may be used in particle physics experiments where radiation levels are considerable higher than the conventional terrestrial earth environment. This paper will summarize the effects of radiation on FPGAs, methods to mitigate against these effects, provide a case study of a successful FPGA system operating in space, and discuss the issues that will affect the use of FPGAs within particle physics experiments.

Creating a flexible learning environment.

Science.gov (United States)

Taylor, B A; Jones, S; Winters, P

1990-01-01

Lack of classroom space is a common problem for many hospital-based nurse educators. This article describes how nursing educators in one institution redesigned fixed classroom space into a flexible learning center that accommodates their various programs. Using the nursing process, the educators assessed their needs, planned the learning environment, implemented changes in the interior design, and evaluated the outcome of the project. The result was a learning environment conducive to teaching and learning.

Fire safety in space

DEFF Research Database (Denmark)

Jomaas, Grunde; Torero, Jose L.; Eigenbrod, Christian

2015-01-01

experiments has been based on existing knowledge of scenarios that are relevant, yet challenging, for a spacecraft environment. Given that there is always airflow in the space station, all the experiments are conducted with flame spread in either concurrent or opposed flow, though with the flow being stopped...... undocked from the International Space Station (ISS). The tests will be fully automated with the data downlinked at the conclusion of the test before the Cygnus vehicle re-enters the atmosphere. The unmanned, pressurized environment in the Saffire experiments allows for the largest sample sizes ever...

Monitoring the Microgravity Environment Quality On-Board the International Space Station Using Soft Computing Techniques

Science.gov (United States)

Jules, Kenol; Lin, Paul P.

2001-01-01

This paper presents an artificial intelligence monitoring system developed by the NASA Glenn Principal Investigator Microgravity Services project to help the principal investigator teams identify the primary vibratory disturbance sources that are active, at any moment in time, on-board the International Space Station, which might impact the microgravity environment their experiments are exposed to. From the Principal Investigator Microgravity Services' web site, the principal investigator teams can monitor via a graphical display, in near real time, which event(s) is/are on, such as crew activities, pumps, fans, centrifuges, compressor, crew exercise, platform structural modes, etc., and decide whether or not to run their experiments based on the acceleration environment associated with a specific event. This monitoring system is focused primarily on detecting the vibratory disturbance sources, but could be used as well to detect some of the transient disturbance sources, depending on the events duration. The system has built-in capability to detect both known and unknown vibratory disturbance sources. Several soft computing techniques such as Kohonen's Self-Organizing Feature Map, Learning Vector Quantization, Back-Propagation Neural Networks, and Fuzzy Logic were used to design the system.

Investigating fundamental physics and space environment with a dedicated Earth-orbiting spacecraft

Science.gov (United States)

Peron, Roberto

The near-Earth environment is a place of first choice for performing fundamental physics experiments, given its proximity to Earth and at the same time being relatively quiet dynamically for particular orbital arrangements. This environment also sees a rich phenomenology for what concerns gravitation. In fact, the general theory of relativity is an incredibly accurate description of gravitational phenomenology. However, its overall validity is being questioned by the theories that aim at reconciling it with the microscopic domain. Challenges come also from the ‘mysteries’ of Dark Matter and Dark Energy, though mainly at scales from the galactic up to the cosmological. It is therefore important to precisely test the consequences of the theory -- as well as those of competing ones -- at all the accessible scales. At the same time, the development of high-precision experimental space techniques, which are needed for tests in fundamental physics, opens the way to complementary applications. The growth of the (man-made) orbital debris population is creating problems to the future development of space. The year 2009 witnessed the first accidental collision between two satellites in orbit (Iridium and Cosmos) that led to the creation of more debris. International and national agencies are intervening by issuing and/or adopting guidelines to mitigate the growth of orbital debris. A central tenet of these guidelines requires a presence in space shorter than 25 years to satellites in low Earth orbit (LEO) after the conclusion of their operational lives. However, the determination of the natural lifetime of a satellite in LEO is very uncertain due to a large extent to the short-term and long-term variability of the atmospheric density in LEO and the comparatively low-accuracy of atmospheric density models. Many satellites orbiting in the 500-1200 km region with circular or elliptical orbits will be hard pressed to establish before flight whether or not they meet the 25

Täiendava informatsiooni kajastamine ettevõtete majandusaasta aruannetes / Sirle Kasendi

Index Scriptorium Estoniae

Kasendi, Sirle

2004-01-01

Eesti ja Soome börsiettevõtete aastaaruannete analüüsi tulemusena selgus, et mittefinantsiliste näitajate kajastamise tase on Eesti firmadel oluliselt nõrgem kui Soome ettevõtetel. Lisad lk. 169-173

Motoorika areng eelkoolieas ning selle mõju õpiedukusele esimeses klassis = The development of motor at preschool age and its influence on academic achievement in their first form : I koht magistritööde kategoorias / Kristi Heilman

Index Scriptorium Estoniae

Heilman, Kristi

2009-01-01

Uuringu ülesandeks oli välja selgitada koolieelikute liigutusoskuste tase sõltuvalt liikumistundide arvust lasteaia õppenädalas ja püüda välja selgitada liikumisoskuste mõju lapse õpiedukusele esimeses klassis

Nuclear and Non-Ionizing Energy-Loss for Coulomb Scattered Particles from Low Energy up to Relativistic Regime in Space Radiation Environment

CERN Document Server

Boschini, M.J.; Gervasi, M.; Giani, S.; Grandi, D.; Ivantchenko, V.; Pensotti, S.; Rancoita, P.G.; Tacconi, M.

