Research and technology: 1994 annual report of the John F. Kennedy Space Center
1994-01-01
As the NASA Center responsible for assembly, checkout, servicing, launch, recovery, and operational support of Space Transportation System elements and payloads, the John F. Kennedy Space Center is placing increasing emphasis on its advanced technology development program. This program encompasses the efforts of the Engineering Development Directorate laboratories, most of the KSC operations contractors, academia, and selected commercial industries - all working in a team effort within their own areas of expertise. This edition of the Kennedy Space Center Research and Technology 1994 Annual Report covers efforts of all these contributors to the KSC advanced technology development program, as well as our technology transfer activities. The Technology Programs and Commercialization Office (DE-TPO), (407) 867-3017, is responsible for publication of this report and should be contacted for any desired information regarding the advanced technology program.
2010-04-01
... prepackaged ready-to-eat savory (i.e., salty or piquant but not sweet) snacks and prepackaged, unpopped popcorn kernels that are ready-to-heat. In such foods, the additive may be used in place of fats and oils... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Olestra. 172.867 Section 172.867 Food and Drugs...
Lifescience Database Archive (English)
Full Text Available SH (Link to library) SHI867 (Link to dictyBase) - - - Contig-U11503-1 - (Link to Or...iginal site) SHI867F 646 - - - - - - Show SHI867 Library SH (Link to library) Clone ID SHI867 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11503-1 Original site URL http://dictycdb.b...fsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICTSLKDAVSRAFLLISNNSRVCIGIIGNINVTSEQITLGNYCGA...l*lsif--- Frame C: qkkqfsl*iy*YMIRKSNNFSILFAIFLKIVFVVSAPLCPNSTILLNYNILTVYNSSEGC GFNNEPICT
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHE867 (Link to dictyBase) - G02701 DDB0204977 Contig-U14789-1... - (Link to Original site) VHE867F 383 - - - - - - Show VHE867 Library VH (Link to library) Clone ID VHE867 (Link to dict...yBase) Atlas ID - NBRP ID G02701 dictyBase ID DDB0204977 Link to Contig Contig-U14789-1 Original site URL http://dict...one) Salmo salar clone ssal-rgb2-599-16... 116 2e-25 DQ363469_1( DQ363469 |pid:none) Ict...m_ : 1.00 40.0 %: cytoplasmic 36.0 %: nuclear 12.0 %: cytoskeletal 8.0 %: mitochondrial 4.0 %: peroxisomal >> predict
14 CFR 91.321 - Carriage of candidates in elections.
2010-01-01
... carrier or commercial operator; (2) You carry the candidate, agent, or person traveling on behalf of a... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Carriage of candidates in elections. 91.321 Section 91.321 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION...
42 CFR 403.321 - State systems for hospital outpatient services.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false State systems for hospital outpatient services. 403.321 Section 403.321 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND... application for approval of an outpatient system if the following conditions are met: (a) The State's...
Base catalyzed synthesis of bicyclo[3.2.1]octane scaffolds.
Boehringer, Régis; Geoffroy, Philippe; Miesch, Michel
2015-07-07
The base-catalyzed reaction of achiral 1,3-cyclopentanediones tethered to activated olefins afforded in high yields bicyclo[3.2.1]octane-6,8-dione or bicyclo[3.2.1]octane-6-carboxylate derivatives bearing respectively three or five stereogenic centers. The course of the reaction is closely related to the reaction time and to the base involved in the reaction.
7 CFR 1951.867 - Conflict of interest.
2010-01-01
... (including immediate family) holds any legal or financial interest or influence in the intermediary. FmHA or...) PROGRAM REGULATIONS (CONTINUED) SERVICING AND COLLECTIONS Rural Development Loan Servicing § 1951.867... the intermediary or its principal officers (including immediate family) hold any legal or financial...
45 CFR 86.7 - Effect of employment opportunities.
2010-10-01
... ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Introduction § 86.7 Effect of employment opportunities. The obligation to comply with this part is not obviated...
Aerial view of the Kennedy Space Center Visitor Center
1998-01-01
The Kennedy Space Center Visitor Center, shown in this aerial view looking south, sprawls across 70 acres on Florida's Space Coast , and is located off State Road 405, NASA Parkway, six miles inside the Space Center entrance. SR 405 can be seen at the bottom of the photo. Just above the roadway, from left can be seen the Shuttle/Gantry mockup; the Post Show Dome; the Astronaut Memorial; and to the far right, the Center for Space Education. Behind the Memorial are a cluster of buildings that include the Theater Complex, Cafeteria, Space Flight Exhibit Building, Souvenir Sales Building, Spaceport Central, and Ticket Pavilion. At the upper right are various rockets that have played a significant role in the growth of the space program.
2008-01-01
This audit was initiated in response to a hotline complaint regarding the review, approval, and release of scientific and technical information (STI) at Johnson Space Center. The complainant alleged that Johnson personnel conducting export control reviews of STI were not fully qualified to conduct those reviews and that the reviews often did not occur until after the STI had been publicly released. NASA guidance requires that STI, defined as the results of basic and applied scientific, technical, and related engineering research and development, undergo certain reviews prior to being released outside of NASA or to audiences that include foreign nationals. The process includes technical, national security, export control, copyright, and trade secret (e.g., proprietary data) reviews. The review process was designed to preclude the inappropriate dissemination of sensitive information while ensuring that NASA complies with a requirement of the National Aeronautics and Space Act of 1958 (the Space Act)1 to provide for the widest practicable and appropriate dissemination of information resulting from NASA research activities. We focused our audit on evaluating the STI review process: specifically, determining whether the roles and responsibilities for the review, approval, and release of STI were adequately defined and documented in NASA and Center-level guidance and whether that guidance was effectively implemented at Goddard Space Flight Center, Johnson Space Center, Langley Research Center, and Marshall Space Flight Center. Johnson was included in the review because it was the source of the initial complaint, and Goddard, Langley, and Marshall were included because those Centers consistently produce significant amounts of STI.
47 CFR 22.867 - Effective radiated power limits.
2010-10-01
... MOBILE SERVICES Air-Ground Radiotelephone Service Commercial Aviation Air-Ground Systems § 22.867... operating on the frequency ranges listed in § 22.857 must not exceed the limits in this section. (a) The peak ERP of airborne mobile station transmitters must not exceed 12 Watts. (b) The peak ERP of ground...
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Authority. 550.321 Section 550.321...) Allotments From Federal Employees Labor Organization § 550.321 Authority. Section 7115, title 5, United... with such rules and regulations as may be prescribed by the Federal Labor Relations Authority. ...
INFINITY at NASA Stennis Space Center
2010-01-01
Flags are planted on the roof of the new INFINITY at NASA Stennis Space Center facility under construction just west of the Mississippi Welcome Center at exit 2 on Interstate 10. Stennis and community leaders celebrated the 'topping out' of the new science center Nov. 17, marking a construction milestone for the center. The 72,000-square-foot science and education center will feature space and Earth galleries to showcase the science that underpins the missions of the agencies at Stennis Space Center. The center is targeted to open in 2012.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Reports. 321.8 Section 321.8... ADMINISTRATION) § 321.8 Reports. The Department of Defense, Department of Energy, and Maritime Administration shall furnish the Administrator of the Federal Emergency Management Agency with reports on items and...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Hearing. 209.321 Section 209.321 Transportation... TRANSPORTATION RAILROAD SAFETY ENFORCEMENT PROCEDURES Disqualification Procedures § 209.321 Hearing. (a) Upon receipt of a hearing request complying with § 209.311, an administrative hearing for review of a notice of...
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Introduction. 32.1 Section 32.1 Public Lands: Interior Office of the Secretary of the Interior GRANTS TO STATES FOR ESTABLISHING YOUNG ADULT CONSERVATION CORPS (YACC) PROGRAM § 32.1 Introduction. (a) The Young Adult Conservation Corps (YACC) is...
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Marketing. 886.321 Section 886.321... the Disposition of HUD-Owned Projects § 886.321 Marketing. (a) Marketing in accordance with HUD-Approved Plan. Marketing of units and selection of families by the owner shall be in accordance with the...
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Hearing. 107.321 Section 107.321 Transportation... PROCEDURES Enforcement Compliance Orders and Civil Penalties § 107.321 Hearing. (a) To the extent practicable, the hearing is held in the general vicinity of the place where the alleged violation occurred or at a...
2010-07-01
... ASSISTANCE General Provisions § 32.1 Purpose. Section 504 of the Rehabilitation Act of 1973 prohibits... purpose of this part is to implement section 504 with respect to receiving Federal financial assistance... 29 Labor 1 2010-07-01 2010-07-01 true Purpose. 32.1 Section 32.1 Labor Office of the Secretary of...
2010-01-01
... additional category or class of light-sport aircraft? 61.321 Section 61.321 Aeronautics and Space FEDERAL... INSTRUCTORS, AND GROUND INSTRUCTORS Sport Pilots § 61.321 How do I obtain privileges to operate an additional category or class of light-sport aircraft? If you hold a sport pilot certificate and seek to operate an...
31 CFR 29.321 - General principle.
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false General principle. 29.321 Section 29.321 Money and Finance: Treasury Office of the Secretary of the Treasury FEDERAL BENEFIT PAYMENTS UNDER....321 General principle. Any service performed after June 30, 1997, may never be credited toward Federal...
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Air quality. 75.321 Section 75.321 Mineral... SAFETY STANDARDS-UNDERGROUND COAL MINES Ventilation § 75.321 Air quality. (a)(1) The air in areas where... air current in these areas shall be sufficient to dilute, render harmless, and carry away flammable...
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false IEP Team. 300.321 Section 300.321 Education Regulations... Placements Individualized Education Programs § 300.321 IEP Team. (a) General. The public agency must ensure that the IEP Team for each child with a disability includes— (1) The parents of the child; (2) Not less...
14 CFR 171.321 - DME and marker beacon performance requirements.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false DME and marker beacon performance... (MLS) § 171.321 DME and marker beacon performance requirements. (a) The DME equipment must meet the..._regulations/ibr_locations.html. (b) MLS marker beacon equipment must meet the performance requirements...
867.pdf | aug2012 | jess | Indian Academy of Sciences
Indian Academy of Sciences (India)
Home; jess; aug2012; 867.pdf. 404! error. The page your are looking for can not be found! Please check the link or use the navigation bar at the top. YouTube; Twitter; Facebook; Blog. Academy News. IAS Logo. 29th Mid-year meeting. Posted on 19 January 2018. The 29th Mid-year meeting of the Academy will be held from ...
U-235 Holdup Measurements in the 321-M Lathe HEPA Banks
International Nuclear Information System (INIS)
Salaymeh, S.R.
2002-01-01
The Analytical Development Section of Savannah River Technology Center (SRTC) was requested by the Facilities Decommissioning Division (FDD) to determine the holdup of enriched uranium in the 321-M facility as part of an overall deactivation project of the facility. The results of the holdup assays are essential for determining compliance with the Waste Acceptance Criteria, Material Control and Accountability, and to meet criticality safety controls. This report covers holdup measurements of uranium residue in six high efficiency particulate air (HEPA) filter banks of the A-lathe and B-lathe exhaust systems of the 321-M facility. This report discusses the non-destructive assay measurements, assumptions, calculations, and results of the uranium holdup in these six items
7 CFR 1210.321 - Nominations and selection.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Nominations and selection. 1210.321 Section 1210.321 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... PROMOTION PLAN Watermelon Research and Promotion Plan National Watermelon Promotion Board § 1210.321...
14 CFR 1216.321 - Environmental effects abroad of major Federal actions.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Environmental effects abroad of major...) Other Requirements § 1216.321 Environmental effects abroad of major Federal actions. (a) In accordance with these procedures and E.O. 12114, “Environmental Effects Abroad of Major Federal Actions” (44 FR...
Activities of the Center for Space Construction
1993-01-01
The Center for Space Construction (CSC) at the University of Colorado at Boulder is one of eight University Space Engineering Research Centers established by NASA in 1988. The mission of the center is to conduct research into space technology and to directly contribute to space engineering education. The center reports to the Department of Aerospace Engineering Sciences and resides in the College of Engineering and Applied Science. The college has a long and successful track record of cultivating multi-disciplinary research and education programs. The Center for Space Construction is prominent evidence of this record. At the inception of CSC, the center was primarily founded on the need for research on in-space construction of large space systems like space stations and interplanetary space vehicles. The scope of CSC's research has now evolved to include the design and construction of all spacecraft, large and small. Within this broadened scope, our research projects seek to impact the underlying technological basis for such spacecraft as remote sensing satellites, communication satellites, and other special purpose spacecraft, as well as the technological basis for large space platforms. The center's research focuses on three areas: spacecraft structures, spacecraft operations and control, and regolith and surface systems. In the area of spacecraft structures, our current emphasis is on concepts and modeling of deployable structures, analysis of inflatable structures, structural damage detection algorithms, and composite materials for lightweight structures. In the area of spacecraft operations and control, we are continuing our previous efforts in process control of in-orbit structural assembly. In addition, we have begun two new efforts in formal approach to spacecraft flight software systems design and adaptive attitude control systems. In the area of regolith and surface systems, we are continuing the work of characterizing the physical properties of lunar
44 CFR 321.3 - Maintaining the mobilization base.
2010-10-01
... base. 321.3 Section 321.3 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY PREPAREDNESS MAINTENANCE OF THE MOBILIZATION BASE (DEPARTMENT OF DEFENSE, DEPARTMENT OF ENERGY, MARITIME ADMINISTRATION) § 321.3 Maintaining the mobilization base. (a) Facilities...
44 CFR 321.5 - Retention of industrial facilities.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Retention of industrial facilities. 321.5 Section 321.5 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY..., DEPARTMENT OF ENERGY, MARITIME ADMINISTRATION) § 321.5 Retention of industrial facilities. (a) Industrial...
44 CFR 321.6 - Participation of small business.
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Participation of small business. 321.6 Section 321.6 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY..., DEPARTMENT OF ENERGY, MARITIME ADMINISTRATION) § 321.6 Participation of small business. The agencies...
49 CFR 387.321 - Operations in foreign commerce.
2010-10-01
... 49 Transportation 5 2010-10-01 2010-10-01 false Operations in foreign commerce. 387.321 Section 387.321 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL MOTOR CARRIER... Carriers and Property Brokers § 387.321 Operations in foreign commerce. No motor carrier may operate in the...
National Space Science Data Center Master Catalog
National Aeronautics and Space Administration — The National Space Science Data Center serves as the permanent archive for NASA space science mission data. 'Space science' means astronomy and astrophysics, solar...
Health services at the Kennedy Space Center
Ferguson, E. B.; Humbert, P.; Long, I. D.; Tipton, D. A.
1992-01-01
Comprehensive occupational health services are provided to approximately 17,000 workers at the Kennedy Space Center and an additional 6000 on Cape Canaveral Air Force Station. These areas cover about 120,000 acres encompassing part of the Merritt Island Wild Life Refuge and wetlands which are the habitat of numerous endangered and protected species of wildlife. The services provided at the Kennedy Space Center optimally assure a safe and healthy working environment for the employees engaged in the preparation and launching of this country's Space Shuttle and other important space exploration programs.
31 CFR 321.2 - Eligible organizations.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Eligible organizations. 321.2 Section... § 321.2 Eligible organizations. (a) Organizations eligible to apply for qualification and to serve as.... (b)(1) An organization that desires to redeem securities must first qualify as a paying agent. An...
Not all IGHV3-21 chronic lymphocytic leukemias are equal
DEFF Research Database (Denmark)
Baliakas, Panagiotis; Agathangelidis, Andreas; Hadzidimitriou, Anastasia
2015-01-01
An unresolved issue in chronic lymphocytic leukemia (CLL) is whether IGHV3-21 gene usage, in general, or the expression of stereotyped B-cell receptor immunoglobulin defining subset #2 (IGHV3-21/IGLV3-21), in particular, determines outcome for IGHV3-21-utilizing cases. We reappraised this issue...
44 CFR 321.2 - Selection of the mobilization base.
2010-10-01
... base. 321.2 Section 321.2 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY PREPAREDNESS MAINTENANCE OF THE MOBILIZATION BASE (DEPARTMENT OF DEFENSE, DEPARTMENT OF ENERGY, MARITIME ADMINISTRATION) § 321.2 Selection of the mobilization base. (a) The Department...
40 CFR 89.321 - Oxides of nitrogen analyzer calibration.
2010-07-01
... 40 Protection of Environment 20 2010-07-01 2010-07-01 false Oxides of nitrogen analyzer calibration. 89.321 Section 89.321 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... Test Equipment Provisions § 89.321 Oxides of nitrogen analyzer calibration. (a) The chemiluminescent...
Kennedy Space Center Spaceport Analysis
Wary, Samantha A.
2013-01-01
Until the Shuttle Atlantis' final landing on July 21, 2011, Kennedy Space Center (KSC) served as NASA's main spaceport, which is a launch and landing facility for rockets and spacecraft that are attempting to enter orbit. Many of the facilities at KSC were created to assist the Shuttle Program. One of the most important and used facilities is the Shuttle Landing Facility (SLF), This was the main landing area for the return of the shuttle after her mission in space. · However, the SLF has also been used for a number of other projects including straight-line testing by Gibbs Racing, weather data collection by NOAA, and an airfield for the KSC helicopters. This runway is three miles long with control tower at midfield and a fire department located at the end in care of an emergency. This facility, which was part of the great space race, will continue to be used for historical events as Kennedy begins to commercialize its facilities. KSC continues to be an important spaceport to the government, and it will transform into an important spaceport for the commercial industry as well. During my internship at KSC's Center Planning and Development Directorate, I had the opportunity to be a part of the negotiation team working on the agreement for Space Florida to control the Shuttle Landing Facility. This gave me the opportunity to learn about all the changes that are occurring here at Kennedy Space Center. Through various meetings, I discovered the Master Plan and its focus is to transform the existing facilities that were primarily used for the Shuttle Program, to support government operations and commercial flights in the future. This. idea is also in a new strategic business plan and completion of a space industry market analysis. All of these different documentations were brought to my attention and I. saw how they came together in the discussions of transitioning the SLF to a commercial operator, Space Florida. After attending meetings and partaking in discussions for
7 CFR 3.21 - Referrals of Debts to Justice.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false Referrals of Debts to Justice. 3.21 Section 3.21... and Compromise of Claims § 3.21 Referrals of Debts to Justice. An agency shall promptly refer to Justice for litigation debts on which aggressive collection activity has been taken in accordance with...
7 CFR 922.321 - Apricot Regulation 21.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Apricot Regulation 21. 922.321 Section 922.321 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... least as yellow as Shade 3 on U.S. Department of Agriculture Standard Ground Color Chart of Apples and...
Renewable Energy at NASA's Johnson Space Center
McDowall, Lindsay
2014-01-01
NASA's Johnson Space Center has implemented a great number of renewable energy systems. Renewable energy systems are necessary to research and implement if we humans are expected to continue to grow and thrive on this planet. These systems generate energy using renewable sources - water, wind, sun - things that we will not run out of. Johnson Space Center is helping to pave the way by installing and studying various renewable energy systems. The objective of this report will be to examine the completed renewable energy projects at NASA's Johnson Space Center for a time span of ten years, beginning in 2003 and ending in early 2014. This report will analyze the success of each project based on actual vs. projected savings and actual vs. projected efficiency. Additionally, both positive and negative experiences are documented so that lessons may be learned from past experiences. NASA is incorporating renewable energy wherever it can, including into buildings. According to the 2012 JSC Annual Sustainability Report, there are 321,660 square feet of green building space on JSC's campus. The two projects discussed here are major contributors to that statistic. These buildings were designed to meet various Leadership in Energy and Environmental Design (LEED) Certification criteria. LEED Certified buildings use 30 to 50 percent less energy and water compared to non-LEED buildings. The objectives of this project were to examine data from the renewable energy systems in two of the green buildings onsite - Building 12 and Building 20. In Building 12, data was examined from the solar photovoltaic arrays. In Building 20, data was examined from the solar water heater system. By examining the data from the two buildings, it could be determined if the renewable energy systems are operating efficiently. Objectives In Building 12, the data from the solar photovoltaic arrays shows that the system is continuously collecting energy from the sun, as shown by the graph below. Building 12
31 CFR 321.5 - Termination of qualification.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Termination of qualification. 321.5 Section 321.5 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... of a paying agent upon its written request, provided the agent renders a final accounting for all...
Networking at NASA. Johnson Space Center
Garman, John R.
1991-01-01
A series of viewgraphs on computer networks at the Johnson Space Center (JSC) are given. Topics covered include information resource management (IRM) at JSC, the IRM budget by NASA center, networks evolution, networking as a strategic tool, the Information Services Directorate charter, and SSC network requirements, challenges, and status.