2011-01-01

In the space environment, instruments onboard of spacecrafts can be affected by displacement damage due to radiation. The differential scattering cross section for screened nucleus--nucleus interactions - i.e., including the effects due to screened Coulomb nuclear fields -, nuclear stopping powers and non-ionization energy losses are treated from about 50\\,keV/nucleon up to relativistic energies.

Screens as light biological variable in microgravitational space environment.

Science.gov (United States)

Schlacht, S.; Masali, M.

Foreword The ability of the biological organisms to orient themselves and to synchronize on the variations of the solar rhythms is a fundamental aspect in the planning of the human habitat above all when habitat is confined in the Space the planetary and in satellite outer space settlements In order to simulate the experience of the astronauts in long duration missions one of the dominant characteristics of the Space confined habitats is the absence of the earthlings solar cycles references The Sun is the main references and guidelines of the biological compass and timepiece The organism functions are influenced from the variation of the light in the round of the 24 hours the human circadian rhythms In these habitats it is therefore necessary to reproduce the color and intensity of the solar light variations along the arc of the day according to defined scientific programs assuring a better performance of the human organism subsubsection Multilayer Foldable Screens as biological environmental variable In the project Multilayer Foldable Screens are the monitors posed in the ceiling of an Outer Space habitat and are made of liquid crystals and covered with Kevlar they stand for a modulate and flexible structure for different arrangements and different visions Screens work sout s on all the solar light frequencies and display the images that the subject needs They are characterized from the emission of an environmental light that restores the earthly solar cycle for intensity and color temperature to irradiate

Shmigun shokeeris positiivse dopinguprooviga / Andrus Nilk, Priit Pullerits

Index Scriptorium Estoniae

Nilk, Andrus, 1962-

2002-01-01

Eesti olümpiamedalilootuse organismis ületas anaboolse toimega hormooni 19-norandrosteroni tase lubatud piiri. Vt. ka art. Spordijuhid loodavad kiiret B-proovi analüüsi. Skeem: Kristina Shmiguni suusatajakarjääri silmapaistvamad saavutused

Alkylating agent (MNU)-induced mutation in space environment

Science.gov (United States)

Ohnishi, T.; Takahashi, A.; Ohnishi, K.; Takahashi, S.; Masukawa, M.; Sekikawa, K.; Amano, T.; Nakano, T.; Nagaoka, S.

2001-01-01

In recent years, some contradictory data about the effects of microgravity on radiation-induced biological responses in space experiments have been reported. We prepared a damaged template DNA produced with an alkylating agent (N-methyl-N-nitroso urea; MNU) to measure incorrect base-incorporation during DNA replication in microgravity. We examined whether mutation frequency is affected by microgravity during DNA replication for a DNA template damaged by an alkylating agent. Using an in vitro enzymatic reaction system, DNA synthesis by Taq polymerase or polymerase III was done during a US space shuttle mission (Discovery, STS-91). After the flight, DNA replication and mutation frequencies were measured. We found that there was almost no effect of microgravity on DNA replication and mutation frequency. It is suggested that microgravity might not affect at the stage of substrate incorporation in induced-mutation frequency.

An overview of space medicine.

Science.gov (United States)

Hodkinson, P D; Anderton, R A; Posselt, B N; Fong, K J

2017-12-01

Space medicine is fundamental to the human exploration of space. It supports survival, function and performance in this challenging and potentially lethal environment. It is international, intercultural and interdisciplinary, operating at the boundaries of exploration, science, technology and medicine. Space medicine is also the latest UK specialty to be recognized by the Royal College of Physicians in the UK and the General Medical Council. This review introduces the field of space medicine and describes the different types of spaceflight, environmental challenges, associated medical and physiological effects, and operational medical considerations. It will describe the varied roles of the space medicine doctor, including the conduct of surgery and anaesthesia, and concludes with a vision of the future for space medicine in the UK.Space medicine doctors have a responsibility to space workers and spaceflight participants. These 'flight surgeons' are key in developing mitigation strategies to ensure the safety, health and performance of space travellers in what is an extreme and hazardous environment. This includes all phases from selection, training and spaceflight itself to post-flight rehabilitation and long-term health. The recent recognition of the speciality provides a pathway to train in this fascinating field of medicine and is a key enabler for the UK Government's commercial spaceflight ambition. © Crown copyright 2017.

Ion accelerators for space

International Nuclear Information System (INIS)

Slobodrian, R.J.; Potvin, L.

1991-01-01

The main purpose of the accelerators is to allow ion implantation in space stations and their neighborhoods. There are several applications of interest immediately useful in such environment: as ion engines and thrusters, as implanters for material science and for hardening of surfaces (relevant to improve resistance to micrometeorite bombardment of exposed external components), production of man made alloys, etc. The microgravity environment of space stations allows the production of substances (crystalline and amorphous) under conditions unknown on earth, leading to special materials. Ion implantation in situ of those materials would thus lead uninterruptedly to new substances. Accelerators for space require special design. On the one hand it is possible to forego vacuum systems simplifying the design and operation but, on the other hand, it is necessary to pay special attention to heat dissipation. Hence it is necessary to construct a simulator in vacuum to properly test prototypes under conditions prevailing in space

New Space Weather Systems Under Development and Their Contribution to Space Weather Management

Science.gov (United States)

Tobiska, W.; Bouwer, D.; Schunk, R.; Garrett, H.; Mertens, C.; Bowman, B.