31 CFR 321.7 - Authorized cash payments.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Authorized cash payments. 321.7 Section 321.7 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL... registration on the front of the security, or by a person authorized or empowered to act for a corporate legal...
31 CFR 321.15 - Liability for losses.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Liability for losses. 321.15 Section... INSTITUTIONS OF UNITED STATES SAVINGS BONDS AND UNITED STATES SAVINGS NOTES (FREEDOM SHARES) Losses Resulting From Erroneous Payments § 321.15 Liability for losses. Under the governing statute, as amended (31 U.S...
Marshall Space Flight Center Technology Investments Overview
Tinker, Mike
2014-01-01
NASA is moving forward with prioritized technology investments that will support NASA's exploration and science missions, while benefiting other Government agencies and the U.S. aerospace enterprise. center dotThe plan provides the guidance for NASA's space technology investments during the next four years, within the context of a 20-year horizon center dotThis plan will help ensure that NASA develops technologies that enable its 4 goals to: 1.Sustain and extend human activities in space, 2.Explore the structure, origin, and evolution of the solar system, and search for life past and present, 3.Expand our understanding of the Earth and the universe and have a direct and measurable impact on how we work and live, and 4.Energize domestic space enterprise and extend benefits of space for the Nation.
Not all IGHV3-21 chronic lymphocytic leukemias are equal: Prognostic considerations
P. Baliakas (P.); A. Agathangelidis (Andreas); A. Hadzidimitriou (A.); L.-A. Sutton (L.); E. Minga (Evangelia); A. Tsanousa (Athina); L. Scarfó (L.); Z. Davis (Zadie); X.-J. Yan (Xiao-Jie); T. Shanafelt (Tait); K. Plevova (K.); Y. Sandberg (Yorick); F.J. Vojdeman (Fie Juhl); M. Boudjogra (Myriam); T. Tzenou (T.); M. Chatzouli (Maria); C.C. Chu (Charles C.); S. Veronese (Silvio); A. Gardiner (Anne); A. Mansouri (Ahmed); O. Smedby; L.B. Pedersen (Lone Bredo); D. Moreno (Denis); K. van Lom (Kirsten); V. Giudicelli (Veronique); H.S. Francova (Hana Skuhrova); F. Nguyen-Khac (Florence); P. Panagiotidis (P.); G. Juliusson (Gunnar); L. Angelis (Lefteris); C. Anagnostopoulos (Constantinos); M.-P. Lefranc (Marie-Paule); M. Facco (Monica); L. Trentin (Livio); M. Catherwood (M.); M. Montillo (Marco); C.H. Geisler (Christian); A.W. Langerak (Anton); D. Pospisilova (Dagmar); N. Chiorazzi (Nicholas); D.G. Oscier (David Graham); D.F. Jelinek (Diane F.); N. Darzentas (Nikos); C. Belessi (C.); F. Davi (Frédéric); P. Ghia (Paolo); R. Rosenquist (R.); K. Stamatopoulos (Kostas)
2015-01-01
textabstractAn unresolved issue in chronic lymphocytic leukemia (CLL) is whether IGHV3-21 gene usage, in general, or the expression of stereotyped B-cell receptor immunoglobulin defining subset #2 (IGHV3-21/IGLV3-21), in particular, determines outcome for IGHV3-21-utilizing cases. We reappraised
Esrange Space Center, a Gate to Space
Widell, Ola
Swedish Space Corporation (SSC) is operating the Esrange Space Center in northern Sweden. Space operations have been performed for more than 40 years. We have a unique combination of maintaining balloon and rocket launch operations, and building payloads, providing space vehicles and service systems. Sub-orbital rocket flights with land recovery and short to long duration balloon flights up to weeks are offered. The geographical location, land recovery area and the long term experience makes Swedish Space Corporation and Esrange to an ideal gate for space activities. Stratospheric balloons are primarily used in supporting atmospheric research, validation of satellites and testing of space systems. Balloon operations have been carried out at Esrange since 1974. A large number of balloon flights are yearly launched in cooperation with CNES, France. Since 2005 NASA/CSBF and Esrange provide long duration balloon flights to North America. Flight durations up to 5 days with giant balloons (1.2 Million cubic metres) carrying heavy payload (up to 2500kg) with astronomical instruments has been performed. Balloons are also used as a crane for lifting space vehicles or parachute systems to be dropped and tested from high altitude. Many scientific groups both in US, Europe and Japan have indicated a great need of long duration balloon flights. Esrange will perform a technical polar circum balloon flight during the summer 2008 testing balloon systems and flight technique. We are also working on a permission giving us the opportunity on a circular stratospheric balloon flight around the North Pole.
The Center for Space Telemetering and Telecommunications Systems
Horan, S.; DeLeon, P.; Borah, D.; Lyman, R.
2003-01-01
This report comprises the final technical report for the research grant 'Center for Space Telemetering and Telecommunications Systems' sponsored by the National Aeronautics and Space Administration's Goddard Space Flight Center. The grant activities are broken down into the following technology areas: (1) Space Protocol Testing; (2) Autonomous Reconfiguration of Ground Station Receivers; (3) Satellite Cluster Communications; and (4) Bandwidth Efficient Modulation. The grant activity produced a number of technical reports and papers that were communicated to NASA as they were generated. This final report contains the final summary papers or final technical report conclusions for each of the project areas. Additionally, the grant supported students who made progress towards their degrees while working on the research.
NASA Space Weather Center Services: Potential for Space Weather Research
Zheng, Yihua; Kuznetsova, Masha; Pulkkinen, Antti; Taktakishvili, A.; Mays, M. L.; Chulaki, A.; Lee, H.; Hesse, M.
2012-01-01
The NASA Space Weather Center's primary objective is to provide the latest space weather information and forecasting for NASA's robotic missions and its partners and to bring space weather knowledge to the public. At the same time, the tools and services it possesses can be invaluable for research purposes. Here we show how our archive and real-time modeling of space weather events can aid research in a variety of ways, with different classification criteria. We will list and discuss major CME events, major geomagnetic storms, and major SEP events that occurred during the years 2010 - 2012. Highlights of major tools/resources will be provided.
34 CFR 303.321 - Comprehensive child find system.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Comprehensive child find system. 303.321 Section 303... Services Identification and Evaluation § 303.321 Comprehensive child find system. (a) General. (1) Each system must include a comprehensive child find system that is consistent with part B of the Act (see 34...
49 CFR 192.321 - Installation of plastic pipe.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Installation of plastic pipe. 192.321 Section 192... Transmission Lines and Mains § 192.321 Installation of plastic pipe. (a) Plastic pipe must be installed below ground level except as provided by paragraphs (g) and (h) of this section. (b) Plastic pipe that is...
1988-01-01
The research activities of the Lewis Research Center for 1988 are summarized. The projects included are within basic and applied technical disciplines essential to aeropropulsion, space propulsion, space power, and space science/applications. These disciplines are materials science and technology, structural mechanics, life prediction, internal computational fluid mechanics, heat transfer, instruments and controls, and space electronics.
Maddox, Marlo; Zheng, Yihua; Rastaetter, Lutz; Taktakishvili, A.; Mays, M. L.; Kuznetsova, M.; Lee, Hyesook; Chulaki, Anna; Hesse, Michael; Mullinix, Richard;
2012-01-01
The NASA GSFC Space Weather Center (http://swc.gsfc.nasa.gov) is committed to providing forecasts, alerts, research, and educational support to address NASA's space weather needs - in addition to the needs of the general space weather community. We provide a host of services including spacecraft anomaly resolution, historical impact analysis, real-time monitoring and forecasting, custom space weather alerts and products, weekly summaries and reports, and most recently - video casts. There are many challenges in providing accurate descriptions of past, present, and expected space weather events - and the Space Weather Center at NASA GSFC employs several innovative solutions to provide access to a comprehensive collection of both observational data, as well as space weather model/simulation data. We'll describe the challenges we've faced with managing hundreds of data streams, running models in real-time, data storage, and data dissemination. We'll also highlight several systems and tools that are utilized by the Space Weather Center in our daily operations, all of which are available to the general community as well. These systems and services include a web-based application called the Integrated Space Weather Analysis System (iSWA http://iswa.gsfc.nasa.gov), two mobile space weather applications for both IOS and Android devices, an external API for web-service style access to data, google earth compatible data products, and a downloadable client-based visualization tool.
Stennis Space Center celebrates Native American culture
2009-01-01
Famie Willis (left), 2009-2010 Choctaw Indian Princess, displays artifacts during Native American Heritage Month activities at Stennis Space Center on Nov. 24. The celebration featured various Native American cultural displays for Stennis employees to view. Shown above are (l to r): Willis, Elaine Couchman of NASA Shared Services Center, John Cecconi of NSSC and Lakeisha Robertson of the Environmental Protection Agency.
In-Space Manufacturing at NASA Marshall Space Flight Center: Enabling Technologies for Exploration
Bean, Quincy; Johnston, Mallory; Ordonez, Erick; Ryan, Rick; Prater, Tracie; Werkeiser, Niki
2015-01-01
NASA Marshall Space Flight Center is currently engaged in a number of in-space manufacturing(ISM)activities that have the potential to reduce launch costs, enhance crew safety, and provide the capabilities needed to undertake long duration spaceflight safely and sustainably.
31 CFR 321.25 - Role of Federal Reserve Banks.
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Role of Federal Reserve Banks. 321.25 Section 321.25 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL.... Federal Reserve Bank of Kansas City, 925 Grand Avenue, Kansas City, MO 64198 Dallas, San Francisco, Kansas...
33 CFR 187.321 - What are the hull identification number (HIN) provisions?
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false What are the hull identification number (HIN) provisions? 187.321 Section 187.321 Navigation and Navigable Waters COAST GUARD, DEPARTMENT... Vessel Titling Systems § 187.321 What are the hull identification number (HIN) provisions? A State must...
Business Plan: The Virginia Space Flight Center
Reed, Billie M.
1997-01-01
The Virginia Commercial Space Flight Authority (VCSFA) was established on July 1, 1995 and codified at Sections 9-266.1 et seq., Code of Virginia. It is governed by an eleven person Board of Directors representing industry, state and local government and academia. VCSFA has designated the Center for Commercial Space Infrastructure as its Executive Directorate and Operating Agent. This Business Plan has been developed to provide information to prospective customers, prospective investors, state and federal government agencies, the VCSFA Board and other interested parties regarding development and operation of the Virginia Space Flight Center (VSFC) at Wallops Island. The VSFC is an initiative sponsored by VCSFA to achieve its stated objectives in the areas of economic development and education. Further, development of the VSFC is in keeping with the state's economic goals set forth in Opportunity Virginia, the strategic plan for jobs and prosperity, which are to: (1) Strengthen the rapidly growing aerospace industry in space based services including launch services, remote sensing, satellite manufacturing and telecommunications; and (2) Capitalize on intellectual and technical resources throughout the state and become a leader in the development of advanced technology businesses.
31 CFR 321.21 - Replacement and recovery of losses.
2010-07-01
... liability for such loss under 31 U.S.C. 3126(a), the Bureau of the Public Debt will demand that the paying... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Replacement and recovery of losses. 321.21 Section 321.21 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued...
The Alabama Space and Rocket Center: The Second Decade.
Buckbee, Edward O.
1983-01-01
The Alabama Space and Rocket Center in Huntsville, the world's largest rocket and space museum, includes displays illustrating American rocket history, exhibits and demonstrations on rocketry principles and experiences, and simulations of space travel. A new project includes an integrated recreational-educational complex, described in the three…
Odell, David D; Peleg, Kobi; Givon, Adi; Radomislensky, Irina; Makey, Ian; Decamp, Malcolm M; Whyte, Richard; Gangadharan, Sidhu P; Berger, Robert L
2013-09-01
Sternal fractures fall into two distinct categories as follows: (1) isolated sternal fracture (ISF) without associated injury and (2) polytrauma sternal fracture (PSF) with associated extrasternal injury. PSF can be sufficiently severe to require hospitalization, while ISF is usually a mild insult manageable in an ambulatory setting. Nonetheless, most patients with ISF are hospitalized. The disconnect between treatment based on existing evidence and actual clinical practice may be caused in large part by the small patient cohorts in published studies conducive to inaccurate conclusions. This article addresses the issue by analyzing prospectively collected data on a far larger population than hitherto available. The Israeli National Trauma Registry (INTR) collects data prospectively on patients admitted to trauma centers in Israel. We analyzed the INTR database on sternal fractures for demographics, mechanisms and severity of injury, diagnostic evaluation, treatment, and outcomes. Between 1997 and 2008, the INTR received data on 1,867 consecutive patients hospitalized with sternal fractures. The injury was sustained most often during motor vehicle accidents (84.1%), followed by falls (10.3%) and other blunt or penetrating mechanisms (5.6%). ISF was sustained in 26.4%, and PSF was sustained in 73.6%. Associated injuries involved most parts of the body. Cardiac contusions or lacerations were diagnosed in 1.8% of the 1,867 patients. ISF was associated with a lower incidence of cardiorespiratory compromise, more favorable trauma scores (Glasgow Coma Scale [GCS] score > 14, Revised Trauma Score > 11), and use of fewer intensive care facilities or operations compared with PSF. Endotracheal intubation, chest tube insertion, or thoracotomy was not performed in any ISF patient but was performed in 16.9% of the PSF cohort. The differences between ISF and PSF were statistically significant in all analyzed indices of injury severity. This study produced compelling evidence that
Kodak Mirror Assembly Tested at Marshall Space Flight Center
2003-01-01
This photo (a frontal view) is of one of many segments of the Eastman-Kodak mirror assembly being tested for the James Webb Space Telescope (JWST) project at the X-Ray Calibration Facility at Marshall Space Flight Center (MSFC). MSFC is supporting Goddard Space Flight Center (GSFC) in developing the JWST by taking numerous measurements to predict its future performance. The tests are conducted in a vacuum chamber cooled to approximate the super cold temperatures found in space. During its 27 years of operation, the facility has performed testing in support of a wide array of projects, including the Hubble Space Telescope (HST), Solar A, Chandra technology development, Chandra High Resolution Mirror Assembly and science instruments, Constellation X-Ray Mission, and Solar X-Ray Imager, currently operating on a Geostationary Operational Environment Satellite. The JWST is NASA's next generation space telescope, a successor to the Hubble Space Telescope, named in honor of NASA's second administrator, James E. Webb. It is scheduled for launch in 2010 aboard an expendable launch vehicle. It will take about 3 months for the spacecraft to reach its destination, an orbit of 940,000 miles in space.
Walt Disney visited Marshall Space Flight Center (MSFC)
1965-01-01
Walt Disney toured the West Test Area during his visit to the Marshall Space Flight Center on April 13, 1965. The three in center foreground are Karl Heimburg, Director, Test Division; Dr. von Braun, Director, MSFC; and Walt Disney. The Dynamic Test Stand with the S-1C stage being installed is in the background.
Space and Missile Systems Center Standard: Systems Engineering Requirements and Products
2013-07-01
MISSILE SYSTEMS CENTER Air Force Space Command 483 N. Aviation Blvd. El Segundo, CA 90245 4. This standard has been approved for use on all Space...Any RF receiver with a burnout level of less than 30 dBm (1 mW). b. A summary of all significant areas are addressed in the EMC Control Plan...address 7. Date Submitted 8. Preparing Activity Space and Missile Systems Center AIR FORCE SPACE COMMAND 483 N. Aviation Blvd. El Segundo, CA 91245 Attention: SMC/EN February 2013
Advanced Life Support Project: Crop Experiments at Kennedy Space Center
Sager, John C.; Stutte, Gary W.; Wheeler, Raymond M.; Yorio, Neil
2004-01-01
Crop production systems provide bioregenerative technologies to complement human crew life support requirements on long duration space missions. Kennedy Space Center has lead NASA's research on crop production systems that produce high value fresh foods, provide atmospheric regeneration, and perform water processing. As the emphasis on early missions to Mars has developed, our research focused on modular, scalable systems for transit missions, which can be developed into larger autonomous, bioregenerative systems for subsequent surface missions. Components of these scalable systems will include development of efficient light generating or collecting technologies, low mass plant growth chambers, and capability to operate in the high energy background radiation and reduced atmospheric pressures of space. These systems will be integrated with air, water, and thermal subsystems in an operational system. Extensive crop testing has been done for both staple and salad crops, but limited data is available on specific cultivar selection and breadboard testing to meet nominal Mars mission profiles of a 500-600 day surface mission. The recent research emphasis at Kennedy Space Center has shifted from staple crops, such as wheat, soybean and rice, toward short cycle salad crops such as lettuce, onion, radish, tomato, pepper, and strawberry. This paper will review the results of crop experiments to support the Exploration Initiative and the ongoing development of supporting technologies, and give an overview of capabilities of the newly opened Space Life Science (SLS) Lab at Kennedy Space Center. The 9662 square m (104,000 square ft) SLS Lab was built by the State of Florida and supports all NASA research that had been performed in Hanger-L. In addition to NASA research, the SLS Lab houses the Florida Space Research Institute (FSRI), responsible for co-managing the facility, and the University of Florida (UF) has established the Space Agriculture and Biotechnology Research and
Wooden Spaceships: Human-Centered Vehicle Design for Space
Twyford, Evan
2009-01-01
Presentation will focus on creative human centered design solutions in relation to manned space vehicle design and development in the NASA culture. We will talk about design process, iterative prototyping, mockup building and user testing and evaluation. We will take an inside look at how new space vehicle concepts are developed and designed for real life exploration scenarios.
Discovery: Under the Microscope at Kennedy Space Center
Howard, Philip M.
2013-01-01
The National Aeronautics & Space Administration (NASA) is known for discovery, exploration, and advancement of knowledge. Since the days of Leeuwenhoek, microscopy has been at the forefront of discovery and knowledge. No truer is that statement than today at Kennedy Space Center (KSC), where microscopy plays a major role in contamination identification and is an integral part of failure analysis. Space exploration involves flight hardware undergoing rigorous "visually clean" inspections at every step of processing. The unknown contaminants that are discovered on these inspections can directly impact the mission by decreasing performance of sensors and scientific detectors on spacecraft and satellites, acting as micrometeorites, damaging critical sealing surfaces, and causing hazards to the crew of manned missions. This talk will discuss how microscopy has played a major role in all aspects of space port operations at KSC. Case studies will highlight years of analysis at the Materials Science Division including facility and payload contamination for the Navigation Signal Timing and Ranging Global Positioning Satellites (NA VST AR GPS) missions, quality control monitoring of monomethyl hydrazine fuel procurement for launch vehicle operations, Shuttle Solids Rocket Booster (SRB) foam processing failure analysis, and Space Shuttle Main Engine Cut-off (ECO) flight sensor anomaly analysis. What I hope to share with my fellow microscopists is some of the excitement of microscopy and how its discoveries has led to hardware processing, that has helped enable the successful launch of vehicles and space flight missions here at Kennedy Space Center.
42 CFR 436.321 - Medically needy coverage of the blind.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Medically needy coverage of the blind. 436.321... Optional Coverage of the Medically Needy § 436.321 Medically needy coverage of the blind. If the agency provides Medicaid to the medically needy, it may provide Medicaid to blind individuals who meet— (a) The...
Experts warn against cutting NOAA Space Weather Center
Showstack, Randy
A well-timed congressional hearing, coming in the midst of fierce geomagnetic storms, could help to restore funding to the U.S. National Oceanic and Atmospheric Administration's Space Environment Center (SEC).The center, which is the nation's official source of space weather alerts and warnings, currently is funded at $5.24 million for fiscal year 2003. That amount is $2 million less than it received the previous year. The Bush Administration has requested $8.02 million in funding. The appropriations bill, for the departments of Commerce, Justice, and State for fiscal year 2004, passed on 23 July by the House of Representatives, calls for funding the SEC at the $5.29 million level.
Space Operations Learning Center
Lui, Ben; Milner, Barbara; Binebrink, Dan; Kuok, Heng
2012-01-01
The Space Operations Learning Center (SOLC) is a tool that provides an online learning environment where students can learn science, technology, engineering, and mathematics (STEM) through a series of training modules. SOLC is also an effective media for NASA to showcase its contributions to the general public. SOLC is a Web-based environment with a learning platform for students to understand STEM through interactive modules in various engineering topics. SOLC is unique in its approach to develop learning materials to teach schoolaged students the basic concepts of space operations. SOLC utilizes the latest Web and software technologies to present this educational content in a fun and engaging way for all grade levels. SOLC uses animations, streaming video, cartoon characters, audio narration, interactive games and more to deliver educational concepts. The Web portal organizes all of these training modules in an easily accessible way for visitors worldwide. SOLC provides multiple training modules on various topics. At the time of this reporting, seven modules have been developed: Space Communication, Flight Dynamics, Information Processing, Mission Operations, Kids Zone 1, Kids Zone 2, and Save The Forest. For the first four modules, each contains three components: Flight Training, Flight License, and Fly It! Kids Zone 1 and 2 include a number of educational videos and games designed specifically for grades K-6. Save The Forest is a space operations mission with four simulations and activities to complete, optimized for new touch screen technology. The Kids Zone 1 module has recently been ported to Facebook to attract wider audience.