2008-12-01

There have been notable successes during the past decade in the development of operational space environment systems. Examples include the Magnetospheric Specification Model (MSM) of the Earth's magnetosphere, 2000; SOLAR2000 (S2K) solar spectral irradiances, 2001; High Accuracy Satellite Drag Model (HASDM) neutral atmosphere densities, 2004; Global Assimilation of Ionospheric Measurements (GAIM) ionosphere specification, 2006; Hakamada-Akasofu-Fry (HAF) solar wind parameters, 2007; Communication Alert and Prediction System (CAPS) ionosphere, high frequency radio, and scintillation S4 index prediction, 2008; and GEO Alert and Prediction System (GAPS) geosynchronous environment satellite charging specification and forecast, 2008. Operational systems that are in active operational implementation include the Jacchia-Bowman 2006/2008 (JB2006/2008) neutral atmosphere, 2009, and the Nowcast of Atmospheric Ionizing Radiation for Aviation Safety (NAIRAS) aviation radiation model using the Radiation Alert and Prediction System (RAPS), 2010. U.S. national agency and commercial assets will soon reach a state where specification and prediction will become ubiquitous and where coordinated management of the space environment and space weather will become a necessity. We describe the status of the CAPS, GAPS, RAPS, and JB2008 operational development. We additionally discuss the conditions that are laying the groundwork for space weather management and estimate the unfilled needs as we move beyond specification and prediction efforts.

Morbidity is related to a green living environment.

NARCIS (Netherlands)

Maas, J.; Verheij, R.A.; Vries, S. de; Spreeuwenberg, P.; Groenewegen, P.P.; Schellevis, F.G.

2009-01-01

Background: Due to increasing urbanisation people face the prospect of living in environments with few green spaces. There is increasing evidence for a positive relation between green space in people's living environment and self-reported indicators of physical and mental health. This study

Experiencing the relationship between architectural space and the major space phobias

Directory of Open Access Journals (Sweden)

Dana Pop

2015-12-01

Full Text Available During the past decades there was a noticeable effervescence characterising the space-psychology related studies. These studies established a connection between the characteristics of the environment and behaviour. Thus, this paper would like to join this field of research. Consequently, the first issue raised is whether architecture is about a space in itself, or whether it is about perception, of a mental representation. A second issue is whether a space has qualities of its own, or whether its characteristics depend on the subjectivity of the perceptual process. This hypothesis generated an entire field of research, which disputes the differences between space and place. The last issue would be the role played by architecture in the context of the space-place-perception discussion. Thus, architecture finds itself in the middle of this debate, being the instrument which carves the environment we inhabit. In order to provide a practical answer to this last question, the paper bases its conclusions on the results obtained through an experiment. This experiment tested certain situations in which the natural adaptation process has been short-circuited. These are phobic reactions. Thus, the paper wishes to lay the first theoretical ‘brick’ at the foundation of an interdisciplinary research project between architecture, psychology, sociology and virtual reality.

Successfully Transitioning Science Research to Space Weather Applications

Science.gov (United States)

Spann, James

2012-01-01

The awareness of potentially significant impacts of space weather on spaceand ground ]based technological systems has generated a strong desire in many sectors of government and industry to effectively transform knowledge and understanding of the variable space environment into useful tools and applications for use by those entities responsible for systems that may be vulnerable to space weather impacts. Essentially, effectively transitioning science knowledge to useful applications relevant to space weather has become important. This talk will present proven methodologies that have been demonstrated to be effective, and how in the current environment those can be applied to space weather transition efforts.

Blue space geographies: Enabling health in place.

Science.gov (United States)

Foley, Ronan; Kistemann, Thomas

2015-09-01

Drawing from research on therapeutic landscapes and relationships between environment, health and wellbeing, we propose the idea of 'healthy blue space' as an important new development Complementing research on healthy green space, blue space is defined as; 'health-enabling places and spaces, where water is at the centre of a range of environments with identifiable potential for the promotion of human wellbeing'. Using theoretical ideas from emotional and relational geographies and critical understandings of salutogenesis, the value of blue space to health and wellbeing is recognised and evaluated. Six individual papers from five different countries consider how health can be enabled in mixed blue space settings. Four sub-themes; embodiment, inter-subjectivity, activity and meaning, document multiple experiences within a range of healthy blue spaces. Finally, we suggest a considerable research agenda - theoretical, methodological and applied - for future work within different forms of blue space. All are suggested as having public health policy relevance in social and public space. Copyright © 2015 Elsevier Ltd. All rights reserved.

Environmental Studies at the Guiana Space Centre

Science.gov (United States)

Richard, Sandrine

2013-09-01

The Environmental Commitment of the French Space Agency at the Guiana Space Centre (CNES / CSG) specifies that the environmental protection is a major stake. Consequently, CNES participates in numerous space programs that contribute significantly to a better knowledge, management and protection of our environment at a global scale.The studies and researches that are done at CNES / CSG meet several objectives:* Assessment of safety and environmental effects and risk related to the effects overflowing due to a pollution caused by ground and flight activities* Improvement of the studies related to the knowledge of the environment (flora and fauna monitoring).* Risk assessment and management which may affect the safety of people , property, and protection of public health and environment * Verification of the compliance of the results of impact studies of launch vehicle in flight phase provided by the launch operator (Technical Regulation) with the French Safety Operational Acts.In this note, study and research programs are presented. They allow a better knowledge of the surrounding environment and of impacts caused by the industrial activities done in Guiana Space Center.

Kalijodo transformation in establishment of healthy environment in Jakarta

Science.gov (United States)

Sutanto, Erik; Junadi, Purnawan

2018-03-01

A good city setting can create a healthy environment. One of the structuring of cities that can create a healthy environment is the development of public space like Green Open Space (RTH) and Child-Friendly Integrated Public Space (RPTRA) such as in Kalijodo, Jakarta, Indonesia. The objective of building a public space in Kalijodo is to restore the functioning of the green zone in the area that previously used for housing residents and prostitution businesses to increase public space in Jakarta. The purpose of this study is to describe the formation of a healthy environment and the impact felt by users of this public space. The research method used in this research is descriptive qualitative with a phenomenological approach through interview, observation and documentation. There are three types of community activities in the public sphere, such as sports, children’s playground, and relaxation. The results show that the decline in crime rates and the presence of facilities and infrastructure in time to establish a healthy environment. The construction of facilities in the public spaces changes the image of Kalijodo from the previous place that has a negative image then turned into a positive image because the environment of Kalijodo became healthy. We also find that this changing image creates a positive spirit of the surrounding community and people are generally healthier and happier.

The role of social capital in Estonia today / Leeni Hansson

Index Scriptorium Estoniae

Hansson, Leeni

2001-01-01

Sotsiaalset kapitali iseloomustavad elanikkonna aktiivne osalemine ühiskondlikus elus ja sotsiaalsete probleemide lahendamisel, horisontaalsed võrgustikud, mis on üles ehitatud üksteise abistamise ja toetamise põhimõtetele, ning ühiskonnas valitseva usalduse kõrge tase

ORF Alignment: NC_006841 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...

Space stress and genome shock in developing plant cells

Science.gov (United States)

Krikorian, A. D.

1996-01-01

In the present paper I review symptoms of stress at the level of the nucleus in cells of plants grown in space under nonoptimized conditions. It remains to be disclosed to what extent gravity "unloading" in the space environment directly contributes to the low mitotic index and the chromosomal anomalies and damage that is frequently, but not invariably, demonstrable in space-grown plants. Evaluation of the available facts indicates that indirect effects play a major role and that there is a significant biological component to the susceptibility to stress damage equation as well. Much remains to be learned on how to provide strictly controlled, optimal environments for plant growth in space. Only after optimized controls become possible will one be able to attribute any observed space effects to lowered gravity or to other significant but more indirect effects of the space environment.

Deep Space Gateway Science Opportunities

Science.gov (United States)

Quincy, C. D.; Charles, J. B.; Hamill, Doris; Sidney, S. C.

2018-01-01

The NASA Life Sciences Research Capabilities Team (LSRCT) has been discussing deep space research needs for the last two years. NASA's programs conducting life sciences studies - the Human Research Program, Space Biology, Astrobiology, and Planetary Protection - see the Deep Space Gateway (DSG) as affording enormous opportunities to investigate biological organisms in a unique environment that cannot be replicated in Earth-based laboratories or on Low Earth Orbit science platforms. These investigations may provide in many cases the definitive answers to risks associated with exploration and living outside Earth's protective magnetic field. Unlike Low Earth Orbit or terrestrial locations, the Gateway location will be subjected to the true deep space spectrum and influence of both galactic cosmic and solar particle radiation and thus presents an opportunity to investigate their long-term exposure effects. The question of how a community of biological organisms change over time within the harsh environment of space flight outside of the magnetic field protection can be investigated. The biological response to the absence of Earth's geomagnetic field can be studied for the first time. Will organisms change in new and unique ways under these new conditions? This may be specifically true on investigations of microbial communities. The Gateway provides a platform for microbiology experiments both inside, to improve understanding of interactions between microbes and human habitats, and outside, to improve understanding of microbe-hardware interactions exposed to the space environment.

Considering the Ethical Implications of Space Exploration and Potential Impacts on Planetary Environments and Possible Indigenous Life

Science.gov (United States)

Race, Margaret

Since the early days of the Outer Space Treaty, a primary concern of planetary protection policy has been to avoid contamination of planetary environments by terrestrial microbes that could compromise current or subsequent scientific investigations, particularly those searching for indigenous life. Over the past decade robotic missions and astrobiological research have greatly increased our understanding of diverse planetary landscapes and altered our views about the survivability of terrestrial organisms in extreme environments. They have also expanded notions about the prospect for finding evidence of extraterrestrial life. Recently a number of different groups, including the COSPAR Planetary Protection Workshop in Montreal (January 2008), have questioned whether it is advisable to re-examine current biological planetary protection policy in light of the ethical implications and responsibilities to preserve planetary environments and possible indigenous life. This paper discusses the issues and concerns that have led to recent recommendations for convening an international workshop specifically to discuss planetary protection policy and practices within a broader ethical and practical framework, and to consider whether revisions to policy and practices should be made. In addition to including various international scientific and legal organizations and experts in such a workshop, it will be important to find ways to involve the public in these discussions about ethical aspects of planetary exploration.

The French Space Operation Act: Technical Regulations

Science.gov (United States)

Trinchero, J. P.; Lazare, B.