Strategic Project Management at the NASA Kennedy Space Center
Lavelle, Jerome P.
2000-01-01
This paper describes Project Management at NASA's Kennedy Space Center (KSC) from a strategic perspective. It develops the historical context of the agency and center's strategic planning process and illustrates how now is the time for KSC to become a center which has excellence in project management. The author describes project management activities at the center and details observations on those efforts. Finally the author describes the Strategic Project Management Process Model as a conceptual model which could assist KSC in defining an appropriate project management process system at the center.
A novel immunotoxin reveals a new role for CD321 in endothelial cells.
Directory of Open Access Journals (Sweden)
Takeshi Fukuhara
Full Text Available There are currently several antibody therapies that directly target tumors, and antibody-drug conjugates represent a novel moiety as next generation therapeutics. Here, we used a unique screening probe, DT3C, to identify functional antibodies that recognized surface molecules and functional epitopes, and which provided toxin delivery capability. Accordingly, we generated the 90G4 antibody, which induced DT3C-dependent cytotoxicity in endothelial cells. Molecular analysis revealed that 90G4 recognized CD321, a protein localized at tight junctions. Although CD321 plays a pivotal role in inflammation and lymphocyte trans-endothelial migration, little is known about its mechanism of action in endothelial cells. Targeting of CD321 by the 90G4 immunotoxin induced cell death. Moreover, 90G4 immunotoxin caused cytotoxicity primarily in migratory endothelial cells, but not in those forming sheets, suggesting a critical role for CD321 in tumor angiogenesis. We also found that hypoxia triggered redistribution of CD321 to a punctate localization on the basal side of cells, resulting in functional impairment of tight junctions and increased motility. Thus, our findings raise the intriguing possibility that endothelial CD321 presented cellular localization in tight junction as well as multifunctional dynamics in several conditions, leading to illuminate the importance of widely-expressed CD321 as a potential target for antitumor therapy.
System security in the space flight operations center
Wagner, David A.
1988-01-01
The Space Flight Operations Center is a networked system of workstation-class computers that will provide ground support for NASA's next generation of deep-space missions. The author recounts the development of the SFOC system security policy and discusses the various management and technology issues involved. Particular attention is given to risk assessment, security plan development, security implications of design requirements, automatic safeguards, and procedural safeguards.
Center for Advanced Space Propulsion Second Annual Technical Symposium Proceedings
1990-01-01
The proceedings for the Center for Advanced Space Propulsion Second Annual Technical Symposium are divided as follows: Chemical Propulsion, CFD; Space Propulsion; Electric Propulsion; Artificial Intelligence; Low-G Fluid Management; and Rocket Engine Materials.
Kennedy Space Center environmental health program
International Nuclear Information System (INIS)
Marmaro, G.M.; Cardinale, M.A.; Summerfield, B.R.; Tipton, D.A.
1992-01-01
The Kennedy Space Center's environmental health organization is responsible for programs which assure its employees a healthful workplace under diverse and varied working conditions. These programs encompass the disciplines of industrial hygiene, radiation protection (health physics), and environmental sanitation/pollution control. Activities range from the routine, such as normal office work, to the highly specialized, such as the processing of highly toxic and hazardous materials
Research and Technology at the John F. Kennedy Space Center 1993
1993-01-01
As the NASA Center responsible for assembly, checkout, servicing, launch, recovery, and operational support of Space Transportation System elements and payloads, the John F. Kennedy Space Center is placing increasing emphasis on its advanced technology development program. This program encompasses the efforts of the Engineering Development Directorate laboratories, most of the KSC operations contractors, academia, and selected commercial industries - all working in a team effort within their own areas of expertise. This edition of the Kennedy Space Center Research and Technology 1993 Annual Report covers efforts of all these contributors to the KSC advanced technology development program, as well as our technology transfer activities. Major areas of research include material science, advanced software, industrial engineering, nondestructive evaluation, life sciences, atmospheric sciences, environmental technology, robotics, and electronics and instrumentation.
Kennedy Space Center Five Year Sustainability Plan
Williams, Ann T.
2016-01-01
The Federal Government is committed to following sustainable principles. At its heart, sustainability integrates environmental, societal and economic solutions for present needs without compromising the ability of future generations to meet their needs. Building upon its pledge towards environmental stewardship, the Administration generated a vision of sustainability spanning ten goals mandated within Executive Order (EO) 13693, Planning for Federal Sustainability in the Next Decade. In November 2015, the National Aeronautics and Space Administration (NASA) responded to this EO by incorporating it into a new release of the NASA Strategic Sustainability Performance Plan (SSPP). The SSPP recognizes the importance of aligning environmental practices in a manner that preserves, enhances and strengthens NASA's ability to perform its mission indefinitely. The Kennedy Space Center (KSC) is following suit with KSC's Sustainability Plan (SP) by promoting, maintaining and pioneering green practices in all aspects of our mission. KSC's SP recognizes that the best sustainable solutions use an interdisciplinary, collaborative approach spanning civil servant and contractor personnel from across the Center. This approach relies on the participation of all employees to develop and implement sustainability endeavors connected with the following ten goals: Reduce greenhouse gas (GHG) emissions. Design, build and maintain sustainable buildings, facilities and infrastructure. Leverage clean and renewable energy. Increase water conservation. Improve fleet and vehicle efficiency and management. Purchase sustainable products and services. Minimize waste and prevent pollution. Implement performance contracts for Federal buildings. Manage electronic equipment and data centers responsibly. Pursue climate change resilience. The KSC SP details the strategies and actions that address the following objectives: Reduce Center costs. center dot Increase energy and water efficiencies. Promote smart
Jenkins, George
1986-01-01
Prelaunch, launch, mission, and landing distribution of RF and hardline uplink/downlink information between Space Shuttle Orbiter/cargo elements, tracking antennas, and control centers at JSC, KSC, MSFC, GSFC, ESMC/RCC, and Sunnyvale are presented as functional block diagrams. Typical mismatch problems encountered during spacecraft-to-project control center telemetry transmissions are listed along with new items for future support enhancement.
Supporting Multiple Programs and Projects at NASA's Kennedy Space Center
Stewart, Camiren L.
2014-01-01
With the conclusion of the shuttle program in 2011, the National Aeronautics and Space Administration (NASA) had found itself at a crossroads for finding transportation of United States astronauts and experiments to space. The agency would eventually hand off the taxiing of American astronauts to the International Space Station (ISS) that orbits in Low Earth Orbit (LEO) about 210 miles above the earth under the requirements of the Commercial Crew Program (CCP). By privatizing the round trip journey from Earth to the ISS, the space agency has been given the additional time to focus funding and resources to projects that operate beyond LEO; however, adding even more stress to the agency, the premature cancellation of the program that would succeed the Shuttle Program - The Constellation Program (CxP) -it would inevitably delay the goal to travel beyond LEO for a number of years. Enter the Space Launch System (SLS) and the Orion Multipurpose Crew Vehicle (MPCV). Currently, the SLS is under development at NASA's Marshall Spaceflight Center in Huntsville, Alabama, while the Orion Capsule, built by government contractor Lockheed Martin Corporation, has been assembled and is currently under testing at the Kennedy Space Center (KSC) in Florida. In its current vision, SLS will take Orion and its crew to an asteroid that had been captured in an earlier mission in lunar orbit. Additionally, this vehicle and its configuration is NASA's transportation to Mars. Engineers at the Kennedy Space Center are currently working to test the ground systems that will facilitate the launch of Orion and the SLS within its Ground Services Development and Operations (GSDO) Program. Firing Room 1 in the Launch Control Center (LCC) has been refurbished and outfitted to support the SLS Program. In addition, the Spaceport Command and Control System (SCCS) is the underlying control system for monitoring and launching manned launch vehicles. As NASA finds itself at a junction, so does all of its
Kegley, Jeff; Burdine, Robert V. (Technical Monitor)
2002-01-01
A new cryogenic optical testing capability exists at Marshall Space Flight Center's Space Optics Manufacturing Technology Center (SOMTC). SOMTC has been performing optical wavefront testing at cryogenic temperatures since 1999 in the X-ray Cryogenic Test Facility's (XRCF's) large vacuum chamber. Recently the cryogenic optical testing capability has been extended to a smaller vacuum chamber. This smaller horizontal cylindrical vacuum chamber has been outfitted with a helium-cooled liner that can be connected to the facility's helium refrigeration system bringing the existing kilowatt of refrigeration capacity to bear on a 1 meter diameter x 2 meter long test envelope. Cryogenic environments to less than 20 Kelvin are now possible in only a few hours. SOMTC's existing instruments (the Instantaneous Phase-shifting Interferometer (IPI) from ADE Phase-Shift Technologies and the PhaseCam from 4D Vision Technologies) view the optic under test through a 150 mm clear aperture BK-7 window. Since activation and chamber characterization tests in September 2001, the new chamber has been used to perform a cryogenic (less than 30 Kelvin) optical test of a 22.5 cm diameter x 127 cm radius of curvature Si02 mirror, a cryogenic survival (less than 30 Kelvin) test of an adhesive, and a cryogenic cycle (less than 20 Kelvin) test of a ULE mirror. A vibration survey has also been performed on the test chamber. Chamber specifications and performance data, vibration environment data, and limited test results will be presented.
Space Weather Forecasting and Research at the Community Coordinated Modeling Center
Aronne, M.
2015-12-01
The Space Weather Research Center (SWRC), within the Community Coordinated Modeling Center (CCMC), provides experimental research forecasts and analysis for NASA's robotic mission operators. Space weather conditions are monitored to provide advance warning and forecasts based on observations and modeling using the integrated Space Weather Analysis Network (iSWA). Space weather forecasters come from a variety of backgrounds, ranging from modelers to astrophysicists to undergraduate students. This presentation will discuss space weather operations and research from an undergraduate perspective. The Space Weather Research, Education, and Development Initiative (SW REDI) is the starting point for many undergraduate opportunities in space weather forecasting and research. Space weather analyst interns play an active role year-round as entry-level space weather analysts. Students develop the technical and professional skills to forecast space weather through a summer internship that includes a two week long space weather boot camp, mentorship, poster session, and research opportunities. My unique development of research projects includes studying high speed stream events as well as a study of 20 historic, high-impact solar energetic particle events. This unique opportunity to combine daily real-time analysis with related research prepares students for future careers in Heliophysics.
New Center Links Earth, Space, and Information Sciences
Aswathanarayana, U.
2004-05-01
Broad-based geoscience instruction melding the Earth, space, and information technology sciences has been identified as an effective way to take advantage of the new jobs created by technological innovations in natural resources management. Based on this paradigm, the University of Hyderabad in India is developing a Centre of Earth and Space Sciences that will be linked to the university's super-computing facility. The proposed center will provide the basic science underpinnings for the Earth, space, and information technology sciences; develop new methodologies for the utilization of natural resources such as water, soils, sediments, minerals, and biota; mitigate the adverse consequences of natural hazards; and design innovative ways of incorporating scientific information into the legislative and administrative processes. For these reasons, the ethos and the innovatively designed management structure of the center would be of particular relevance to the developing countries. India holds 17% of the world's human population, and 30% of its farm animals, but only about 2% of the planet's water resources. Water will hence constitute the core concern of the center, because ecologically sustainable, socially equitable, and economically viable management of water resources of the country holds the key to the quality of life (drinking water, sanitation, and health), food security, and industrial development of the country. The center will be focused on interdisciplinary basic and pure applied research that is relevant to the practical needs of India as a developing country. These include, for example, climate prediction, since India is heavily dependent on the monsoon system, and satellite remote sensing of soil moisture, since agriculture is still a principal source of livelihood in India. The center will perform research and development in areas such as data assimilation and validation, and identification of new sensors to be mounted on the Indian meteorological
University of Tennessee Center for Space Transportation and Applied Research (CSTAR)
1995-10-01
The Center for Space Transportation and Applied Research had projects with space applications in six major areas: laser materials processing, artificial intelligence/expert systems, space transportation, computational methods, chemical propulsion, and electric propulsion. The closeout status of all these projects is addressed.
University of Tennessee Center for Space Transportation and Applied Research (CSTAR)
1995-01-01
The Center for Space Transportation and Applied Research had projects with space applications in six major areas: laser materials processing, artificial intelligence/expert systems, space transportation, computational methods, chemical propulsion, and electric propulsion. The closeout status of all these projects is addressed.
Gregory Merkel Tours Marshall Space Flight Center (MSFC)
1972-01-01
Gregory A. Merkel (left), high school student from Springfield, Massachusetts, is pictured here with Harry Coons of the Marshall Space Flight Center (MSFC) during a visit to the center. Merkel was among 25 winners of a contest in which some 3,500 high school students proposed experiments for the following year's Skylab mission. The nationwide scientific competition was sponsored by the National Science Teachers Association and the National Aeronautics and Space Administration (NASA). The winning students, along with their parents and sponsor teachers, visited MSFC where they met with scientists and engineers, participated in design reviews for their experiments, and toured MSFC facilities. Of the 25 students, 6 did not see their experiments conducted on Skylab because the experiments were not compatible with Skylab hardware and timelines. Of the 19 remaining, 11 experiments required the manufacture of additional equipment.
A Milestone in Commercial Space Weather: USTAR Center for Space Weather
Tobiska, W.; Schunk, R. W.; Sojka, J. J.; Thompson, D. C.; Scherliess, L.; Zhu, L.; Gardner, L. C.
2009-12-01
As of 2009, Utah State University (USU) hosts a new organization to develop commercial space weather applications using funding that has been provided by the State of Utah’s Utah Science Technology and Research (USTAR) initiative. The USTAR Center for Space Weather (UCSW) is located on the USU campus in Logan, Utah and is developing innovative applications for mitigating adverse space weather effects in technological systems. Space weather’s effects upon the near-Earth environment are due to dynamic changes in the Sun’s photons, particles, and fields. Of the space environment domains that are affected by space weather, the ionosphere is the key region that affects communication and navigation systems. The UCSW has developed products for users of systems that are affected by space weather-driven ionospheric changes. For example, on September 1, 2009 USCW released, in conjunction with Space Environment Technologies, the world’s first real-time space weather via an iPhone app. Space WX displays the real-time, current global ionosphere total electron content along with its space weather drivers; it is available through the Apple iTunes store and is used around the planet. The Global Assimilation of Ionospheric Measurements (GAIM) system is now being run operationally in real-time at UCSW with the continuous ingestion of hundreds of global data streams to dramatically improve the ionosphere’s characterization. We discuss not only funding and technical advances that have led to current products but also describe the direction for UCSW that includes partnering opportunities for moving commercial space weather into fully automated specification and forecasting over the next half decade.
Nanomaterials Work at NASA-Johnson Space Center
Arepalli, Sivaram
2005-01-01
Nanomaterials activities at NASA-Johnson Space Center focus on single wall carbon nanotube production, characterization and their applications for aerospace. Nanotubes are produced by arc and laser methods and the growth process is monitored by in-situ diagnostics using time resolved passive emission and laser induced fluorescence of the active species. Parametric study of both these processes are conducted to monitor the effect of production parameters including temperature, buffer gas, flow rate, pressure, laser fluence and arc current. Characterization of the nanotube material is performed using the NASA-JSC protocol developed by combining analytical techniques of SEM, TEM, UV-VIS-NIR absorption, Raman, and TGA. Efforts at JSC over the past five years in composites have centered on structural polymernanotube systems. Recent activities broadened this focus to multifunctional materials, supercapacitors, fuel cells, regenerable CO2 absorbers, electromagnetic shielding, radiation dosimetry and thermal management systems of interest for human space flight. Preliminary tests indicate improvement of performance in most of these applications because of the large surface area as well as high conductivity exhibited by SWCNTs.
Spaceflight Radiation Health program at the Lyndon B. Johnson Space Center
Energy Technology Data Exchange (ETDEWEB)
Johnson, A.S.; Badhwar, G.D.; Golightly, M.J.; Hardy, A.C.; Konradi, A.; Yang, T.C.
1993-12-01
The Johnson Space Center leads the research and development activities that address the health effects of space radiation exposure to astronaut crews. Increased knowledge of the composition of the environment and of the biological effects of space radiation is required to assess health risks to astronaut crews. The activities at the Johnson Space Center range from quantification of astronaut exposures to fundamental research into the biological effects resulting from exposure to high energy particle radiation. The Spaceflight Radiation Health Program seeks to balance the requirements for operational flexibility with the requirement to minimize crew radiation exposures. The components of the space radiation environment are characterized. Current and future radiation monitoring instrumentation is described. Radiation health risk activities are described for current Shuttle operations and for research development program activities to shape future analysis of health risk.
Spaceflight Radiation Health program at the Lyndon B. Johnson Space Center
International Nuclear Information System (INIS)
Johnson, A.S.; Badhwar, G.D.; Golightly, M.J.; Hardy, A.C.; Konradi, A.; Yang, T.C.
1993-12-01
The Johnson Space Center leads the research and development activities that address the health effects of space radiation exposure to astronaut crews. Increased knowledge of the composition of the environment and of the biological effects of space radiation is required to assess health risks to astronaut crews. The activities at the Johnson Space Center range from quantification of astronaut exposures to fundamental research into the biological effects resulting from exposure to high energy particle radiation. The Spaceflight Radiation Health Program seeks to balance the requirements for operational flexibility with the requirement to minimize crew radiation exposures. The components of the space radiation environment are characterized. Current and future radiation monitoring instrumentation is described. Radiation health risk activities are described for current Shuttle operations and for research development program activities to shape future analysis of health risk
The new Athens Center applied to Space Weather Forecasting
International Nuclear Information System (INIS)
Mavromichalaki, H.; Sarlanis, C.; Souvatzoglou, G.; Mariatos, G.; Gerontidou, M.; Plainaki, C.; Papaioannou, A.; Tatsis, S.; Belov, A.; Eroshenko, E.; Yanke, V.
2006-01-01
The Sun provides most of the initial energy driving space weather and modulates the energy input from sources outside the solar system, but this energy undergoes many transformations within the various components of the solar-terrestrial system, which is comprised of the solar wind, magnetosphere and radiation belts, the ionosphere, and the upper and lower atmospheres of Earth. This is the reason why an Earth's based neutron monitor network can be used in order to produce a real time forecasting of space weather phenomena.Since 2004 a fully functioned new data analysis Center in real-time is in operation in Neutron Monitor Station of Athens University (ANMODAP Center) suitable for research applications. It provides a multi sided use of twenty three neutron monitor stations distributing in all world and operating in real-time given crucial information on space weather phenomena. In particular, the ANMODAP Center can give a preliminary alert of ground level enhancements (GLEs) of solar cosmic rays which can be registered around 20 to 30 minutes before the main part of lower energy particles. Therefore these energetic solar cosmic rays provide the advantage of forth warning. Moreover, the monitoring of the precursors of cosmic rays gives a forehand estimate on that kind of events should be expected (geomagnetic storms and/or Forbush decreases)
Space Environment Testing of Photovoltaic Array Systems at NASA's Marshall Space Flight Center
Phillips, Brandon S.; Schneider, Todd A.; Vaughn, Jason A.; Wright, Kenneth H., Jr.
2015-01-01
To successfully operate a photovoltaic (PV) array system in space requires planning and testing to account for the effects of the space environment. It is critical to understand space environment interactions not only on the PV components, but also the array substrate materials, wiring harnesses, connectors, and protection circuitry (e.g. blocking diodes). Key elements of the space environment which must be accounted for in a PV system design include: Solar Photon Radiation, Charged Particle Radiation, Plasma, and Thermal Cycling. While solar photon radiation is central to generating power in PV systems, the complete spectrum includes short wavelength ultraviolet components, which photo-ionize materials, as well as long wavelength infrared which heat materials. High energy electron radiation has been demonstrated to significantly reduce the output power of III-V type PV cells; and proton radiation damages material surfaces - often impacting coverglasses and antireflective coatings. Plasma environments influence electrostatic charging of PV array materials, and must be understood to ensure that long duration arcs do not form and potentially destroy PV cells. Thermal cycling impacts all components on a PV array by inducing stresses due to thermal expansion and contraction. Given such demanding environments, and the complexity of structures and materials that form a PV array system, mission success can only be ensured through realistic testing in the laboratory. NASA's Marshall Space Flight Center has developed a broad space environment test capability to allow PV array designers and manufacturers to verify their system's integrity and avoid costly on-orbit failures. The Marshall Space Flight Center test capabilities are available to government, commercial, and university customers. Test solutions are tailored to meet the customer's needs, and can include performance assessments, such as flash testing in the case of PV cells.
33 CFR 149.321 - How many ring life buoys must be on each deepwater port?
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false How many ring life buoys must be on each deepwater port? 149.321 Section 149.321 Navigation and Navigable Waters COAST GUARD... EQUIPMENT Lifesaving Equipment Manned Deepwater Port Requirements § 149.321 How many ring life buoys must be...
Space Flight Operations Center local area network
Goodman, Ross V.
1988-01-01
The existing Mission Control and Computer Center at JPL will be replaced by the Space Flight Operations Center (SFOC). One part of the SFOC is the LAN-based distribution system. The purpose of the LAN is to distribute the processed data among the various elements of the SFOC. The SFOC LAN will provide a robust subsystem that will support the Magellan launch configuration and future project adaptation. Its capabilities include (1) a proven cable medium as the backbone for the entire network; (2) hardware components that are reliable, varied, and follow OSI standards; (3) accurate and detailed documentation for fault isolation and future expansion; and (4) proven monitoring and maintenance tools.
Stennis Space Center celebrates Diversity Day
2009-01-01
Kendall Mitchell of the Naval Oceanographic Office (right) learns about the culture of Bolivia from Narda Inchausty, president of the Foreign Born Wives Association in Slidell, La., during 2009 Diversity Day events at NASA's John Stennis Space Center. Stennis hosted Diversity Day activities for employees on Oct. 7. The day's events included cultural and agency exhibits, diversity-related performances, a trivia contest and a classic car and motorcycle show. It also featured the first-ever sitewide Stennis Employee Showcase.
7 CFR 1207.321 - Term of office.
2010-01-01
... Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE POTATO RESEARCH AND PROMOTION PLAN Potato Research and Promotion Plan National Potato Promotion Board § 1207.321 Term of office. (a) The...
Using Web 2.0 (and Beyond?) in Space Flight Operations Control Centers
Scott, David W.
2010-01-01
Word processing was one of the earliest uses for small workstations, but we quickly learned that desktop computers were far more than e-typewriters. Similarly, "Web 2.0" capabilities, particularly advanced search engines, chats, wikis, blogs, social networking, and the like, offer tools that could significantly improve our efficiency at managing the avalanche of information and decisions needed to operate space vehicles in realtime. However, could does not necessarily equal should. We must wield two-edged swords carefully to avoid stabbing ourselves. This paper examines some Web 2.0 tools, with an emphasis on social media, and suggests which ones might be useful or harmful in real-time space operations co rnotl environments, based on the author s experience as a Payload Crew Communicator (PAYCOM) at Marshall Space Flight Center s (MSFC) Payload Operations Integration Center (POIC) for the International Space Station (ISS) and on discussions with other space flight operations control organizations and centers. There is also some discussion of an offering or two that may come from beyond the current cyber-horizon.
Crowd-Sourced Radio Science at Marshall Space Flight Center
Fry, C. D.; McTernan, J. K.; Suggs, R. M.; Rawlins, L.; Krause, L. H.; Gallagher, D. L.; Adams, M. L.
2018-01-01
August 21, 2017 provided a unique opportunity to investigate the effects of the total solar eclipse on high frequency (HF) radio propagation and ionospheric variability. In Marshall Space Flight Center's partnership with the US Space and Rocket Center (USSRC) and Austin Peay State University (APSU), we engaged citizen scientists and students in an investigation of the effects of an eclipse on the mid-latitude ionosphere. Activities included fieldwork and station-based data collection of HF Amateur Radio frequency bands and VLF radio waves before, during, and after the eclipse to build a continuous record of changing propagation conditions as the moon's shadow marched across the United States. Post-eclipse radio propagation analysis provided insights into ionospheric variability due to the eclipse.
R and T report: Goddard Space Flight Center
Soffen, Gerald A. (Editor)
1993-01-01
The 1993 Research and Technology Report for Goddard Space Flight Center is presented. Research covered areas such as (1) flight projects; (2) space sciences including cosmology, high energy, stars and galaxies, and the solar system; (3) earth sciences including process modeling, hydrology/cryology, atmospheres, biosphere, and solid earth; (4) networks, planning, and information systems including support for mission operations, data distribution, advanced software and systems engineering, and planning/scheduling; and (5) engineering and materials including spacecraft systems, material and testing, optics and photonics and robotics.
32.1 Gbit/s InverseRZ-ASK-DQPSK modulation with low implementation penalty
DEFF Research Database (Denmark)
Tokle, Torger; Serbay, M.; Rosenkranz, W.
2006-01-01
32.1 Gbit/s InverseRZ-ASK-DQPSK is experimentally investigated using a new InverseRZ generation method. We demonstrate......32.1 Gbit/s InverseRZ-ASK-DQPSK is experimentally investigated using a new InverseRZ generation method. We demonstrate...
Marshall Space Flight Center Faculty Fellowship Program
Six, N. F.; Damiani, R. (Compiler)
2017-01-01
The 2017 Marshall Faculty Fellowship Program involved 21 faculty in the laboratories and departments at Marshall Space Flight Center. These faculty engineers and scientists worked with NASA collaborators on NASA projects, bringing new perspectives and solutions to bear. This Technical Memorandum is a compilation of the research reports of the 2017 Marshall Faculty Fellowship program, along with the Program Announcement (Appendix A) and the Program Description (Appendix B). The research affected the following six areas: (1) Materials (2) Propulsion (3) Instrumentation (4) Spacecraft systems (5) Vehicle systems (6) Space science The materials investigations included composite structures, printing electronic circuits, degradation of materials by energetic particles, friction stir welding, Martian and Lunar regolith for in-situ construction, and polymers for additive manufacturing. Propulsion studies were completed on electric sails and low-power arcjets for use with green propellants. Instrumentation research involved heat pipes, neutrino detectors, and remote sensing. Spacecraft systems research was conducted on wireless technologies, layered pressure vessels, and two-phase flow. Vehicle systems studies were performed on life support-biofilm buildup and landing systems. In the space science area, the excitation of electromagnetic ion-cyclotron waves observed by the Magnetospheric Multiscale Mission provided insight regarding the propagation of these waves. Our goal is to continue the Marshall Faculty Fellowship Program funded by Center internal project offices. Faculty Fellows in this 2017 program represented the following minority-serving institutions: Alabama A&M University and Oglala Lakota College.
Space Environmental Effects Testing Capability at the Marshall Space Flight Center
DeWittBurns, H.; Craven, Paul; Finckenor, Miria; Nehls, Mary; Schneider, Todd; Vaughn, Jason
2012-01-01
Understanding the effects of the space environment on materials and systems is fundamental and essential for mission success. If not properly understood and designed for, the effects of the environment can lead to degradation of materials, reduction of functional lifetime, and system failure. In response to this need, the Marshall Space Flight Center has developed world class Space Environmental Effects (SEE) expertise and test facilities to simulate the space environment. Capabilities include multiple unique test systems comprising the most complete SEE testing capability available. These test capabilities include charged particle radiation (electrons, protons, ions), ultraviolet radiation (UV), vacuum ultraviolet radiation (VUV), atomic oxygen, plasma effects, space craft charging, lunar surface and planetary effects, vacuum effects, and hypervelocity impacts as well as the combination of these capabilities. In addition to the uniqueness of the individual test capabilities, MSFC is the only NASA facility where the effects of the different space environments can be tested in one location. Combined with additional analytical capabilities for pre- and post-test evaluation, MSFC is a one-stop shop for materials testing and analysis. The SEE testing and analysis are performed by a team of award winning experts nationally recognized for their contributions in the study of the effects of the space environment on materials and systems. With this broad expertise in space environmental effects and the variety of test systems and equipment available, MSFC is able to customize tests with a demonstrated ability to rapidly adapt and reconfigure systems to meet customers needs. Extensive flight experiment experience bolsters this simulation and analysis capability with a comprehensive understanding of space environmental effects.
System Engineering Processes at Kennedy Space Center for Development of SLS and Orion Launch Systems
Schafer, Eric; Stambolian, Damon; Henderson, Gena
2013-01-01
There are over 40 subsystems being developed for the future SLS and Orion Launch Systems at Kennedy Space Center. These subsystems are developed at the Kennedy Space Center Engineering Directorate. The Engineering Directorate at Kennedy Space Center follows a comprehensive design process which requires several different product deliverables during each phase of each of the subsystems. This Presentation describes this process with examples of where the process has been applied.
Center for Space Transportation and Applied Research Fifth Annual Technical Symposium Proceedings
1993-01-01
This Fifth Annual Technical Symposium, sponsored by the UT-Calspan Center for Space Transportation and Applied Research (CSTAR), is organized to provide an overview of the technical accomplishments of the Center's five Research and Technology focus areas during the past year. These areas include chemical propulsion, electric propulsion, commerical space transportation, computational methods, and laser materials processing. Papers in the area of artificial intelligence/expert systems are also presented.
Robotic Technology Efforts at the NASA/Johnson Space Center
Diftler, Ron
2017-01-01
The NASA/Johnson Space Center has been developing robotic systems in support of space exploration for more than two decades. The goal of the Center’s Robotic Systems Technology Branch is to design and build hardware and software to assist astronauts in performing their mission. These systems include: rovers, humanoid robots, inspection devices and wearable robotics. Inspection systems provide external views of space vehicles to search for surface damage and also maneuver inside restricted areas to verify proper connections. New concepts in human and robotic rovers offer solutions for navigating difficult terrain expected in future planetary missions. An important objective for humanoid robots is to relieve the crew of “dull, dirty or dangerous” tasks allowing them more time to perform their important science and exploration missions. Wearable robotics one of the Center’s newest development areas can provide crew with low mass exercise capability and also augment an astronaut’s strength while wearing a space suit.This presentation will describe the robotic technology and prototypes developed at the Johnson Space Center that are the basis for future flight systems. An overview of inspection robots will show their operation on the ground and in-orbit. Rovers with independent wheel modules, crab steering, and active suspension are able to climb over large obstacles, and nimbly maneuver around others. Humanoid robots, including the First Humanoid Robot in Space: Robonaut 2, demonstrate capabilities that will lead to robotic caretakers for human habitats in space, and on Mars. The Center’s Wearable Robotics Lab supports work in assistive and sensing devices, including exoskeletons, force measuring shoes, and grasp assist gloves.
Joint Space Operations Center (JSpOC) Mission System (JMS)
Morton, M.; Roberts, T.
2011-09-01
US space capabilities benefit the economy, national security, international relationships, scientific discovery, and our quality of life. Realizing these space responsibilities is challenging not only because the space domain is increasingly congested, contested, and competitive but is further complicated by the legacy space situational awareness (SSA) systems approaching end of life and inability to provide the breadth of SSA and command and control (C2) of space forces in this challenging domain. JMS will provide the capabilities to effectively employ space forces in this challenging domain. Requirements for JMS were developed based on regular, on-going engagement with the warfighter. The use of DoD Architecture Framework (DoDAF) products facilitated requirements scoping and understanding and transferred directly to defining and documenting the requirements in the approved Capability Development Document (CDD). As part of the risk reduction efforts, the Electronic System Center (ESC) JMS System Program Office (SPO) fielded JMS Capability Package (CP) 0 which includes an initial service oriented architecture (SOA) and user defined operational picture (UDOP) along with force status, sensor management, and analysis tools. Development efforts are planned to leverage and integrate prototypes and other research projects from Defense Advanced Research Projects Agency, Air Force Research Laboratories, Space Innovation and Development Center, and Massachusetts Institute of Technology/Lincoln Laboratories. JMS provides a number of benefits to the space community: a reduction in operational “transaction time” to accomplish key activities and processes; ability to process the increased volume of metric observations from new sensors (e.g., SBSS, SST, Space Fence), as well as owner/operator ephemerides thus enhancing the high accuracy near-real-time catalog, and greater automation of SSA data sharing supporting collaboration with government, civil, commercial, and foreign
Nanotechnology Concepts at Marshall Space Flight Center: Engineering Directorate
Bhat, B.; Kaul, R.; Shah, S.; Smithers, G.; Watson, M. D.
2001-01-01
Nanotechnology is the art and science of building materials and devices at the ultimate level of finesse: atom by atom. Our nation's space program has need for miniaturization of components, minimization of weight, and maximization of performance, and nanotechnology will help us get there. Marshall Space Flight Center's (MSFC's) Engineering Directorate is committed to developing nanotechnology that will enable MSFC missions in space transportation, space science, and space optics manufacturing. MSFC has a dedicated group of technologists who are currently developing high-payoff nanotechnology concepts. This poster presentation will outline some of the concepts being developed including, nanophase structural materials, carbon nanotube reinforced metal and polymer matrix composites, nanotube temperature sensors, and aerogels. The poster will outline these concepts and discuss associated technical challenges in turning these concepts into real components and systems.
NASA Pathways Co-op Tour Johnson Space Center Fall 2013
Masood, Amir; Osborne-Lee, Irwin W.
2013-01-01
This report outlines the tasks and objectives completed during a co-operative education tour with National Aeronautics and Space Association (NASA) at the Johnson Space Center in Houston, Texas. I worked for the Attitude & Pointing group of the Flight Dynamics Division within the Mission Operations Directorate at Johnson Space Center. NASA's primary mission is to support and expand the various ongoing space exploration programs and any research and development activities associated with it. My primary project required me to develop and a SharePoint web application for my group. My secondary objective was to become familiar with the role of my group which was primarily to provide spacecraft attitude and line of sight determination, including Tracking and Data Relay Satellite (TDRS) communications coverage for various NASA, International, and commercial partner spacecraft. My projects required me to become acquainted with different software systems, fundamentals of aerospace engineering, project management, and develop essential interpersonal communication skills. Overall, I accomplished multiple goals which included laying the foundations for an updated SharePoint which will allow for an organized platform to communicate and share data for group members and external partners. I also successfully learned about the operations of the Attitude & Pointing Group and how it contributes to the Missions Operations Directorate and NASA's Space Program as a whole
Johnson Space Center's Solar and Wind-Based Renewable Energy System
Vasquez, A.; Ewert, M.; Rowlands, J.; Post, K.
2009-01-01
The NASA Johnson Space Center (JSC) in Houston, Texas has a Sustainability Partnership team that seeks ways for earth-based sustainability practices to also benefit space exploration research. A renewable energy gathering system was installed in 2007 at the JSC Child Care Center (CCC) which also offers a potential test bed for space exploration power generation and remote monitoring and control concepts. The system comprises: 1) several different types of photovoltaic panels (29 kW), 2) two wind-turbines (3.6 kW total), and 3) one roof-mounted solar thermal water heater and tank. A tie to the JSC local electrical grid was provided to accommodate excess power. The total first year electrical energy production was 53 megawatt-hours. A web-based real-time metering system collects and reports system performance and weather data. Improvements in areas of the CCC that were detected during subsequent energy analyses and some concepts for future efforts are also presented.
32 CFR 321.1 - Purpose and applicability.
2010-07-01
... PROGRAM DEFENSE SECURITY SERVICE PRIVACY PROGRAM § 321.1 Purpose and applicability. (a) This part... Defense Security Service (DSS) to the individual subjects, the handling of requests for amendment or... Copies may be obtained via internet at http://web7.whs.osd.mil/corres.htm. (b) The procedures set forth...
Taxonomy, Ontology and Semantics at Johnson Space Center
Berndt, Sarah Ann
2011-01-01
At NASA Johnson Space Center (JSC), the Chief Knowledge Officer has been developing the JSC Taxonomy to capitalize on the accomplishments of yesterday while maintaining the flexibility needed for the evolving information environment of today. A clear vision and scope for the semantic system is integral to its success. The vision for the JSC Taxonomy is to connect information stovepipes to present a unified view for information and knowledge across the Center, across organizations, and across decades. Semantic search at JSC means seemless integration of disparate information sets into a single interface. Ever increasing use, interest, and organizational participation mark successful integration and provide the framework for future application.
Marshall Space Flight Center - Launching the Future of Science and Exploration
Shivers, Alisa; Shivers, Herbert
2010-01-01
Topics include: NASA Centers around the country, launching a legacy (Explorer I), Marshall's continuing role in space exploration, MSFC history, lifting from Earth, our next mission STS 133, Space Shuttle propulsion systems, Space Shuttle facts, Space Shuttle and the International Space Station, technologies/materials originally developed for the space program, astronauts come from all over, potential future missions and example technologies, significant accomplishments, living and working in space, understanding our world, understanding worlds beyond, from exploration to innovation, inspiring the next generation, space economy, from exploration to opportunity, new program assignments, NASA's role in education, and images from deep space including a composite of a galaxy with a black hole, Sagittarius A, Pillars of Creation, and an ultra deep field
Guidotti, J. G.
1976-01-01
An overall introduction to the NASA sounding rocket program as managed by the Goddard Space Flight Center is presented. The various sounding rockets, auxiliary systems (telemetry, guidance, etc.), launch sites, and services which NASA can provide are briefly described.
Kinlaw, Dennis C.; Eads, Jeannette
1992-01-01
It is apparent to everyone associated with the Nation's aeronautics and space programs that the challenge of continuous improvement can be reasonably addressed only if NASA and its contractors act together in a fully integrated and cooperative manner that transcends the traditional boundaries of proprietary interest. It is, however, one thing to assent to the need for such integration and cooperation; it is quite another thing to undertake the hard tasks of turning such a need into action. Whatever else total quality management is, it is fundamentally a team-centered and team-driven process of continuous improvement. The introduction of total quality management at KSC, therefore, has given the Center a special opportunity to translate the need for closer integration and cooperation among all its organizations into specific initiatives. One such initiative that NASA and its contractors have undertaken at KSC is a NASA/Contractor team-centered Total Quality Management Seminar. It is this seminar which is the subject of this paper. The specific purposes of this paper are to describe the following: Background, development, and evolution of Kennedy Space Center's Total Quality Management Seminar; Special characteristics of the seminar; Content of the seminar; Meaning and utility of a team-centered design for TQM training; Results of the seminar; Use that one KSC contractor, EG&G Florida, Inc. has made of the seminar in its Total Quality Management initiative; and Lessons learned.
Lewis Research Center space station electric power system test facilities
Birchenough, Arthur G.; Martin, Donald F.
1988-01-01
NASA Lewis Research Center facilities were developed to support testing of the Space Station Electric Power System. The capabilities and plans for these facilities are described. The three facilities which are required in the Phase C/D testing, the Power Systems Facility, the Space Power Facility, and the EPS Simulation Lab, are described in detail. The responsibilities of NASA Lewis and outside groups in conducting tests are also discussed.
Optical Fiber Assemblies for Space Flight from the NASA Goddard Space Flight Center, Photonics Group
Ott, Melanie N.; Thoma, William Joe; LaRocca, Frank; Chuska, Richard; Switzer, Robert; Day, Lance
2009-01-01
The Photonics Group at NASA Goddard Space Flight Center in the Electrical Engineering Division of the Advanced Engineering and Technologies Directorate has been involved in the design, development, characterization, qualification, manufacturing, integration and anomaly analysis of optical fiber subsystems for over a decade. The group supports a variety of instrumentation across NASA and outside entities that build flight systems. Among the projects currently supported are: The Lunar Reconnaissance Orbiter, the Mars Science Laboratory, the James Webb Space Telescope, the Express Logistics Carrier for the International Space Station and the NASA Electronic Parts. and Packaging Program. A collection of the most pertinent information gathered during project support over the past year in regards to space flight performance of optical fiber components is presented here. The objective is to provide guidance for future space flight designs of instrumentation and communication systems.
Industrial Engineering Lifts Off at Kennedy Space Center
Barth, Tim
1998-01-01
When the National Aeronautics and Space Administration (NASA) began the Space Shuttle Program, it did not have an established industrial engineering (IE) capability for several probable reasons. For example, it was easy for some managers to dismiss IE principles as being inapplicable at NASA's John F. Kennedy Space Center (KSC). When NASA was formed by the National Aeronautics and Space Act of 1958, most industrial engineers worked in more traditional factory environments. The primary emphasis early in the shuttle program, and during previous human space flight programs such as Mercury and Apollo, was on technical accomplishments. Industrial engineering is sometimes difficult to explain in NASA's highly technical culture. IE is different in many ways from other engineering disciplines because it is devoted to process management and improvement, rather than product design. Images of clipboards and stopwatches still come to the minds of many people when the term industrial engineering is mentioned. The discipline of IE has only recently begun to gain acceptance and understanding in NASA. From an IE perspective today, the facilities used for flight hardware processing at KSC are NASA's premier factories. The products of these factories are among the most spectacular in the world: safe and successful launches of shuttles and expendable vehicles that carry tremendous payloads into space.