2010-09-01

The French Space Operation Act(FSOA) stipulates that a prime objective of the National technical regulations is to protect people, property, public health and the environment. Compliance with these technical regulations is mandatory as of 10 December 2010 for space operations by French space operators and for space operations from French territory. The space safety requirements and regulations governing procedures are based on national and international best practices and experience. A critical design review of the space system and procedures shall be carried out by the applicant, in order to verify compliance with the Technical Regulations. An independent technical assessment of the operation is delegated to CNES. The principles applied when drafting technical regulations are as follows: requirements must as far as possible establish the rules according to the objective to be obtained, rather than how it is to be achieved; requirements must give preference to international standards recognised as being the state of the art; requirements must take previous experience into account. Technical regulations are divided into three sections covering common requirements for the launch, control and return of a space object. A dedicated section will cover specific rules to be applied at the Guiana Space Centre. The main topics addressed by the technical regulations are: operator safety management system; study of risks to people, property, public health and the Earth’s environment; impact study on the outer space environment: space debris generated by the operation; planetary protection.

Detection of Social Interaction in Smart Spaces.

Science.gov (United States)

Cook, Diane J; Crandall, Aaron; Singla, Geetika; Thomas, Brian

2010-02-01

The pervasive sensing technologies found in smart environments offer unprecedented opportunities for monitoring and assisting the individuals who live and work in these spaces. An aspect of daily life that is important for one's emotional and physical health is social interaction. In this paper we investigate the use of smart environment technologies to detect and analyze interactions in smart spaces. We introduce techniques for collect and analyzing sensor information in smart environments to help in interpreting resident behavior patterns and determining when multiple residents are interacting. The effectiveness of our techniques is evaluated using two physical smart environment testbeds.

Measurement result of the neutron monitor onboard the Space Environment Data Acquisition Equipment - Attached Payload (SEDA-AP)

Science.gov (United States)

Koga, K.; Muraki, Y.; Shibata, S.; Yamamoto, T.; Matsumoto, H.; Okudaira, O.; Kawano, H.; Yumoto, K.

2013-12-01

To support future space activities, it is crucial to acquire space environmental data related to the space-radiation degradation of space parts and materials, and spacecraft anomalies. Such data are useful for spacecraft design and manned space activity. SEDA-AP was mounted on 'Kibo' of the ISS (International Space Station) to measure the space environment at a 400-kilometer altitude. Neutrons are very harmful radiation, with electrical neutrality that makes them strongly permeable. SEDA-AP measures the energy of neutrons from thermal to 100 MeV in real time using a Bonner Ball Detector (BBND) and a Scintillation Fiber Detector (FIB). BBND detects neutrons using He-3 counters, which have high sensitivity to thermal neutrons. Neutron energy is derived using the relative response function of polyethylene moderators of 6 different thicknesses. FIB measures the tracks of recoil protons caused by neutrons within a cubic arrayed sensor of 512 scintillation fibers. The charged particles are excluded using an anti-scintillator which surrounds the cube sensor, and the neutron energy is obtained from the track length of a recoil proton. There are three sources of neutrons in space; 1. Albedo Neutrons Produced by reactions of galactic cosmic rays or radiation belt particles with the atmosphere 2. Local Neutrons Produced by the reactions of galactic cosmic rays or radiation belt particles with spacecraft 3. Solar Neutrons Produced by accelerated particles in solar flares An accurate energy spectrum of the solar neutrons includes important information on high-energy particle generation mechanism in a solar flare, because neutrons are unaffected by interplanetary magnetic fields. These data will become useful to forecast solar energetic particles in future. Some candidate events involving solar neutrons were found as a result of analyzing data of the solar flare of M>2 since September 2009. Moreover, it is important to measure albedo neutrons, since protons generated by neutron

European activities in space radiation biology and exobiology

International Nuclear Information System (INIS)

Horneck, G.

1996-01-01

In view of the space station era, the European Space Agency has initiated a review and planning document for space life sciences. Radiation biology includes dosimetry of the radiation field and its modification by mass shielding, studies on the biological responses to radiation in space, on the potential impact of space flight environment on radiation effects, and assessing the radiation risks and establishing radiation protection guidelines. To reach a better understanding of the processes leading to the origin, evolution and distribution of life, exobiological activities include the exploration of the solar system, the collection and analysis of extraterrestrial samples and the utilization of space as a tool for testing the impact of space environment on organics and resistant life forms. (author)

Electrodynamic Dust Shield for Space Applications

Science.gov (United States)

Mackey, Paul J.; Johansen, Michael R.; Olsen, Robert C.; Raines, Matthew G.; Phillips, James R., III; Cox, Rachel E.; Hogue, Michael D.; Pollard, Jacob R. S.; Calle, Carlos I.

2016-01-01

Dust mitigation technology has been highlighted by NASA and the International Space Exploration Coordination Group (ISECG) as a Global Exploration Roadmap (GER) critical technology need in order to reduce life cycle cost and risk, and increase the probability of mission success. The Electrostatics and Surface Physics Lab in Swamp Works at the Kennedy Space Center has developed an Electrodynamic Dust Shield (EDS) to remove dust from multiple surfaces, including glass shields and thermal radiators. Further development is underway to improve the operation and reliability of the EDS as well as to perform material and component testing outside of the International Space Station (ISS) on the Materials on International Space Station Experiment (MISSE). This experiment is designed to verify that the EDS can withstand the harsh environment of space and will look to closely replicate the solar environment experienced on the Moon.

Ultralightweight PV Array Materials for Deep Space Mission Environments, Phase I

Data.gov (United States)

National Aeronautics and Space Administration — Photovoltaic arrays for future deep space NASA missions demand multiple functionalities. They must efficiently generate electrical power, have very large areas and...