Center for Space Power, Texas A and M University
Jones, Ken
Johnson Controls is a 106 year old company employing 42,000 people worldwide with $4.7 billion annual sales. Though we are new to the aerospace industry we are a world leader in automobile battery manufacturing, automotive seating, plastic bottling, and facilities environment controls. The battery division produces over 24,000,000 batteries annually under private label for the new car manufacturers and the replacement market. We are entering the aerospace market with the nickel hydrogen battery with the help of NASA's Center for Space Power at Texas A&M. Unlike traditional nickel hydrogen battery manufacturers, we are reaching beyond the space applications to the higher volume markets of aircraft starting and utility load leveling. Though space applications alone will not provide sufficient volume to support the economies of scale and opportunities for statistical process control, these additional terrestrial applications will. For example, nickel hydrogen batteries do not have the environmental problems of nickel cadmium or lead acid and may someday start your car or power your electric vehicle. However you envision the future, keep in mind that no manufacturer moves into a large volume market without fine tuning their process. The Center for Space Power at Texas A&M is providing indepth technical analysis of all of the materials and fabricated parts of our battery as well as thermal and mechanical design computer modeling. Several examples of what we are doing with nickel hydrogen chemistry to lead to these production efficiencies are presented.
Inference in media space. The case of IBM Software Executive Briefing Center - Rome
Directory of Open Access Journals (Sweden)
Toni Marino
2014-11-01
Full Text Available In our paper we apply Peirce's model of Arguments (Statistical Deduction, Probabilistic Deduction, Induction and Abduction to a communication process where negotiating sense and meanings is emphasized. We selected a communication space where everything is planned as a medium of sense (video terminals, screens, lights, etc. namely the IBM Software Executive Briefing Center in Italy, a workplace used to exchange views, negotiate or transact. It is based in Rome in the same building as the International Development Laboratory of the IBM Software Group. The Software Center is the place where IBM welcomes its potential customers and has the opportunity to show them its technology and offer solutions. This paper focuses on "media space" in the Center which is structured by the seller according to his/her idea of the buyer's interpretive process. This paper analyzes the roles of visual codes in the allocation of functions. It also looks into the relation between the symbolism of the company with its marketing, past history and media space in order to define the buyer's typology of inference (deduction, induction or abduction in relation to the communication strategy of the media space design. The research is conducted directly in the field by interviewing the Manager of the IBM Center as well as asking people who use it to fill in an anonymous questionnaire, which analyses both the media space and the plan of the building.
[Factors related to the life space of daycare center users].
Kawamura, Koki; Kato, Chikako; Kondo, Izumi
2018-01-01
We examined the factors related to life space and changes in the care level after one year in daycare center users. The participants were 83 older adults (age, > 65 years; mean age, 79.5±6.8 years) with MMSE scores of ≥20, who could walk independently, who needed support (1-2) or care (1), and who underwent rehabilitation at a daycare center. The life space was evaluated by the Life Space Assessment (LSA). The subjects' basic information (i.e., age, medical history.) was collected, and their physical function (i.e., grip strength, timed up and go test [TUG]), mental function (i.e., vitality, fear of falls), and social function (i.e., friends, hobbies, public transportation) were assessed to investigate the factors associated with their LSA scores. In addition, a follow-up survey was conducted on the care level at approximately one year later. A multiple regression analysis indicated that TUG scores (β=-0.33), hobbies (β=0.30), friends (β=0.29), public transportation (β=0.26), and grip strength (β=0.24) were related to the life space. Next, the participants were divided into LSA-high and LSA-low groups, and changes in the care level (improvement, maintenance, deterioration) at approximately one year after the initial assessment were examined using a chi-squared test. A significant difference was observed in the distribution of the groups (p=0.03). Multiple factors were related to the life space. Moreover, it is possible that improvements in the level of care may be achieved by improving the life space.
Marshall Space Flight Center Faculty Fellowship Program
Six, N. F. (Compiler)
2015-01-01
The Faculty Fellowship program was revived in the summer of 2015 at NASA Marshall Space Flight Center, following a period of diminished faculty research activity here since 2006 when budget cuts in the Headquarters' Education Office required realignment. Several senior Marshall managers recognized the need to involve the Nation's academic research talent in NASA's missions and projects to the benefit of both entities. These managers invested their funds required to establish the renewed Faculty Fellowship program in 2015, a 10-week residential research involvement of 16 faculty in the laboratories and offices at Marshall. These faculty engineers and scientists worked with NASA collaborators on NASA projects, bringing new perspectives and solutions to bear. This Technical Memorandum is a compilation of the research reports of the 2015 Marshall Faculty Fellowship program, along with the Program Announcement (appendix A) and the Program Description (appendix B). The research touched on seven areas-propulsion, materials, instrumentation, fluid dynamics, human factors, control systems, and astrophysics. The propulsion studies included green propellants, gas bubble dynamics, and simulations of fluid and thermal transients. The materials investigations involved sandwich structures in composites, plug and friction stir welding, and additive manufacturing, including both strength characterization and thermosets curing in space. The instrumentation projects involved spectral interfero- metry, emissivity, and strain sensing in structures. The fluid dynamics project studied the water hammer effect. The human factors project investigated the requirements for close proximity operations in confined spaces. Another team proposed a controls system for small launch vehicles, while in astrophysics, one faculty researcher estimated the practicality of weather modification by blocking the Sun's insolation, and another found evidence in satellite data of the detection of a warm
2010-06-02
rooted , mesophylic plant species that Chapter 3. Affected Environment Final Environmental Assessment - California Space Center, Vandenberg Air...Chapter 3. Affected Environment 3-12 Final Environmental Assessment - California Space Center, Vandenberg Air Force Base the root and debris zone of the...protruding objects, slippery soils or mud, and biological hazards including vegetation (i.e. poison oak and stinging nettle ), animals (i.e. insects
Bilitza, D.; King, J. H.
1988-01-01
The activities and services of the National Space Science data Center (NSSDC) and the World Data Center A for Rockets and Satellites (WDC-A-R and S) are described with special emphasis on ionospheric physics. The present catalog/archive system is explained and future developments are indicated. In addition to the basic data acquisition, archiving, and dissemination functions, ongoing activities include the Central Online Data Directory (CODD), the Coordinated Data Analysis Workshopps (CDAW), the Space Physics Analysis Network (SPAN), advanced data management systems (CD/DIS, NCDS, PLDS), and publication of the NSSDC News, the SPACEWARN Bulletin, and several NSSD reports.
Chulaki, A.; Kuznetsova, M. M.; Rastaetter, L.; MacNeice, P. J.; Shim, J. S.; Pulkkinen, A. A.; Taktakishvili, A.; Mays, M. L.; Mendoza, A. M. M.; Zheng, Y.; Mullinix, R.; Collado-Vega, Y. M.; Maddox, M. M.; Pembroke, A. D.; Wiegand, C.
2015-12-01
Community Coordinated Modeling Center (CCMC) is a NASA affiliated interagency partnership with the primary goal of aiding the transition of modern space science models into space weather forecasting while supporting space science research. Additionally, over the past ten years it has established itself as a global space science education resource supporting undergraduate and graduate education and research, and spreading space weather awareness worldwide. A unique combination of assets, capabilities and close ties to the scientific and educational communities enable this small group to serve as a hub for raising generations of young space scientists and engineers. CCMC resources are publicly available online, providing unprecedented global access to the largest collection of modern space science models (developed by the international research community). CCMC has revolutionized the way simulations are utilized in classrooms settings, student projects, and scientific labs and serves hundreds of educators, students and researchers every year. Another major CCMC asset is an expert space weather prototyping team primarily serving NASA's interplanetary space weather needs. Capitalizing on its unrivaled capabilities and experiences, the team provides in-depth space weather training to students and professionals worldwide, and offers an amazing opportunity for undergraduates to engage in real-time space weather monitoring, analysis, forecasting and research. In-house development of state-of-the-art space weather tools and applications provides exciting opportunities to students majoring in computer science and computer engineering fields to intern with the software engineers at the CCMC while also learning about the space weather from the NASA scientists.
Ecological Impacts of the Space Shuttle Program at John F. Kennedy Space Center, Florida
Hall, Carlton R.; Schmalzer, Paul A.; Breininger, David R.; Duncan, Brean W.; Drese, John H.; Scheidt, Doug A.; Lowers, Russ H.; Reyier, Eric A.; Holloway-Adkins, Karen G.; Oddy, Donna M.;
2014-01-01
The Space Shuttle Program was one of NASAs first major undertakings to fall under the environmental impact analysis and documentation requirements of the National Environmental Policy Act of 1969 (NEPA). Space Shuttle Program activities at John F. Kennedy Space Center (KSC) and the associated Merritt Island National Wildlife Refuge (MINWR) contributed directly and indirectly to both negative and positive ecological trends in the region through the long-term, stable expenditure of resources over the 40 year program life cycle. These expenditures provided support to regional growth and development in conjunction with other sources that altered land use patterns, eliminated and modified habitats, and contributed to cultural eutrophication of the Indian River Lagoon. At KSC, most Space Shuttle Program related actions were conducted in previously developed facilities and industrial areas with the exception of the construction of the shuttle landing facility (SLF) and the space station processing facility (SSPF). Launch and operations impacts were minimal as a result of the low annual launch rate. The majority of concerns identified during the NEPA process such as potential weather modification, acid rain off site, and local climate change did not occur. Launch impacts from deposition of HCl and particulates were assimilated as a result of the high buffering capacity of the system and low launch and loading rates. Metals deposition from exhaust deposition did not display acute impacts. Sub-lethal effects are being investigated as part of the Resource Conservation and Recovery Act (RCRA) regulatory process. Major positive Space Shuttle Program effects were derived from the adequate resources available at the Center to implement the numerous environmental laws and regulations designed to enhance the quality of the environment and minimize impacts from human activities. This included reduced discharges of domestic and industrial wastewater, creation of stormwater management
42 CFR 405.2468 - Allowable costs.
2010-10-01
... capital-related costs. (C) The marginal increase in patient care costs that the RHC or FQHC experiences as... Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN SERVICES MEDICARE PROGRAM.... (f) Graduate medical education. (1) Effective for that portion of cost reporting periods occurring on...
TRW Ships NASA's Chandra X-ray Observatory To Kennedy Space Center
1999-04-01
Two U.S. Air Force C-5 Galaxy transport planes carrying the observatory and its ground support equipment landed at Kennedy's Space Shuttle Landing Facility at 2:40 p.m. EST this afternoon. REDONDO BEACH, CA.--(Business Wire)--Feb. 4, 1999--TRW has shipped NASA's Chandra X-ray Observatory ("Chandra") to the Kennedy Space Center (KSC), in Florida, in preparation for a Space Shuttle launch later this year. The 45-foot-tall, 5-ton science satellite will provide astronomers with new information on supernova remnants, the surroundings of black holes, and other celestial phenomena that produce vast quantities of X-rays. Cradled safely in the cargo hold of a tractor-trailer rig called the Space Cargo Transportation System (SCTS), NASA's newest space telescope was ferried on Feb. 4 from Los Angeles International Airport to KSC aboard an Air Force C-5 Galaxy transporter. The SCTS, an Air Force container, closely resembles the size and shape of the Shuttle cargo bay. Over the next few months, Chandra will undergo final tests at KSC and be mated to a Boeing-provided Inertial Upper Stage for launch aboard Space Shuttle Columbia. A launch date for the Space Shuttle STS-93 mission is expected to be announced later this week. The third in NASA's family of Great Observatories that includes the Hubble Space Telescope and the TRW-built Compton Gamma Ray observatory, Chandra will use the world's most powerful X-ray telescope to allow scientists to "see" and monitor cosmic events that are invisible to conventional optical telescopes. Chandra's X-ray images will yield new insight into celestial phenomena such as the temperature and extent of gas clouds that comprise clusters of galaxies and the superheating of gas and dust particles as they swirl into black holes. A TRW-led team that includes the Eastman Kodak Co., Raytheon Optical Systems Inc., and Ball Aerospace & Technologies Corp. designed and built the Chandra X-ray Observatory for NASA's Marshall Space Flight Center. The
Copper Disk Manufactured at the Space Optics Manufacturing and Technology Center
2001-01-01
This photograph shows Wes Brown, Marshall Space Flight Center's (MSFC's) lead diamond tuner, an expert in the science of using diamond-tipped tools to cut metal, inspecting the mold's physical characteristics to ensure the uniformity of its more than 6,000 grooves. This king-size copper disk, manufactured at the Space Optics Manufacturing and Technology Center (SOMTC) at MSFC, is a special mold for making high resolution monitor screens. This master mold will be used to make several other molds, each capable of forming hundreds of screens that have a type of lens called a fresnel lens. Weighing much less than conventional optics, fresnel lenses have multiple concentric grooves, each formed to a precise angle, that together create the curvature needed to focus and project images. The MSFC leads NASA's space optics manufacturing technology development as a technology leader for diamond turning. The machine used to manufacture this mold is among many one-of-a-kind pieces of equipment of MSFC's SOMTC.
Corrosion behavior of 321 stainless steel in low-acidity uranium nitrate solution
International Nuclear Information System (INIS)
Liao Junsheng; Sun Ying; Zhang Wanglin; Ding Ping; Yang Jiangrong; Wu Lunqiang
2003-01-01
Weighing and electrochemical methods have been used to investigate the high-temperature uniform corrosion and electrochemical corrosion behavior of lCr18Ni9Ti (321) stainless steel in uranium nitrate solution at different concentrations and pH values. The uniform corrosion results showed that the corrosion rate of 321 stainless steel was less than 0.04 g/m 2 .h, and the visible change of surface smoothness was not observed through 960 h. It was perfect corrosion-resisting in obtained conditions. The electro-chemical corrosion behavior study has been performed to investigate 321 stainless steel in uranium nitrate solutions of the dissolved and saturated oxygen. The corrosion potential and corrosion current density were obtained. Auger photoelectron spectroscopy for measurement of uranium in specimen was used to indicate that uranium is in corrosion product. The corrosion film was measured by Ar ion gun sputter, and the thickness is 10-15 nm. (authors)
Schowengerdt, F. D.; Kee, Bob; Linne, Mark; McKinnon, Tom; Moore, John; Parker, Terry; Readey, Dennis; Tilton, John E.; Helble, Joe
1997-01-01
The Center for Commercial Applications of Combustion in Space (CCACS) is a NASA/Industry/University consortium at the Colorado School of Mines (CSM). The mission of the Center is to assist industry in developing commercial products by conducting combustion research which takes advantage of the unique properties of space. By conducting experiments in near-zero gravity, convection and buoyancy effects can be minimized and new fundamental design-related knowledge can be gained which can be used to improve combustion-related products and processes on earth. Companies, government laboratories and universities most actively involved in CCACS at present include ABB Combustion, ADA Technologies, Advanced Refractory Technologies, Golden Technologies, Lockheed-Martin, Southwest Sciences, Space Systems/Lora, NASA-Lewis, JPL, the Baylor Dental School and the University of Connecticut. Products and processes of interest to the Center participants include industrial process combustors; catalytic combustion; Halon replacements; ceramic powders, whiskers and fibers; metal-matrix composites; NiTi for bone replacement; diamond coatings for oil-well drill bits; zeolites; imaging sensor arrays and other instrumentation for flame and particulate diagnostics. The center also assists member companies in marketing the resulting products and processes.
Effect of pH on the corrosion behaviour of SUS321 in the ammonia aqueous solution
International Nuclear Information System (INIS)
Park, Sang Yoon; Jeong, Y. H.; Baek, J. H.; Choi, B. K.; Lee, M. H.; Choi, B. S.; Yoon, J. H.; Lee, D. J.
2003-02-01
The corrosion characteristics of SUS321 for pressure vessel of SMART in pure water, ammonia aqueous solutions of pH 8.5 ∼ 11.5 at 300 .deg. C were evaluated by using static autoclaves. SUS321 specimen in the high temperature ammonia aqueous solution has weight gain or loss by the 4 reactions. And it depends on the refreshing period of the aqueous solution. So additional experiments by recirculating loop system were required to evaluate the corrosion behaviour of SUS321 in the ammonia aqueous solution
Marshall Space Flight Center Faculty Fellowship Program
Six, N. F.; Karr, G.
2017-01-01
The research projects conducted by the 2016 Faculty Fellows at NASA Marshall Space Flight Center included propulsion studies on propellant issues, and materials investigations involving plasma effects and friction stir welding. Spacecraft Systems research was conducted on wireless systems and 3D printing of avionics. Vehicle Systems studies were performed on controllers and spacecraft instruments. The Science and Technology group investigated additive construction applied to Mars and Lunar regolith, medical uses of 3D printing, and unique instrumentation, while the Test Laboratory measured pressure vessel leakage and crack growth rates.
Minute, Stephen A.
2013-01-01
Mr. Christopher Miller with the Kennedy Space Center (KSC) NASA Safety & Mission Assurance (S&MA) office requested the NASA Engineering and Safety Center's (NESC) technical support on March 15, 2012, to review and make recommendations on the structural analysis being performed for the Orbiter Atlantis static display at the KSC Visitor Center. The principal focus of the assessment was to review the engineering firm's structural analysis for lifting and aligning the orbiter and its static display configuration
The Sharjah Center for Astronomy and Space Sciences (SCASS 2015): Concept and Resources
Naimiy, Hamid M. K. Al
2015-08-01
The Sharjah Center for Astronomy and Space Sciences (SCASS) was launched this year 2015 at the University of Sharjah in the UAE. The center will serve to enrich research in the fields of astronomy and space sciences, promote these fields at all educational levels, and encourage community involvement in these sciences. SCASS consists of:The Planetarium: Contains a semi-circle display screen (18 meters in diameter) installed at an angle of 10° which displays high-definition images using an advanced digital display system consisting of seven (7) high-performance light-display channels. The Planetarium Theatre offers a 200-seat capacity with seats placed at highly calculated angles. The Planetarium also contains an enormous star display (Star Ball - 10 million stars) located in the heart of the celestial dome theatre.The Sharjah Astronomy Observatory: A small optical observatory consisting of a reflector telescope 45 centimeters in diameter to observe the galaxies, stars and planets. Connected to it is a refractor telescope of 20 centimeters in diameter to observe the sun and moon with highly developed astronomical devices, including a digital camera (CCD) and a high-resolution Echelle Spectrograph with auto-giving and remote calibration ports.Astronomy, space and physics educational displays for various age groups include:An advanced space display that allows for viewing the universe during four (4) different time periods as seen by:1) The naked eye; 2) Galileo; 3) Spectrographic technology; and 4) The space technology of today.A space technology display that includes space discoveries since the launching of the first satellite in 1940s until now.The Design Concept for the Center (450,000 sq. meters) was originated by HH Sheikh Sultan bin Mohammed Al Qasimi, Ruler of Sharjah, and depicts the dome as representing the sun in the middle of the center surrounded by planetary bodies in orbit to form the solar system as seen in the sky.
NASA Glenn Research Center Solar Cell Experiment Onboard the International Space Station
Myers, Matthew G.; Wolford, David S.; Prokop, Norman F.; Krasowski, Michael J.; Parker, David S.; Cassidy, Justin C.; Davies , William E.; Vorreiter, Janelle O.; Piszczor, Michael F.; Mcnatt, Jeremiah S.;
2016-01-01
Accurate air mass zero (AM0) measurement is essential for the evaluation of new photovoltaic (PV) technology for space solar cells. The NASA Glenn Research Center (GRC) has flown an experiment designed to measure the electrical performance of several solar cells onboard NASA Goddard Space Flight Center's (GSFC) Robotic Refueling Missions (RRM) Task Board 4 (TB4) on the exterior of the International Space Station (ISS). Four industry and government partners provided advanced PV devices for measurement and orbital environment testing. The experiment was positioned on the exterior of the station for approximately eight months, and was completely self-contained, providing its own power and internal data storage. Several new cell technologies including four-junction (4J) Inverted Metamorphic Multi-junction (IMM) cells were evaluated and the results will be compared to ground-based measurement methods.
Springer, Darlene
1989-01-01
Different aspects of Space Station Environmental Control and Life Support System (ECLSS) testing are currently taking place at Marshall Space Flight Center (MSFC). Unique to this testing is the variety of test areas and the fact that all are located in one building. The north high bay of building 4755, the Core Module Integration Facility (CMIF), contains the following test areas: the Subsystem Test Area, the Comparative Test Area, the Process Material Management System (PMMS), the Core Module Simulator (CMS), the End-use Equipment Facility (EEF), and the Pre-development Operational System Test (POST) Area. This paper addresses the facility that supports these test areas and briefly describes the testing in each area. Future plans for the building and Space Station module configurations will also be discussed.
NASA Space Engineering Research Center for VLSI systems design
1991-01-01
This annual review reports the center's activities and findings on very large scale integration (VLSI) systems design for 1990, including project status, financial support, publications, the NASA Space Engineering Research Center (SERC) Symposium on VLSI Design, research results, and outreach programs. Processor chips completed or under development are listed. Research results summarized include a design technique to harden complementary metal oxide semiconductors (CMOS) memory circuits against single event upset (SEU); improved circuit design procedures; and advances in computer aided design (CAD), communications, computer architectures, and reliability design. Also described is a high school teacher program that exposes teachers to the fundamentals of digital logic design.