Potential of Space-Borne Hyperspectral Data for Biomass Quantification in an Arid Environment: Advantages and Limitations

Directory of Open Access Journals (Sweden)

Harald Zandler

2015-04-01

Full Text Available In spite of considerable efforts to monitor global vegetation, biomass quantification in drylands is still a major challenge due to low spectral resolution and considerable background effects. Hence, this study examines the potential of the space-borne hyperspectral Hyperion sensor compared to the multispectral Landsat OLI sensor in predicting dwarf shrub biomass in an arid region characterized by challenging conditions for satellite-based analysis: The Eastern Pamirs of Tajikistan. We calculated vegetation indices for all available wavelengths of both sensors, correlated these indices with field-mapped biomass while considering the multiple comparison problem, and assessed the predictive performance of single-variable linear models constructed with data from each of the sensors. Results showed an increased performance of the hyperspectral sensor and the particular suitability of indices capturing the short-wave infrared spectral region in dwarf shrub biomass prediction. Performance was considerably poorer in the area with less vegetation cover. Furthermore, spatial transferability of vegetation indices was not feasible in this region, underlining the importance of repeated model building. This study indicates that upcoming space-borne hyperspectral sensors increase the performance of biomass prediction in the world’s arid environments.

Dose estimation for space radiation protection

International Nuclear Information System (INIS)

Xu Feng; Xu Zhenhua; Huang Zengxin; Jia Xianghong

2007-01-01

For evaluating the effect of space radiation on human health, the dose was estimated using the models of space radiation environment, models of distribution of the spacecraft's or space suit's mass thickness and models of human body. The article describes these models and calculation methods. (authors)

Sissejuhatus / Kjell A Eliassen, Jan Kooiman

Index Scriptorium Estoniae

Eliassen, Kjell A

2002-01-01

Avaliku sektori juhtimise käsitluses eristatakse üldistavalt 2 analüüsitaset: üks on üldine, avaliku sektori kui terviku juhtimine, teine tase aga tegeleb avalike organisatsioonide sisemise käigushoidmise küsimustega. Tabelid

Analysing Medieval Urban Space; a methodology

Directory of Open Access Journals (Sweden)

Marlous L. Craane MA

2007-08-01

Full Text Available This article has been written in reaction to recent developments in medieval history and archaeology, to study not only the buildings in a town but also the spaces that hold them together. It discusses a more objective and interdisciplinary approach for analysing urban morphology and use of space. It proposes a 'new' methodology by combining town plan analysis and space syntax. This methodology was trialled on the city of Utrecht in the Netherlands. By comparing the results of this 'new' methodology with the results of previous, more conventional, research, this article shows that space syntax can be applied successfully to medieval urban contexts. It does this by demonstrating a strong correlation between medieval economic spaces and the most integrated spaces, just as is found in the study of modern urban environments. It thus provides a strong basis for the use of this technique in future research of medieval urban environments.

Space Science at Los Alamos National Laboratory

Science.gov (United States)

Smith, Karl

2017-09-01

The Space Science and Applications group (ISR-1) in the Intelligence and Space Research (ISR) division at the Los Alamos National Laboratory lead a number of space science missions for civilian and defense-related programs. In support of these missions the group develops sensors capable of detecting nuclear emissions and measuring radiations in space including γ-ray, X-ray, charged-particle, and neutron detection. The group is involved in a number of stages of the lifetime of these sensors including mission concept and design, simulation and modeling, calibration, and data analysis. These missions support monitoring of the atmosphere and near-Earth space environment for nuclear detonations as well as monitoring of the local space environment including space-weather type events. Expertise in this area has been established over a long history of involvement with cutting-edge projects continuing back to the first space based monitoring mission Project Vela. The group's interests cut across a large range of topics including non-proliferation, space situational awareness, nuclear physics, material science, space physics, astrophysics, and planetary physics.

Distributed computing environments for future space control systems

Science.gov (United States)

Viallefont, Pierre

1993-01-01

The aim of this paper is to present the results of a CNES research project on distributed computing systems. The purpose of this research was to study the impact of the use of new computer technologies in the design and development of future space applications. The first part of this study was a state-of-the-art review of distributed computing systems. One of the interesting ideas arising from this review is the concept of a 'virtual computer' allowing the distributed hardware architecture to be hidden from a software application. The 'virtual computer' can improve system performance by adapting the best architecture (addition of computers) to the software application without having to modify its source code. This concept can also decrease the cost and obsolescence of the hardware architecture. In order to verify the feasibility of the 'virtual computer' concept, a prototype representative of a distributed space application is being developed independently of the hardware architecture.

Space Weather and Real-Time Monitoring

Directory of Open Access Journals (Sweden)

S Watari

2009-04-01

Full Text Available Recent advance of information and communications technology enables to collect a large amount of ground-based and space-based observation data in real-time. The real-time data realize nowcast of space weather. This paper reports a history of space weather by the International Space Environment Service (ISES in association with the International Geophysical Year (IGY and importance of real-time monitoring in space weather.

MESSENGER, MErcury: Surface, Space ENvironment, GEochemistry, and Ranging; A Mission to Orbit and Explore the Planet Mercury

Science.gov (United States)

1999-01-01

MESSENGER is a scientific mission to Mercury. Understanding this extraordinary planet and the forces that have shaped it is fundamental to understanding the processes that have governed the formation, evolution, and dynamics of the terrestrial planets. MESSENGER is a MErcury Surface, Space ENvironment, GEochemistry and Ranging mission to orbit Mercury for one Earth year after completing two flybys of that planet following two flybys of Venus. The necessary flybys return significant new data early in the mission, while the orbital phase, guided by the flyby data, enables a focused scientific investigation of this least-studied terrestrial planet. Answers to key questions about Mercury's high density, crustal composition and structure, volcanic history, core structure, magnetic field generation, polar deposits, exosphere, overall volatile inventory, and magnetosphere are provided by an optimized set of miniaturized space instruments. Our goal is to gain new insight into the formation and evolution of the solar system, including Earth. By traveling to the inner edge of the solar system and exploring a poorly known world, MESSENGER fulfills this quest.