Energy Technology Data Exchange (ETDEWEB)
Sayiram, G., E-mail: sayiram.g@vit.ac.in; Arivazhagan, N.
2015-04-15
In this work, the microstructural character of dissimilar welds between Incoloy 800H and 321 Stainless Steel has been discussed. The microscopic examination of the base metals, fusion zones and interfaces was characterized using an optical microscope and scanning electron microscopy. The results revealed precipitates of Ti (C, N) in the austenitic matrix along the grain boundaries of the base metals. Migration of grain boundaries in the Inconel 82 weld metal was very extensive when compared to Inconel 617 weldment. Epitaxial growth was observed in the 617 weldment which increases the strength and ductility of the weld metal. Unmixed zone near the fusion line between 321 Stainless Steel and Inconel 82 weld metal was identified. From the results, it has been concluded that Inconel 617 filler metal is a preferable choice for the joint between Incoloy 800H and 321 Stainless Steel. - Highlights: • Failure mechanisms produced by dissimilar welding of Incoloy 800H to AISI 321SS • Influence of filler wire on microstructure properties • Contemplative comparisons of metallurgical aspects of these weldments • Microstructure and chemical studies including metallography, SEM–EDS • EDS-line scan study at interface.
The National Space Science Data Center guide to international rocket data
Dubach, L. L.
1972-01-01
Background information is given which briefly describes the mission of the National Space Science Data Center (NSSDC), including its functions and systems, along with its policies and purposes for collecting rocket data. The operation of a machine-sensible rocket information system, which allows the Data Center to have convenient access to information and data concerning all rocket flights carrying scientific experiments, is also described. The central feature of this system, an index of rocket flights maintained on magnetic tape, is described. Standard outputs for NSSDC and for the World Data Center A (WDC-A) for Rockets and Satellites are described.
The Johnson Space Center management information systems: User's guide to JSCMIS
Bishop, Peter C.; Erickson, Lloyd
1990-01-01
The Johnson Space Center Management Information System (JSCMIS) is an interface to computer data bases at the NASA Johnson Space Center which allows an authorized user to browse and retrieve information from a variety of sources with minimum effort. The User's Guide to JSCMIS is the supplement to the JSCMIS Research Report which details the objectives, the architecture, and implementation of the interface. It is a tutorial on how to use the interface and a reference for details about it. The guide is structured like an extended JSCMIS session, describing all of the interface features and how to use them. It also contains an appendix with each of the standard FORMATs currently included in the interface. Users may review them to decide which FORMAT most suits their needs.
On deformation of foliations with a center in the projective space
Directory of Open Access Journals (Sweden)
MOVASATI HOSSEIN
2001-01-01
Full Text Available Let be a foliation in the projective space of dimension two with a first integral of the type , where F and G are two polynomials on an affine coordinate, = and g.c.d.(p, q = 1. Let z be a nondegenerate critical point of , which is a center singularity of , and be a deformation of in the space of foliations of degree deg( such that its unique deformed singularity near z persists in being a center. We will prove that the foliation has a first integral of the same type of . Using the arguments of the proof of this result we will give a lower bound for the maximum number of limit cycles of real polynomial differential equations of a fixed degree in the real plane.
NASA's astrophysics archives at the National Space Science Data Center
Vansteenberg, M. E.
1992-01-01
NASA maintains an archive facility for Astronomical Science data collected from NASA's missions at the National Space Science Data Center (NSSDC) at Goddard Space Flight Center. This archive was created to insure the science data collected by NASA would be preserved and useable in the future by the science community. Through 25 years of operation there are many lessons learned, from data collection procedures, archive preservation methods, and distribution to the community. This document presents some of these more important lessons, for example: KISS (Keep It Simple, Stupid) in system development. Also addressed are some of the myths of archiving, such as 'scientists always know everything about everything', or 'it cannot possibly be that hard, after all simple data tech's do it'. There are indeed good reasons that a proper archive capability is needed by the astronomical community, the important question is how to use the existing expertise as well as the new innovative ideas to do the best job archiving this valuable science data.
Mills, M; Choi, J; El-Haddad, G; Sweeney, J; Biebel, B; Robinson, L; Antonia, S; Kumar, A; Kis, B
2017-12-01
To investigate the technical success rate and procedure-related complications of computed tomography (CT)-guided needle biopsy of lung lesions and to identify the factors that are correlated with the occurrence of procedure-related complications. This was a single- institution retrospective study of 867 consecutive CT-guided needle biopsies of lung lesions performed on 772 patients in a tertiary cancer centre. The technical success rate and complications were correlated with patient, lung lesion, and procedure-related variables. The technical success rate was 87.2% and the mortality rate was 0.12%. Of the 867 total biopsies 25.7% were associated with pneumothorax, and 6.5% required chest tube drainage. The haemothorax rate was 1.8%. There was positive correlation between the development of pneumothorax and smaller lesion diameter (ptechnical success and a low rate of major complications. The present study has revealed several variables that can be used to identify high-risk procedures. A post-procedural chest X-ray within hours after the procedure is highly recommended to identify high-risk patients who require chest tube placement. Copyright © 2017 The Royal College of Radiologists. Published by Elsevier Ltd. All rights reserved.
NASA Goddard Space Flight Center Supply Chain Management Program
Kelly, Michael P.
2011-01-01
This slide presentation reviews the working of the Supplier Assessment Program at NASA Goddard Space Flight Center. The program supports many GSFC projects to ensure suppliers are aware of and are following the contractual requirements, to provide an independent assessment of the suppliers' processes, and provide suppliers' safety and mission assurance organizations information to make the changes within their organization.
Students build glovebox at Space Science Center
2001-01-01
Students in the Young Astronaut Program at the Coca-Cola Space Science Center in Columbus, GA, constructed gloveboxes using the new NASA Student Glovebox Education Guide. The young astronauts used cardboard copier paper boxes as the heart of the glovebox. The paper boxes transformed into gloveboxes when the students pasted poster-pictures of an actual NASA microgravity science glovebox inside and outside of the paper boxes. The young astronauts then added holes for gloves and removable transparent top covers, which completed the construction of the gloveboxes. This image is from a digital still camera; higher resolution is not available.
NCERA-101 Station Report from Kennedy Space Center, FL, USA
Massa, Gioia D.; Wheeler, Raymond M.
2014-01-01
This is our annual report to the North Central Extension Research Activity, which is affiliated with the USDA and Land Grant University Agricultural Experiment Stations. I have been a member of this committee for 25 years. The presentation will be given by Dr. Gioia Massa, Kennedy Space Center
Mechanism of mechanical property enhancement in nitrogen and titanium implanted 321 stainless steel
International Nuclear Information System (INIS)
Xu Ming; Li Liuhe; Liu Youming; Cai Xun; Chen Qiulong; Chu, Paul K.
2006-01-01
Ion implantation is a well-known method to modify surface mechanical properties. The improvement of the mechanical properties can usually be attributed to the formation of new strengthening phases, solution strengthening, dislocation strengthening, or grain refinement. However, in many cases, the roles of individual factors are not clear. In this study, we implanted nitrogen and titanium into 321 stainless steel samples to investigate the enhancement mechanism of the mechanical properties. Nano-indentation experiments were conducted to measure the hardness under various loadings. The N and Ti implanted 321 stainless steel samples were found to behave differently in the hardness (GPa) versus depth (nm) diagram. The effects of the radiation damage, solution strengthening, and dispersion strengthening phase were analyzed. Characterization of the modified layers was performed using techniques such as Auger electron spectroscopy (AES) and grazing incidence X-ray diffraction (GIXRD). Transmission electron microscopy (TEM) and X-ray diffraction were also applied to reveal the structure of the untreated 321 stainless steel
Environmental control and life support testing at the Marshall Space Flight Center
Schunk, Richard G.; Humphries, William R.
1987-01-01
The Space Station Environmental Control and Life Support System (ECLSS) test program at the Marshall Space Flight Center (MSFC) is addressed. The immediate goals and current activities of the test program are discussed. Also described are the Core Module Integration Facility (CMIF) and the initial ECLSS test configuration. Future plans for the ECLSS test program and the CMIF are summarized.
Marshall Space Flight Center's Virtual Reality Applications Program 1993
Hale, Joseph P., II
1993-01-01
A Virtual Reality (VR) applications program has been under development at the Marshall Space Flight Center (MSFC) since 1989. Other NASA Centers, most notably Ames Research Center (ARC), have contributed to the development of the VR enabling technologies and VR systems. This VR technology development has now reached a level of maturity where specific applications of VR as a tool can be considered. The objectives of the MSFC VR Applications Program are to develop, validate, and utilize VR as a Human Factors design and operations analysis tool and to assess and evaluate VR as a tool in other applications (e.g., training, operations development, mission support, teleoperations planning, etc.). The long-term goals of this technology program is to enable specialized Human Factors analyses earlier in the hardware and operations development process and develop more effective training and mission support systems. The capability to perform specialized Human Factors analyses earlier in the hardware and operations development process is required to better refine and validate requirements during the requirements definition phase. This leads to a more efficient design process where perturbations caused by late-occurring requirements changes are minimized. A validated set of VR analytical tools must be developed to enable a more efficient process for the design and development of space systems and operations. Similarly, training and mission support systems must exploit state-of-the-art computer-based technologies to maximize training effectiveness and enhance mission support. The approach of the VR Applications Program is to develop and validate appropriate virtual environments and associated object kinematic and behavior attributes for specific classes of applications. These application-specific environments and associated simulations will be validated, where possible, through empirical comparisons with existing, accepted tools and methodologies. These validated VR analytical
The Context of Creating Space: Assessing the Likelihood of College LGBT Center Presence
Fine, Leigh E.
2012-01-01
LGBT (lesbian, gay, bisexual, and transgender) resource centers are campus spaces dedicated to the success of sexual minority students. However, only a small handful of American colleges and universities have such spaces. Political opportunity and resource mobilization theory can provide a useful framework for understanding what contextual factors…
31 CFR 515.321 - United States; continental United States.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States; continental United... General Definitions § 515.321 United States; continental United States. The term United States means the United States and all areas under the jurisdiction or authority thereof, including the Trust Territory of...
31 CFR 500.321 - United States; continental United States.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States; continental United... General Definitions § 500.321 United States; continental United States. The term United States means the United States and all areas under the jurisdiction or authority thereof, including U.S. trust territories...
31 CFR 535.321 - United States; continental United States.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false United States; continental United... General Definitions § 535.321 United States; continental United States. The term United States means the United States and all areas under the jurisdiction or authority thereof including the Trust Territory of...
HEU Holdup Measurements on 321-M A-Lathe
International Nuclear Information System (INIS)
Dewberry, R.A.
2002-01-01
The Analytical Development Section of SRTC was requested by the Facilities Disposition Division (FDD) of the Savannah River Site to determine the holdup of enriched uranium in the 321-M facility as part of an overall deactivation project of the facility. The 321-M facility was used to fabricate enriched uranium fuel assemblies, lithium-aluminum target tubes, neptunium assemblies, and miscellaneous components for the production reactors. The results of the holdup assays are essential for determining compliance with the solid waste Waste Acceptance Criteria, Material Control and Accountability, and to meet criticality safety controls. Three measurement systems were used to determine highly enriched uranium (HEU) holdup. This report covers holdup measurements on the A-Lathe that was used to machine uranium-aluminum-alloy (U-Al). Our results indicated that the lathe contained more than the limits stated in the Waste Acceptance Criteria (WAC) for the solid waste E-Area Vaults. Thus the lathe was decontaminated three times and assayed four times in order to bring the amounts of uranium to an acceptable content. This report will discuss the methodology, Non-Destructive Assay (NDA) measurements, and results of the U-235 holdup on the lathe
The NASA Community Coordinated Modeling Center (CCMC) Next Generation Space Weather Data Warehouse
Maddox, M. M.; Kuznetsova, M. M.; Pulkkinen, A. A.; Zheng, Y.; Rastaetter, L.; Chulaki, A.; Pembroke, A. D.; Wiegand, C.; Mullinix, R.; Boblitt, J.; Mendoza, A. M. M.; Swindell, M. J., IV; Bakshi, S. S.; Mays, M. L.; Shim, J. S.; Hesse, M.; Collado-Vega, Y. M.; Taktakishvili, A.; MacNeice, P. J.
2014-12-01
The Community Coordinated Modeling Center (CCMC) at NASA Goddard Space Flight Center enables, supports, and performs research and development for next generation space science and space weather models. The CCMC currently hosts a large and expanding collection of state-or-the-art, physics-based space weather models that have been developed by the international research community. There are many tools and services provided by the CCMC that are currently available world-wide, along with the ongoing development of new innovative systems and software for research, discovery, validation, visualization, and forecasting. Over the history of the CCMC's existence, there has been one constant engineering challenge - describing, managing, and disseminating data. To address the challenges that accompany an ever-expanding number of models to support, along with a growing catalog of simulation output - the CCMC is currently developing a flexible and extensible space weather data warehouse to support both internal and external systems and applications. This paper intends to chronicle the evolution and future of the CCMC's data infrastructure, and the current infrastructure re-engineering activities that seek to leverage existing community data model standards like SPASE and the IMPEx Simulation Data Model.
Ishigaki, Aya; Kanno, Minoru; Onoda, Yasuaki; Sakaguchi, Taiyo
2004-01-01
The number of emotionally disturbed children in Japan has been increasing recently; However, only few attempts with an aim at improving children's living space have been made at treatment centers. We conducted some field surveys on the cottage-type residential center to examine the relationship among space, communication, and the effectiveness of therapy. In addition, to clarify conditions of treatment for children with emotional disturbances, the children's daily life with milieu therapy was...
CCSDS telemetry systems experience at the Goddard Space Flight Center
Carper, Richard D.; Stallings, William H., III
1990-01-01
NASA Goddard Space Flight Center (GSFC) designs, builds, manages, and operates science and applications spacecraft in near-earth orbit, and provides data capture, data processing, and flight control services for these spacecraft. In addition, GSFC has the responsibility of providing space-ground and ground-ground communications for near-earth orbiting spacecraft, including those of the manned spaceflight programs. The goal of reducing both the developmental and operating costs of the end-to-end information system has led the GSFC to support and participate in the standardization activities of the Consultative Committee for Space Data Systems (CCSDS), including those for packet telemetry. The environment in which such systems function is described, and the GSFC experience with CCSDS packet telemetry in the context of the Gamma-Ray Observatory project is discussed.
International Nuclear Information System (INIS)
Luo Yijun
2013-01-01
The metallurgical, physical and mechanical performance, and the corrosion and welding properties of 00Cr17Ni12Mo2 (controlled Nitrogen, ANSI316LN) and 0Cr18Ni10Ti (ANSI321SS) for main pipe material were analyzed comparatively in this paper. The feasibility of 316LN pipe material manufacturing was studied too. The analysis results showed that under the operation condition of the nuclear reactor, the general properties of 316LN are better than that of 321SS. Therefore, 316LN could be used for main pipe material, replacing 321SS. (authors)
2014-09-05
Aviation Blvd. El Segundo, CA 90245 4. This standard has been approved for use on all Space and Missile Systems Center/Air Force Program...140 Satellite Hardness and Survivability; Testing Rationale for Electronic Upset and Burnout Effects 30. JANNAF-GL-2012-01-RO Test and Evaluation...vehicle, subsystem, and unit lev- els . Acceptance testing shall be conducted on all subsequent flight items. The protoqualification strategy shall require
A Detailed Assessment for the Potential use of Waste Hydrogen Gas at Stennis Space Center
National Aeronautics and Space Administration — Stennis Space Center (SSC) is NASA’s primary liquid rocket engine test facility. As such, large amounts of liquid hydrogen are used as a rocket propellant. This...
Responding to the Concerns of Student Cultural Groups: Redesigning Spaces for Cultural Centers
McDowell, Anise Mazone; Higbee, Jeanne L.
2014-01-01
This paper describes the engagement of a student committee in redesigning an entire floor of a university union to accommodate student cultural centers and provide space in a fair and equitable manner. The reorganization focused on the process as well as the task of allocating space, with an emphasis on the opportunity to foster the development of…
Schafer, Eric J.
2012-01-01
There are over 40 subsystems being developed for the future SLS and Orion Launch Systems at Kennedy Space Center. These subsystems developed at the Kennedy Space Center Engineering Directorate follow a comprehensive design process which requires several different product deliverables during each phase of each of the subsystems. This Paper describes this process and gives an example of where the process has been applied.
Aspects of plasma cutting in AISI 321 stainless steel
International Nuclear Information System (INIS)
Souza Barros, I. de; Cardoso, P.E.
1985-10-01
The utilization of plasma cutting process in AISI 321 stainless steel heavy plates for fabricating nozzles for nuclear reactors was evaluated. The effect of current, electric potential and cutting speed are studied. The superficial irregularity and the microstructure of the zone affected by the cut were analyzed by measurements of roughness, optical metallography and microhardness. (E.G.) [pt
NASA Johnson Space Center Usability Testing and Analysis Facility (WAF) Overview
Whitmore, M.
2004-01-01
The Usability Testing and Analysis Facility (UTAF) is part of the Space Human Factors Laboratory at the NASA Johnson Space Center in Houston, Texas. The facility provides support to the Office of Biological and Physical Research, the Space Shuttle Program, the International Space Station Program, and other NASA organizations. In addition, there are ongoing collaborative research efforts with external businesses and universities. The UTAF provides human factors analysis, evaluation, and usability testing of crew interfaces for space applications. This includes computer displays and controls, workstation systems, and work environments. The UTAF has a unique mix of capabilities, with a staff experienced in both cognitive human factors and ergonomics. The current areas of focus are: human factors applications in emergency medical care and informatics; control and display technologies for electronic procedures and instructions; voice recognition in noisy environments; crew restraint design for unique microgravity workstations; and refinement of human factors processes. This presentation will provide an overview of ongoing activities, and will address how the projects will evolve to meet new space initiatives.
Bhat, Biliyar N.; Carter, Robert W.; Ding, Robert J.; Lawless, Kirby G.; Nunes, Arthur C., Jr.; Russell, Carolyn K.; Shah, Sandeep R.; Munafo, Paul M. (Technical Monitor)
2001-01-01
This paper presents an over-view of friction stir welding (FSW) process development and applications at Marshall Space Flight Center (MSFC). FSW process development started as a laboratory curiosity but soon found support from many users. The FSW process advanced very quickly and has found many applications both within and outside the aerospace industry. It is currently being adapted for joining key elements of the Space Shuttle External Tank for improved producibility and reliability. FSW process modeling is done to better understand and improve the process. Special tools have been developed to weld variable thickness materials including very thin and very thick materials. FSW is now being applied to higher temperature materials such as copper and to advanced materials such as metal matrix composites. FSW technology is being successfully transferred from MSFC laboratory to shop floors of many commercial companies.
NASA Johnson Space Center Usability Testing and Analysis facility (UTAF) Overview
Whitmore, Mihriban; Holden, Kritina L.
2005-01-01
The Usability Testing and Analysis Facility (UTAF) is part of the Space Human Factors Laboratory at the NASA Johnson Space Center in Houston, Texas. The facility performs research for NASA's HumanSystems Integration Program, under the HumanSystems Research and Technology Division. Specifically, the UTAF provides human factors support for space vehicles, including the International Space Station, the Space Shuttle, and the forthcoming Crew Exploration Vehicle. In addition, there are ongoing collaborative research efforts with external corporations and universities. The UTAF provides human factors analysis, evaluation, and usability testing of crew interfaces for space applications. This includes computer displays and controls, workstation systems, and work environments. The UTAF has a unique mix of capabilities, with a staff experienced in both cognitive human factors and ergonomics. The current areas of focus are: human factors applications in emergency medical care and informatics; control and display technologies for electronic procedures and instructions; voice recognition in noisy environments; crew restraint design for unique microgravity workstations; and refinement of human factors processes and requirements. This presentation will provide an overview of ongoing activities, and will address how the UTAF projects will evolve to meet new space initiatives.
McCoy, Keegan
2010-01-01
The Kennedy Space Center (KSC) is NASA's spaceport, launching rockets into space and leading important human spaceflight research. This spring semester, I worked at KSC on Constellation Program electrical ground support equipment through NASA's Undergraduate Student Research Program (USRP). This report includes a discussion of NASA, KSC, and my individual research project. An analysis of Penn State's preparation of me for an internship and my overall impressions of the Penn State and NASA internship experience conclude the report.
Electric Vehicles at Kennedy Space Center
Chesson, Bruce E.
2007-01-01
The story of how the transportation office began by introducing low speed electric cars (LSEV) to the fleet managers and employees. This sparked and interest in purchasing some of these LSEV and the usage on KSC. Transportation was approached by a vender of High Speed Electric Vehicle (HSEV) we decided to test the HSEV to see if they would meet our fleet vehicle needs. Transportation wrote a Space Act Agreement (SAA) for the loan of three Lithium Powered Electric vehicles for a one year test. The vehicles have worked very well and we have extended the test for another year. The use of HSEV has pushed for an independent Electric Vehicle Study to be performed to consider ways to effectively optimize the use of electric vehicles in replacement of gasoline vehicles in the KSC vehicle fleet. This will help the center to move closer to meeting the Executive Order 13423.
Finite Element Simulation of the Compaction and Springback of Alumix 321 PM Alloy
Directory of Open Access Journals (Sweden)
Stanley G. Selig
2015-01-01
Full Text Available A finite element simulation of the compaction and springback of an aluminum-based powder metallurgy alloy (Alumix 321 was developed and validated using the LS-DYNA hydrocode. The present work aims to directly address the current scarcity of modeling works on this popular alloy system. The Alumix 321 constitutive material parameters are presented. The model can predict the results of single-action compaction as well as the amount of springback experienced by a compact upon ejection from the die. The model has been validated using a series of experiments including powder compaction, optical densitometry, and the creation of a compaction curve.
Innovative Partnerships Program Accomplishments: 2009-2010 at NASA's Kennedy Space Center
Makufka, David
2010-01-01
This document reports on the accomplishments of the Innovative Partnerships Program during the two years of 2009 and 2010. The mission of the Innovative Partnerships Program is to provide leveraged technology alternatives for mission directorates, programs, and projects through joint partnerships with industry, academia, government agencies, and national laboratories. As outlined in this accomplishments summary, the IPP at NASA's Kennedy Space Center achieves this mission via two interdependent goals: (1) Infusion: Bringing external technologies and expertise into Kennedy to benefit NASA missions, programs, and projects (2) Technology Transfer: Spinning out space program technologies to increase the benefits for the nation's economy and humanity
Lee, Kok Chang; Arai, Takamitsu; Ibrahim, Darah; Deng, Lan; Murata, Yoshinori; Mori, Yutaka; Kosugi, Akihiko
2016-01-01
This study characterizes crude enzymes derived from Penicillium rolfsii c3-2(1) IBRL, a mesophilic fungus isolated from the local soil of Malaysia. Prior to enzyme activity evaluation, P. rolfsii c3-2(1) IBRL was inoculated into a broth medium containing oil-palm trunk residues for the preparation of crude enzymes. Oil-palm trunk residues were optimally hydrolysed at pH5.0 and 50°C. P. rolfsii c3-2(1) IBRL-derived crude enzymes displayed higher thermal stability compared with the commercial enzymes, Celluclast 1.5 L and Acellerase 1500. Moreover, the hydrolysing activities of the P. rolfsii c3-2(1) IBRL-derived crude enzymes (xylan, arabinan, and laminarin) were superior compared to that of Celluclast 1.5 L and Acellerase 1500, and exhibit 2- to 3-fold and 3- to 4-fold higher oil-palm trunk residues-hydrolysing specific activity, respectively. This higher hydrolysis efficiency may be attributed to the weak 'lignin-binding' ability of the P. rolfsii c3-2(1) IBRL-derived enzymes compared to the commercial enzymes.
International Nuclear Information System (INIS)
Ganiev, I.; Mukhiddinov, G.N.; Kargapolova, T.V.; Mirsaidov, U.
1995-01-01
The purpose of present work is studying of influence of barium additionson electrochemical corrosion of casting aluminium-copper alloy Al-321,containing as base alloying components copper, chromium, manganese, titanium,zirconium, cadmium
Positron-Electron Pairs in Astrophysics (Goddard Space Flight Center, 1983)
International Nuclear Information System (INIS)
Burns, M.L.; Harding, A.K.; Ramaty, R.
1983-01-01
A workshop on Position-Electron Pairs in Astrophysics was held in 1983 at the Goddard Space Flight Center. This workshop brought together observers and theorists actively engaged in the study of astrophysical sites, as well as physical processes therein where position-electron pairs have a profound influence on both the overall dynamics of the source region and the properties of the emitted radiation. This volume consists of the workshop proceedings
Savrai, R. A.; Makarov, A. V.; Osintseva, A. L.; Malygina, I. Yu.
2018-02-01
Mechanical testing of the AISI 321 corrosion resistant austenitic steel for contact gigacycle fatigue has been conducted with the application of a new method of contact fatigue testing with ultrasonic frequency of loading according to a pulsing impact "plane-to-plane" contact scheme. It has been found that the contact endurance (the ability to resist the fatigue spalling) of the AISI 321 steel under contact gigacycle fatigue loading is determined by its plasticity margin and the possibility of additional hardening under contact loading. It is demonstrated that the appearance of localized deep and long areas of spalling on a material surface can serve as a qualitative characteristic for the loss of the fatigue strength of the AISI 321 steel under impact contact fatigue loading. The value of surface microhardness measured within contact spots and the maximum depth of contact damages in the peripheral zone of contact spots can serve as quantitative criteria for that purpose.
History of Reliability and Quality Assurance at Kennedy Space Center
Childers, Frank M.
2004-01-01
This Kennedy Historical Document (KHD) provides a unique historical perspective of the organizational and functional responsibilities for the manned and un-manned programs at Kennedy Space Center, Florida. As systems become more complex and hazardous, the attention to detailed planning and execution continues to be a challenge. The need for a robust reliability and quality assurance program will always be a necessity to ensure mission success. As new space missions are defined and technology allows for continued access to space, these programs cannot be compromised. The organizational structure that has provided the reliability and quality assurance functions for both the manned and unmanned programs has seen many changes since the first group came to Florida in the 1950's. The roles of government and contractor personnel have changed with each program and organizational alignment has changed based on that responsibility. The organizational alignment of the personnel performing these functions must ensure independent assessment of the processes.
Letchworth, Janet F.
2011-01-01
Kennedy Space Center (KSC) has decided to write its agreements under the Commercial Space Launch Act (CSLA) authority to cover a broad range of categories of support that KSC could provide to our commercial partner. Our strategy was to go through the onerous process of getting the agreement in place once and allow added specificity and final cost estimates to be documented on a separate Task Order Request (TOR). This paper is written from the implementing engineering team's perspective. It describes how we developed the processes associated with getting Government support to our emerging commercial partners, such as SpaceX and reports on our success to date.
Marshall Space Flight Center Ground Systems Development and Integration
Wade, Gina
2016-01-01
Ground Systems Development and Integration performs a variety of tasks in support of the Mission Operations Laboratory (MOL) and other Center and Agency projects. These tasks include various systems engineering processes such as performing system requirements development, system architecture design, integration, verification and validation, software development, and sustaining engineering of mission operations systems that has evolved the Huntsville Operations Support Center (HOSC) into a leader in remote operations for current and future NASA space projects. The group is also responsible for developing and managing telemetry and command configuration and calibration databases. Personnel are responsible for maintaining and enhancing their disciplinary skills in the areas of project management, software engineering, software development, software process improvement, telecommunications, networking, and systems management. Domain expertise in the ground systems area is also maintained and includes detailed proficiency in the areas of real-time telemetry systems, command systems, voice, video, data networks, and mission planning systems.
The Common information space of the Training and Consulting Center design
Directory of Open Access Journals (Sweden)
Dorofeeva N.S.
2017-04-01
Full Text Available the article describes the relevance of the research, such as the assessment of the educational and consulting services market and also the competitive environment based on the analysis of the regional innovative infrastructure. The results of the center activity design are presented, and the basis of the concept of this center functioning is TRIZ (the Theory of Invention Tasks Solving. The basic functional capabilities of the common information space (CIS are formulated and justified in this research, the CIS-structure is formed, the interfaces of the information resources in the CIS for the interaction with potential users have been developed, and data modeling has been carried out.
Jamshidi, M. (Editor); Lumia, R. (Editor); Tunstel, E., Jr. (Editor); White, B. (Editor); Malone, J. (Editor); Sakimoto, P. (Editor)
1997-01-01
This first volume of the Autonomous Control Engineering (ACE) Center Press Series on NASA University Research Center's (URC's) Advanced Technologies on Space Exploration and National Service constitute a report on the research papers and presentations delivered by NASA Installations and industry and Report of the NASA's fourteen URC's held at the First National Conference in Albuquerque, New Mexico from February 16-19, 1997.
Stennis Space Center observes 2009 Safety and Health Day
2009-01-01
Sue Smith, a medical clinic employee at NASA's John C. Stennis Space Center, takes the temperature of colleague Karen Badon during 2009 Safety and Health Day activities Oct. 22. Safety Day activities included speakers, informational sessions and a number of displays on safety and health issues. Astronaut Dominic Gorie also visited the south Mississippi rocket engine testing facility during the day to address employees and present several Silver Snoopy awards for outstanding contributions to flight safety and mission success. The activities were part of an ongoing safety and health emphasis at Stennis.
Luo, Dong-jiao; Yan, Jie; Mao, Ya-fei; Li, Shu-ping; Luo, Yi-hui; Li, Li-wei
2005-01-01
To construct lipL32/1-lipL41/1 fusion gene and its prokaryotic expression system and to determine frequencies of carrying and expression of lipL32 and lipL41 genes in L.interrogans wild strains and specific antibody levels in sera from leptospirosis patients. lipL32/1-lipL41/1 fusion gene was constructed using linking primer PCR method and the prokaryotic expression system of the fusion gene done with routine techniques. SDS-PAGE was used to examine expression of the target recombinant protein rLipL32/1-rLipL41/1. Immunogenicity of rLipL32/1-rLipL41/1 was identified by Western blot. PCR and MAT were performed to detect carrying and expression of lipL32 and lipL41 genes in 97 wild L.interrogans strains. Antibodies against products of lipL32 and lipL41 genes in serum samples from 228 leptospirosis patients were detected by ELISA method. The homogeneity of nucleotide and putative amino acid sequence of lipL32/1-lipL41/1 fusion gene were 99.9 % and 99.8 % in comparison with the reported sequences. Expression output of the target recombinant protein rLipL32/1-rLipL41/1, mainly present in inclusion body, accounted for 10 % of the total bacterial proteins. Both the rabbit antisera against rLipL32/1 and rLipL41/1 could combine to rLipL32/1-rLipL41/1. 97.9 % and 87.6 % of the L.interrogans wild strains had lipL32 and lipL41 genes, respectively. 95.9 % and 84.5 % of the wild strains were positive for MAT with titers of 1:4 - 1:128 using rabbit anti-rLipL32s or anti-rLipL41s sera, respectively. 94.7 % - 97.4 % of the patients'serum samples were positive for rLipL32s antibodies, while 78.5 % - 84.6 % of them were rLipL41s antibodies detectable. lipL32/1-jlipL41/1 fusion gene and its prokaryotic expression system were successfully constructed. The expressed fusion protein had qualified immunogenicity. Both the lipL32 and lipL41 genes are extensively carried and frequently expressed by different serogroups of L.interrogans, and their expression products exhibit cross-antigenicity.
International Nuclear Information System (INIS)
Watanabe, Kenta; Hirata, Michiko; Tominari, Tsukasa; Matsumoto, Chiho; Endo, Yasuyuki; Murphy, Gillian; Nagase, Hideaki
2016-01-01
Carboranes are a class of carbon-containing polyhedral boron cluster compounds with globular geometry and hydrophobic surface that interact with hormone receptors such as estrogen receptor (ER) and androgen receptor (AR). We have synthesized BA321, a novel carborane compound, which binds to AR. We found here that it also binds to ERs, ERα and ERβ. In orchidectomized (ORX) mice, femoral bone mass was markedly reduced due to androgen deficiency and BA321 restored bone loss in the male, whilst the decreased weight of seminal vesicle in ORX mice was not recovered by administration of BA321. In female mice, BA321 acts as a pure estrogen agonist, and restored both the loss of bone mass and uterine atrophy due to estrogen deficiency in ovariectomized (OVX) mice. In bone tissues, the trabecular bone loss occurred in both ORX and OVX mice, and BA321 completely restored the trabecular bone loss in both sexes. Cortical bone loss occurred in ORX mice but not in OVX mice, and BA321 clearly restored cortical bone loss due to androgen deficiency in ORX mice. Therefore, BA321 is a novel selective androgen receptor modulator (SARM) that may offer a new therapy option for osteoporosis in the male. - Highlights: • A novel carborane compound BA321 binds to both AR and ERs, ERα and ERβ. • BA321 restores bone loss in orchidectomized mice without effects on sex organ. • BA321 acts as an estrogen agonist in bone and uterus in ovariectomized mice. • BA321 may be a new SARM to prevent the loss of musculoskeletal mass in elder men.
Energy Technology Data Exchange (ETDEWEB)
Watanabe, Kenta [Department of Biotechnology and Life Science, Tokyo University of Agriculture and Technology, 2-24-16 Nakamachi, Koganei, Tokyo 184-8588 (Japan); Cooperative Major in Advanced Health Science, Tokyo University of Agriculture and Technology, 2-24-16 Nakamachi, Koganei, Tokyo 184-8588 (Japan); Hirata, Michiko [Department of Biotechnology and Life Science, Tokyo University of Agriculture and Technology, 2-24-16 Nakamachi, Koganei, Tokyo 184-8588 (Japan); Tominari, Tsukasa [Department of Biotechnology and Life Science, Tokyo University of Agriculture and Technology, 2-24-16 Nakamachi, Koganei, Tokyo 184-8588 (Japan); Institute of Global Innovation Research, Tokyo University of Agriculture and Technology, 2-24-16 Nakamachi, Koganei, Tokyo 184-8588 (Japan); Matsumoto, Chiho [Department of Biotechnology and Life Science, Tokyo University of Agriculture and Technology, 2-24-16 Nakamachi, Koganei, Tokyo 184-8588 (Japan); Endo, Yasuyuki [Faculty of Pharmaceutical Sciences, Tohoku Medical and Pharmaceutical University, 4-4-1, Komatsushima, Aoba-ku, Sendai, 981-8558 (Japan); Murphy, Gillian [Department of Oncology, University of Cambridge, Cancer Research UK, Cambridge Institute, Li Ka Shing Centre, Cambridge, CB2 0RE (United Kingdom); Nagase, Hideaki [Institute of Global Innovation Research, Tokyo University of Agriculture and Technology, 2-24-16 Nakamachi, Koganei, Tokyo 184-8588 (Japan); Kennedy Institute of Rheumatology, Nuffield Department of Orthopaedics, Rheumatology and Musculoskeletal Sciences, University of Oxford, Oxford, OX3 7FY (United Kingdom); and others
2016-09-09
Carboranes are a class of carbon-containing polyhedral boron cluster compounds with globular geometry and hydrophobic surface that interact with hormone receptors such as estrogen receptor (ER) and androgen receptor (AR). We have synthesized BA321, a novel carborane compound, which binds to AR. We found here that it also binds to ERs, ERα and ERβ. In orchidectomized (ORX) mice, femoral bone mass was markedly reduced due to androgen deficiency and BA321 restored bone loss in the male, whilst the decreased weight of seminal vesicle in ORX mice was not recovered by administration of BA321. In female mice, BA321 acts as a pure estrogen agonist, and restored both the loss of bone mass and uterine atrophy due to estrogen deficiency in ovariectomized (OVX) mice. In bone tissues, the trabecular bone loss occurred in both ORX and OVX mice, and BA321 completely restored the trabecular bone loss in both sexes. Cortical bone loss occurred in ORX mice but not in OVX mice, and BA321 clearly restored cortical bone loss due to androgen deficiency in ORX mice. Therefore, BA321 is a novel selective androgen receptor modulator (SARM) that may offer a new therapy option for osteoporosis in the male. - Highlights: • A novel carborane compound BA321 binds to both AR and ERs, ERα and ERβ. • BA321 restores bone loss in orchidectomized mice without effects on sex organ. • BA321 acts as an estrogen agonist in bone and uterus in ovariectomized mice. • BA321 may be a new SARM to prevent the loss of musculoskeletal mass in elder men.
Environmental Physiology at the Johnson Space Center: Past, Present, and Future
Conkin, Johnny
2007-01-01
This viewgraph presentation reviews the work in environmental physiology done at Johnson Space Center (JSC). The work is aimed at keeping astronauts healthy. This is a different approach than treating the sick, and is more of an occupational health model. The reduction of risks is the main emphasis for this work. They emphasis is to reduce the risk of decompression sickness (DCS) and acute mountain sickness (AMS). The work in environmental physiology encompasses the following areas: (1) Pressure: hypobaric and hyperbaric (2) Gases: hypoxia and hyperoxia, hypercapnia--closed space issues, inert gas physiology / respiration (3) Temperature: hypothermia and hyperthermia, thermal comfort, Protective clothing diving, aviation, mountaineering, and space (4) Acceleration (5) Noise and Vibration (6) Exercise / Performance (6) Acclimatization / Adaptation: engineering solutions when necessary. This presentation reviews the work done at JSC in the areas of DCS and AMS.
Robotic and automatic welding development at the Marshall Space Flight Center
Jones, C. S.; Jackson, M. E.; Flanigan, L. A.
1988-01-01
Welding automation is the key to two major development programs to improve quality and reduce the cost of manufacturing space hardware currently undertaken by the Materials and Processes Laboratory of the NASA Marshall Space Flight Center. Variable polarity plasma arc welding has demonstrated its effectiveness on class 1 aluminum welding in external tank production. More than three miles of welds were completed without an internal defect. Much of this success can be credited to automation developments which stabilize the process. Robotic manipulation technology is under development for automation of welds on the Space Shuttle's main engines utilizing pathfinder systems in development of tooling and sensors for the production applications. The overall approach to welding automation development undertaken is outlined. Advanced sensors and control systems methodologies are described that combine to make aerospace quality welds with a minimum of dependence on operator skill.
Use of IKONOS Data for Mapping Cultural Resources of Stennis Space Center, Mississippi
Spruce, Joseph P.; Giardino, Marco
2002-01-01
Cultural resource surveys are important for compliance with Federal and State law. Stennis Space Center (SSC) in Mississippi is researching, developing, and validating remote sensing and Geographical Information System (GIS) methods for aiding cultural resource assessments on the center's own land. The suitability of IKONOS satellite imagery for georeferencing scanned historic maps is examined in this viewgraph presentation. IKONOS data can be used to map historic buildings and farmland in Gainsville, MS, and plan archaeological surveys.
Space Solar Power Satellite Technology Development at the Glenn Research Center: An Overview
Dudenhoefer, James E.; George, Patrick J.
2000-01-01
NASA Glenn Research Center (GRC). is participating in the Space Solar Power Exploratory Research and Technology program (SERT) for the development of a solar power satellite concept. The aim of the program is to provide electrical power to Earth by converting the Sun's energy and beaming it to the surface. This paper will give an overall view of the technologies being pursued at GRC including thin film photovoltaics, solar dynamic power systems, space environmental effects, power management and distribution, and electric propulsion. The developmental path not only provides solutions to gigawatt sized space power systems for the future, but provides synergistic opportunities for contemporary space power architectures. More details of Space Solar Power can be found by reading the references sited in this paper and by connecting to the web site http://moonbase.msfc.nasa.gov/ and accessing the "Space Solar Power" section "Public Access" area.
Regional Super ESPC Saves Energy and Dollars at NASA's Johnson Space Center
International Nuclear Information System (INIS)
Federal Energy Management Program
2001-01-01
This case study about energy saving performance contacts (ESPCs) presents an overview of how the NASA's Johnson Space Flight Center established an ESPC contract and the benefits derived from it. The Federal Energy Management Program instituted these special contracts to help federal agencies finance energy-saving projects at their facilities
Garcia, Sam; Homan, Jonathan; Speed, John
2016-01-01
NASA is the mission lead for the James Webb Space Telescope (JWST), the next of the "Great Observatories", scheduled for launch in 2018. It is directly responsible for the integration and test (I&T) program that will culminate in an end-to-end cryo vacuum optical test of the flight telescope and instrument module in Chamber A at NASA Johnson Space Center. Historic Chamber A is the largest thermal vacuum chamber at Johnson Space Center and one of the largest space simulation chambers in the world. Chamber A has undergone a major modernization effort to support the deep cryogenic, vacuum and cleanliness requirements for testing the JWST. This paper describe the challenges of developing, integrating and modifying new payload rails capable of transporting payloads within the thermal vacuum chamber up to 65,000 pounds. Ambient and Cryogenic Operations required to configure for testing will be explained. Lastly review historical payload configurations stretching from the Apollo program era to current James Webb Space Telescope testing.