Digitally intensive DC-DC converter for extreme space environments, Phase II

Data.gov (United States)

National Aeronautics and Space Administration — The Space Micro-Arizona State University (ASU) team will develop an all-digitally controlled, wide temperature range point-of-load switch-mode DC-DC regulator core...

Space Gerontology

Science.gov (United States)

Miquel, J. (Editor); Economos, A. C. (Editor)

1982-01-01

Presentations are given which address the effects of space flght on the older person, the parallels between the physiological responses to weightlessness and the aging process, and experimental possibilities afforded by the weightless environment to fundamental research in gerontology and geriatrics.

Prediction of temperature variation in a rotating spacecraft in space environment

International Nuclear Information System (INIS)

Gadalla, Mohamed A.

2005-01-01

This paper presents a closed-form prediction model for the temperature distribution of a thick-walled cylindrical space vehicle subjected to solar heating in deep space. The model is based on the coupling between dynamics and solar radiation. Since solar radiation is, in general, incident from a fixed direction, one side of the space vehicle will be shone bright, and the other side dark. Thus the space astronauts, instruments, and cryogenic-fuel tanks are gaining heat on the bright side and losing heat from the dark side. This radiative heat gain and loss become equally significant as the conductive heat transfer through the interior of the space vehicle. Thermal analysis is carried out to predict the effect of the spinning speed and angular position on the temperature variation and gradients attained by speed vehicles outside the Earth's atmosphere. This analysis is based on the non-linearity of the radiative heat dissipation, the significant conductive heat transfer role, and combined boundary conditions that involve the temperature and angular position of the vehicle. An exact analytical solution is obtained inspite of the non-linearity and non-homogeneity in the boundary conditions. The results indicate that the temperature distribution on the outer surface of the space vehicle is nearly independent of the angular position; at sub-cylindrical surface, this independence is achieved at low angular velocity

Digitally intensive DC-DC converter for extreme space environments, Phase I

Data.gov (United States)

National Aeronautics and Space Administration — The Space Micro –Arizona State University (ASU) team will develop an all-digitally controlled, wide temperature range point-of-load switch-mode DC-DC regulator core...

Activating Public Space: How to Promote Physical Activity in Urban Environment

Science.gov (United States)

Kostrzewska, Małgorzata

2017-10-01

Physical activity is an essential component of a healthy lifestyle. The quality and equipment of urban public space plays an important role in promoting physical activity among people (residents, tourists). In order for recreation and sports activities to be undertaken willingly, in a safe and comprehensive manner, certain spatial conditions and requirements must be met. The distinctive feature of contemporary large cities is the disappearance of local, neighbourly relations, and the consequent loneliness, alienation, and atomization of the residents. Thus, the design of public spaces should be an expression of the values of social inclusion and integration. A properly designed urban space would encourage people to leave their homes and integrate, also by undertaking different forms of physical activities. This, in turn, can lead to raising the quality of the space, especially in the context of its “familiarization” and “domestication”. The aim of the research was to identify the architectural and urban features of the public spaces of contemporary cities that can contribute to the promotion of physical activity. The paper presents the research results and the case studies of such spatial solutions and examples of good practices, which invite residents to undertake different forms of physical activities in public spaces. The issue of the integrating, inclusionary, and social function of physical recreation and sport is discussed as well, and so are the possibilities of translating these values into physical characteristics of an urban space. The main conclusions are that taking into account the diverse needs of different social groups, participation in the design and construction process, aesthetic and interesting design, vicinity of the residence, open access for all age groups and the disabled would be the most important spatial determinants of a properly designed, physically activating public space. Strategies of planning the sports and recreation

The Affect of the Space Environment on the Survival of Halorubrum Chaoviator and Synechococcus (Nageli): Data from the Space Experiment OSMO on EXPOSE-R

Science.gov (United States)

Mancinelli, R. L.

2014-01-01

We have shown using ESA's Biopan facility flown in Earth orbit that when exposed to the space environment for 2 weeks the survival rate of Synechococcus (Nageli), a halophilic cyanobacterium isolated from the evaporitic gypsum-halite crusts that form along the marine intertidal, and Halorubrum chaoviator a member of the Halobacteriaceae isolated from an evaporitic NaCl crystal obtained from a salt evaporation pond, were higher than all other test organisms except Bacillus spores. These results led to the EXPOSE-R mission to extend and refine these experiments as part of the experimental package for the external platform space exposure facility on the ISS. The experiment was flown in February 2009 and the organisms were exposed to low-Earth orbit for nearly 2 years. Samples were either exposed to solar ultraviolet (UV)-radiation (lambda is greater than 110 nm or lambda is greater than 200 nm, cosmic radiation (dosage range 225-320 mGy), or kept in darkness shielded from solar UV-radiation. Half of each of the UV-radiation exposed samples and dark samples were exposed to space vacuum and half kept at 105 pascals in argon. Duplicate samples were kept in the laboratory to serve as unexposed controls. Ground simulation control experiments were also performed. After retrieval, organism viability was tested using Molecular Probes Live-Dead Bac-Lite stain and by their reproduction capability. Samples kept in the dark, but exposed to space vacuum had a 90 +/- 5% survival rate compared to the ground controls. Samples exposed to full UV-radiation for over a year were bleached and although results from Molecular Probes Live-Dead stain suggested approximately 10% survival, the data indicate that no survival was detected using cell growth and division using the most probable number method. Those samples exposed to attenuated UV-radiation exhibited limited survival. Results from of this study are relevant to understanding adaptation and evolution of life, the future of life

Concept for an International Standard related to Space Weather Effects on Space Systems

Science.gov (United States)

Tobiska, W. Kent; Tomky, Alyssa

There is great interest in developing an international standard related to space weather in order to specify the tools and parameters needed for space systems operations. In particular, a standard is important for satellite operators who may not be familiar with space weather. In addition, there are others who participate in space systems operations that would also benefit from such a document. For example, the developers of software systems that provide LEO satellite orbit determination, radio communication availability for scintillation events (GEO-to-ground L and UHF bands), GPS uncertainties, and the radiation environment from ground-to-space for commercial space tourism. These groups require recent historical data, current epoch specification, and forecast of space weather events into their automated or manual systems. Other examples are national government agencies that rely on space weather data provided by their organizations such as those represented in the International Space Environment Service (ISES) group of 14 national agencies. Designers, manufacturers, and launchers of space systems require real-time, operational space weather parameters that can be measured, monitored, or built into automated systems. Thus, a broad scope for the document will provide a useful international standard product to a variety of engineering and science domains. The structure of the document should contain a well-defined scope, consensus space weather terms and definitions, and internationally accepted descriptions of the main elements of space weather, its sources, and its effects upon space systems. Appendices will be useful for describing expanded material such as guidelines on how to use the standard, how to obtain specific space weather parameters, and short but detailed descriptions such as when best to use some parameters and not others; appendices provide a path for easily updating the standard since the domain of space weather is rapidly changing with new advances

The hydrodynamics of plant spacing distance: Optimizing consumptive and non-consumptive water use in water-limited environments

Science.gov (United States)

Trautz, A.; Illangasekare, T. H.; Rodriguez-Iturbe, I.; Howington, S. E.

2017-12-01

The availability of soil moisture in water-stressed environments is one of the primary factors controlling plant performance and overall plant community productivity and structure. The minimization of non-consumptive water loss, or water not utilized by plants (i.e. consumptive use), to bare soil evaporation is a key plant survival strategy and important agricultural consideration. Competitive (negative) and facilitative (positive) interactions between individual plants play a pivotal role in controlling the local coupled soil-plant-atmosphere hydrodynamics that affect both consumptive and non-consumptive water use. The strength of these two types of interactions vary with spacing distance between individuals. In a recent PNAS publication, we hypothesized that there exists a quantifiable spacing distance between plants that optimizes the balance between competition and facilitation, and hence maximizes water conservation. This study expands upon on our previous work, for which only a subset of the data generated was used, through the development and testing of a numerical model that can test a conceptual model we presented. The model simulates soil-plant-atmosphere continuum heat and mass transfer hydrodynamics, taking into account the complex feedbacks that exist between the near-surface atmosphere, subsurface, and plants. This model has been developed to explore the combined effects of subsurface competition and micro-climatic amelioration (i.e., facilitation) on local soil moisture redistribution and fluxes in the context of water-stressed environments that experienced sustained winds. We believe the results have the potential to provide new insights into climatological, ecohydrological, and hydrological problems pertaining to: the extensively used and much debated stress-gradient hypothesis, plant community population self-organization, agricultural best practices (e.g., water management), and spatial heterogeneity of land-atmosphere fluxes.

Microorganisms and biomolecules in space hard environment

Science.gov (United States)

Horneck, G.

1981-01-01

Microorganisms and biomolecules exposed to space vacuum and to different intensities of selected wavelengths of solar ultraviolet radiation is studied. The influence of these factors, applied singly or simultaneously, on the integrity of microbial systems and biomolecules is measured. Specifically, this experiment will study in Bacillus subtilis spores (1) disturbances in subsequent germination, outgrowth, and colony formation; (2) photochemical reactions of the DNA and protein in vivo and in vitro and their role in biological injury; and (3) the efficiency of repair processes in these events.

Space Sharing Between Formal and Informal Sectors In Kemang Area

Science.gov (United States)

Sihombing, Antony; Dewanti, Hafizka Chandra

2018-01-01

Sharing is a form of human activity as a social being, over resources or spaces. Humans generally define their space according to their psychological and biological needs. However, what if space sharing takes place in an urban scope? The phenomenon of space sharing happens in Kemang area done by two distinct sectors, formal and informal which both are engaged in commercial activities independently. In the study of territory and the behavior settings, the quality of environment can affect the formation of human activities in a space, occurs a phenomenon of space sharing. The researcher will discuss and present a form of the space sharing by the formal and informal sectors in a commercial area through different environmental qualities. In some circumstance, a form of space sharing can increase the value of space and obtain to a shared space, where both sectors mutually take benefits. Otherwise, it leads to an adverse impact in some others. It is clear that differences in the physical environment and social environment have an impact on the formation of space sharing and the value of space in an urban region.

Virtual Satellite Integration Environment, Phase II

Data.gov (United States)

National Aeronautics and Space Administration — An integrated environment for rapid design studies of small satellite missions will be developed. This environment will be designed to streamline processes at the...

The Space Industry