Human Systems Engineering for Launch processing at Kennedy Space Center (KSC)
Henderson, Gena; Stambolian, Damon B.; Stelges, Katrine
2012-01-01
Launch processing at Kennedy Space Center (KSC) is primarily accomplished by human users of expensive and specialized equipment. In order to reduce the likelihood of human error, to reduce personal injuries, damage to hardware, and loss of mission the design process for the hardware needs to include the human's relationship with the hardware. Just as there is electrical, mechanical, and fluids, the human aspect is just as important. The focus of this presentation is to illustrate how KSC accomplishes the inclusion of the human aspect in the design using human centered hardware modeling and engineering. The presentations also explain the current and future plans for research and development for improving our human factors analysis tools and processes.
Environmental monitoring and research at the John F. Kennedy Space Center
Hall, C. R.; Hinkle, C. R.; Knott, W. M.; Summerfield, B. R.
1992-01-01
The Biomedical Operations and Research Office at the NASA John F. Kennedy Space Center has been supporting environmental monitoring and research since the mid-1970s. Program elements include monitoring of baseline conditions to document natural variability in the ecosystem, assessments of operations and construction of new facilities, and ecological research focusing on wildlife habitat associations. Information management is centered around development of a computerized geographic information system that incorporates remote sensing and digital image processing technologies along with traditional relational data base management capabilities. The proactive program is one in which the initiative is to anticipate potential environmental concerns before they occur and, by utilizing in-house expertise, develop impact minimization or mitigation strategies to reduce environmental risk.
Experimental study of high density foods for the Space Operations Center
Ahmed, S. M.
1981-01-01
The experimental study of high density foods for the Space Operations Center is described. A sensory evaluation of the high density foods was conducted first to test the acceptability of the products. A shelf-life study of the high density foods was also conducted for three different time lengths at three different temperatures. The nutritional analysis of the high density foods is at present incomplete.
Marshall Space Flight Center's Impact Testing Facility Capabilities
Finchum, Andy; Hubbs, Whitney; Evans, Steve
2008-01-01
Marshall Space Flight Center s (MSFC) Impact Testing Facility (ITF) serves as an important installation for space and missile related materials science research. The ITF was established and began its research in spacecraft debris shielding in the early 1960s, then played a major role in the International Space Station debris shield development. As NASA became more interested in launch debris and in-flight impact concerns, the ITF grew to include research in a variety of impact genres. Collaborative partnerships with the DoD led to a wider range of impact capabilities being relocated to MSFC as a result of the closure of Particle Impact Facilities in Santa Barbara, California. The Particle Impact Facility had a 30 year history in providing evaluations of aerospace materials and components during flights through rain, ice, and solid particle environments at subsonic through hypersonic velocities. The facility s unique capabilities were deemed a "National Asset" by the DoD. The ITF now has capabilities including environmental, ballistic, and hypervelocity impact testing utilizing an array of air, powder, and two-stage light gas guns to accommodate a variety of projectile and target types and sizes. Numerous upgrades including new instrumentation, triggering circuitry, high speed photography, and optimized sabot designs have been implemented. Other recent research has included rain drop demise characterization tests to obtain data for inclusion in on-going model development. The current and proposed ITF capabilities range from rain to micrometeoroids allowing the widest test parameter range possible for materials investigations in support of space, atmospheric, and ground environments. These test capabilities including hydrometeor, single/multi-particle, ballistic gas guns, exploding wire gun, and light gas guns combined with Smooth Particle Hydrodynamics Code (SPHC) simulations represent the widest range of impact test capabilities in the country.
The University of Nebraska at Omaha Center for Space Data Use in Teaching and Learning
Grandgenett, Neal
2000-01-01
Within the context of innovative coursework and other educational activities, we are proposing the establishment of a University of Nebraska at Omaha (UNO) Center for the Use of Space Data in Teaching and Learning. This Center will provide an exciting and motivating process for educators at all levels to become involved in professional development and training which engages real life applications of mathematics, science, and technology. The Center will facilitate innovative courses (including online and distance education formats), systematic degree programs, classroom research initiatives, new instructional methods and tools, engaging curriculum materials, and various symposiums. It will involve the active participation of several Departments and Colleges on the UNO campus and be well integrated into the campus environment. It will have a direct impact on pre-service and in-service educators, the K12 (kindergarten through 12th grade) students that they teach, and other college students of various science, mathematics, and technology related disciplines, in which they share coursework. It is our belief that there are many exciting opportunities represented by space data and imagery, as a context for engaging mathematics, science, and technology education. The UNO Center for Space Data Use in Teaching and Learning being proposed in this document will encompass a comprehensive training and dissemination strategy that targets the improvement of K-12 education, through changes in the undergraduate and graduate preparation of teachers in science, mathematics and technology education.
Friction Stir Welding Development at NASA-Marshall Space Flight Center
Bhat, Biliyar N.; Carter, Robert W.; Ding, Robert J.; Lawless, Kirby G.; Nunes, Arthur C., Jr.; Russell, Carolyn K.; Shah, Sandeep R.
2001-01-01
This paper presents an overview of friction stir welding (FSW) process development and applications at Marshall Space Flight Center (MSFC). FSW process development started as a laboratory curiosity but soon found support from many users. The FSW process advanced very quickly and has found many applications both within and outside the aerospace industry. It is currently being adapted for joining key elements of the Space Shuttle External Tank for improved producibility and reliability. FSW process modeling is done to better understand and improve the process. Special tools have been developed to weld variable thickness materials including thin and thick materials. FSW is now being applied to higher temperature materials such as copper and to advanced materials such as metal matrix composites. FSW technology is being successfully transferred from MSFC laboratory to shop floors of many commercial companies.
Innovative Educational Aerospace Research at the Northeast High School Space Research Center
Luyet, Audra; Matarazzo, Anthony; Folta, David
1997-01-01
Northeast High Magnet School of Philadelphia, Pennsylvania is a proud sponsor of the Space Research Center (SPARC). SPARC, a model program of the Medical, Engineering, and Aerospace Magnet school, provides talented students the capability to successfully exercise full simulations of NASA manned missions. These simulations included low-Earth Shuttle missions and Apollo lunar missions in the past, and will focus on a planetary mission to Mars this year. At the end of each scholastic year, a simulated mission, lasting between one and eight days, is performed involving 75 students as specialists in seven teams The groups are comprised of Flight Management, Spacecraft Communications (SatCom), Computer Networking, Spacecraft Design and Engineering, Electronics, Rocketry, Robotics, and Medical teams in either the mission operations center or onboard the spacecraft. Software development activities are also required in support of these simulations The objective of this paper is to present the accomplishments, technology innovations, interactions, and an overview of SPARC with an emphasis on how the program's educational activities parallel NASA mission support and how this education is preparing student for the space frontier.
Innovative Near Real-Time Data Dissemination Tools Developed by the Space Weather Research Center
Mullinix, R.; Maddox, M. M.; Berrios, D.; Kuznetsova, M.; Pulkkinen, A.; Rastaetter, L.; Zheng, Y.
2012-12-01
Space weather affects virtually all of NASA's endeavors, from robotic missions to human exploration. Knowledge and prediction of space weather conditions are therefore essential to NASA operations. The diverse nature of currently available space environment measurements and modeling products compels the need for a single access point to such information. The Integrated Space Weather Analysis (iSWA) System provides this single point access along with the capability to collect and catalog a vast range of sources including both observational and model data. NASA Goddard Space Weather Research Center heavily utilizes the iSWA System daily for research, space weather model validation, and forecasting for NASA missions. iSWA provides the capabilities to view and analyze near real-time space weather data from any where in the world. This presentation will describe the technology behind the iSWA system and describe how to use the system for space weather research, forecasting, training, education, and sharing.
Moses, Haifa R.
2017-01-01
As NASA moves beyond exploring low earth orbit and into deep space exploration, increased communication delays between astronauts and earth drive a need for crew to become more autonomous (earth-independent). Currently crew on board the International Space Station (ISS) have limited insight into specific vehicle system performance because of the dependency on monitoring and real-time communication with Mission Control. Wearable technology provides a method to bridge the gap between the human (astronaut) and the system (spacecraft) by providing mutual monitoring between the two. For example, vehicle or environmental information can be delivered to astronauts through on-body devices and in return wearables provide data to the spacecraft regarding crew health, location, etc. The Wearable Electronics and Applications Research (WEAR) Lab at the NASA Johnson Space Center utilizes a collaborative approach between engineering and human factors to investigate the use of wearables for spaceflight. Zero and partial gravity environments present unique challenges to wearables that require collaborative, user-centered, and iterative approaches to the problems. Examples of the WEAR Lab's recent wearable projects for spaceflight will be discussed.
Thermal Stir Welding Development at Marshall Space Flight Center
Ding, Robert J.
2008-01-01
Solid state welding processes have become the focus of welding process development at NASA's Marshall Space Flight Center. Unlike fusion weld processes such as tungsten inert gas (TIG), variable polarity plasma arc (VPPA), electron beam (EB), etc., solid state welding processes do not melt the material during welding. The resultant microstructure can be characterized as a dynamically recrystallized morphology much different than the casted, dentritic structure typical of fusion weld processes. The primary benefits of solid state processes over fusion weld processes include superior mechanic properties and the elimination of thermal distortion and residual stresses. These solid state processes attributes have profoundly influenced the direction of advanced welding research and development within the NASA agency. Thermal Stir Welding (TSW) is a new solid state welding process being developed at the Marshall Space Flight Center. Unlike friction stir welding, the heating, stirring and forging elements of the weld process can be decoupled for independent control. An induction coil induces energy into a workpiece to attain a desired plastic temperature. An independently controlled stir rod, captured within non-rotating containment plates, then stirs the plasticized material followed by forging plates/rollers that work the stirred weld joint. The independent control (decoupling) of heating, stirring and forging allows, theoretically, for the precision control of microstructure morphology. The TSW process is being used to evaluate the solid state joining of Haynes 230 for ARES J-2X applications. It is also being developed for 500-in (12.5 mm) thick commercially pure grade 2 titanium for navy applications. Other interests include Inconel 718 and stainless steel. This presentation will provide metallurgical and mechanical property data for these high melting temperature alloys.
Risk factors for colostomy in military colorectal trauma: a review of 867 patients.
Watson, J Devin B; Aden, James K; Engel, Julie E; Rasmussen, Todd E; Glasgow, Sean C
2014-06-01
Limited data exist examining the use of fecal diversion in combatants from modern armed conflicts. Characterization of factors leading to colostomy creation is an initial step toward optimizing and individualizing combat casualty care. A retrospective review of the US Department of Defense Trauma Registry database was performed for all US and coalition troops with colorectal injuries sustained during combat operations in Iraq and Afghanistan over 8 years. Colostomy rate, anatomic injury location, mechanism of injury, demographic data, and initial physiologic parameters were examined. Univariate and multivariate analyses were conducted. We identified 867 coalition military personnel with colorectal injuries. The overall colostomy rate was 37%. Rectal injuries had the highest diversion rate (56%), followed by left-sided (41%) and right-sided (20%) locations (P colon (odds ratio [OR], 2.2), rectal versus right colon (OR, 7.5), left versus right colon (OR, 3.4), GSW (OR, 2.0), ISS ≥ 16 (OR, 1.7), and DCS (OR, 1.6). In this exploratory study of 320 combat-related colostomies, distal colon and rectal injuries continue to be diverted at higher rates independent of other comorbidities. Additional outcomes-directed research is needed to determine whether such operative management is beneficial in all patients. Published by Mosby, Inc.
Development of a NEW Vector Magnetograph at Marshall Space Flight Center
West, Edward; Hagyard, Mona; Gary, Allen; Smith, James; Adams, Mitzi; Rose, M. Franklin (Technical Monitor)
2001-01-01
This paper will describe the Experimental Vector Magnetograph that has been developed at the Marshall Space Flight Center (MSFC). This instrument was designed to improve linear polarization measurements by replacing electro-optic and rotating waveplate modulators with a rotating linear analyzer. Our paper will describe the motivation for developing this magnetograph, compare this instrument with traditional magnetograph designs, and present a comparison of the data acquired by this instrument and original MSFC vector magnetograph.
Garcia, Sammy; Homan, Jonathan; Montz, Michael
2016-01-01
NASA is the mission lead for the James Webb Space Telescope (JWST), the next of the “Great Observatories”, scheduled for launch in 2018. It is directly responsible for the integration and test (I&T) program that will culminate in an end-to-end cryo vacuum optical test of the flight telescope and instrument module in Chamber A at NASA Johnson Space Center. Historic Chamber A is the largest thermal vacuum chamber at Johnson Space Center and one of the largest space simulation chambers in the world. Chamber A has undergone a major modernization effort to support the deep cryogenic, vacuum and cleanliness requirements for testing the JWST. This paper describes the steps performed in efforts to convert the existing the 60’s era Liquid Nitrogen System from a forced flow (pumped) process to a natural circulation (thermo-siphon) process. In addition, the paper will describe the dramatic conservation of liquid nitrogen to support the long duration thermal vacuum testing. Lastly, describe the simplistic and effective control system which results in zero to minimal human inputs during steady state conditions.
Bittencourt, Maria Cristina; do Valle Pereira, Vera Lúcia Duarte; Pacheco, Waldemar
2012-01-01
This article aims to study the importance of the attributes of usability and attractiveness for the semi-public spaces of Shopping Centers considering the elderly users, the psycho-cognitive and bio-physiological changes resulting from the aging process, as well as their expectations of the built space. Through a qualitative study of theoretical review with a multidisciplinary focus in architecture, ergonomics, gerontology, environmental psychology and management, the conditions of the elderly users were identified, and also the attributes related to usability and attractiveness, collected in order to understand and organize their interrelationships, to suggest recommendations about the drafting of Shopping Centers, aiming to generate projects and environments that should promote the efficient and satisfactory use for elderly and may also create a competitive advantage for these enterprises.
9 CFR 93.321 - Import permits and applications for inspection for horses.
2010-01-01
... PRODUCTS IMPORTATION OF CERTAIN ANIMALS, BIRDS, FISH, AND POULTRY, AND CERTAIN ANIMAL, BIRD, AND POULTRY PRODUCTS; REQUIREMENTS FOR MEANS OF CONVEYANCE AND SHIPPING CONTAINERS Horses Mexico 18 § 93.321 Import... States from Mexico, the importer or his or her agent shall deliver to the veterinary inspector at the...
2010-07-01
... Missile Center (WSMC), Vandenberg AFB, Calif.; danger zones. 334.1130 Section 334.1130 Navigation and... RESTRICTED AREA REGULATIONS § 334.1130 Pacific Ocean, Western Space and Missile Center (WSMC), Vandenberg AFB... (WSMC) at Vandenberg AFB, California. (3) The impacting of missile debris from launch operations will...
Between Community Spaces: Squares of Minor Centers of Calabria
Directory of Open Access Journals (Sweden)
Mauro Francini
2017-08-01
Full Text Available The theme of open “community spaces” in recent years has to the development of important interdisciplinary issues. Nevertheless, the reading of smaller towns, in urbanistic, historical-anthropological and geographical terms appears less extended, considering the declination of public spaces as "squares." Starting from this declension we would like to introduce the first results of a research. The research had the aim of (reinterpreting the particular characteristics of these areas in specific areas such as small towns, using the region of Calabria for the case of analytic application. These communities have diverse and stratified living cultures, altered by settlement processes that have triggered two different types of urban contexts. The former often lead either to urban areas in depopulated decay or, in contrast, in places of memories: empty containers of relationships, sterile and crystallized museum objects, reduced to scenarios on which passing groups of visitors move necessarily from those realities. The latter often encircle primitive nuclei, asphyxiating them, or characterizing the so-called "dual" or "satellites" towns, completely detached from the original urban center in which all public functions are decentralized. The applied methodology is based on the reading of the historical-functional evolution of squares by the identification of codified compositional criteria. Through this research we seek to verify how urban planning, in synergy with other disciplines, can define processes of regeneration aimed at restoring the meaning of "center", and thus of an urban-community reference center.
Carter, John; Kelly, John; Jones, Dan; Lee, James
2013-01-01
There is a national effort to expedite advanced space technologies on new space systems for both government and commercial applications. In order to lower risk, these technologies should be demonstrated in a relevant environment before being installed in new space systems. This presentation introduces several low cost, short schedule space technology demonstrations using airborne and range facilities available at the Dryden Flight Research Center.
Homan, Jonathan L.; Cerimele, Mary P.; Montz, Michael E.; Bachtel, Russell; Speed, John; O'Rear, Patrick
2013-01-01
Chamber A is the largest thermal vacuum chamber at the Johnson Space Center and is one of the largest space environment chambers in the world. The chamber is 19.8 m (65 ft.) in diameter and 36.6 m (120 ft.) tall and is equipped with cryogenic liquid nitrogen panels (shrouds) and gaseous helium shrouds to create a simulated space environment. It was originally designed and built in the mid 1960 s to test the Apollo Command and Service Module and several manned tests were conducted on that spacecraft, contributing to the success of the program. The chamber has been used since that time to test spacecraft active thermal control systems, Shuttle DTO, DOD, and ESA hardware in simulated Low Earth Orbit (LEO) conditions. NASA is now moving from LEO towards exploration of locations with environments approaching those of deep space. Therefore, Chamber A has undergone major modifications to enable it to simulate these deeper space environments. Environmental requirements were driven, and modifications were funded by the James Webb Space Telescope program, and this telescope, which will orbit Solar/Earth L2, will be the first test article to benefit from the chamber s new capabilities. To accommodate JWST, the Chamber A high vacuum system has been modernized, additional LN2 shrouds have been installed, the liquid nitrogen system has been modified to minimize dependency on electrical power and increase its reliability, a new helium shroud/refrigeration system has been installed to create a colder more stable and uniform heat sink, and the controls have been updated to increase the level of automation and improve operator interfaces. Testing of these major modifications was conducted in August of 2012 and this initial test was very successful, with all major systems exceeding their performance requirements. This paper will outline the changes in overall environmental requirements, discuss the technical design data that was used in the decisions leading to the extensive
Homan, Jonathan L.; Cerimele, Mary P.; Montz, Michael E.
2012-01-01
Chamber A is the largest thermal vacuum chamber at the Johnson Space Center and is one of the largest space environment chambers in the world. The chamber is 19.8 m (65 ft) in diameter and 36.6 m (120 ft) tall and is equipped with cryogenic liquid nitrogen panels (shrouds) and gaseous helium shrouds to create a simulated space environment. It was originally designed and built in the mid 1960's to test the Apollo Command and Service Module and several manned tests were conducted on that spacecraft, contributing to the success of the program. The chamber has been used since that time to test spacecraft active thermal control systems, Shuttle DTO, DOD, and ESA hardware in simulated Low Earth Orbit (LEO) conditions. NASA is now moving from LEO towards exploration of locations with environments approaching those of deep space. Therefore, Chamber A has undergone major modifications to enable it to simulate these deeper space environments. Environmental requirements were driven, and the modifications were funded, by the James Webb Space Telescope program, and this telescope which will orbit Solar/Earth L2, will be the first test article to benefit from the chamber s new capabilities. To accommodate JWST, the Chamber A high vacuum system has been modernized, additional LN2 shrouds have been installed, the liquid nitrogen system has been modified to remove dependency on electrical power and increase its reliability, a new helium shroud/refrigeration system has been installed to create a colder more stable and uniform heat sink and, the controls have been updated to increase the level of automation and improve operator interfaces. Testing of these major modifications was conducted in August 2012 and this initial test was very successful, with all major systems exceeding their performance requirements. This paper will outline the changes in the overall environmental requirements, discuss the technical design data that was used in the decisions leading to the extensive
Unique strategies for technical information management at Johnson Space Center
Krishen, Vijay
1994-01-01
In addition to the current NASA manned programs, the maturation of Space Station and the introduction of the Space Exploration programs are anticipated to add substantially to the number and variety of data and documentation at NASA Johnson Space Center (JSC). This growth in the next decade has been estimated at five to ten fold compared to the current numbers. There will be an increased requirement for the tracking and currency of space program data and documents with National pressures to realize economic benefits from the research and technological developments of space programs. From a global perspective the demand for NASA's technical data and documentation is anticipated to increase at local, national, and international levels. The primary users will be government, industry, and academia. In our present national strategy, NASA's research and technology will assume a great role in the revitalization of the economy and gaining international competitiveness. Thus, greater demand will be placed on NASA's data and documentation resources. In this paper the strategies and procedures developed by DDMS, Inc., to accommodate the present and future information utilization needs are presented. The DDMS, Inc., strategies and procedures rely on understanding user requirements, library management issues, and technological applications for acquiring, searching, storing, and retrieving specific information accurately and quickly. The proposed approach responds to changing customer requirements and product deliveries. The unique features of the proposed strategy include: (1) To establish customer driven data and documentation management through an innovative and unique methods to identify needs and requirements. (2) To implement a structured process which responds to user needs, aimed at minimizing costs and maximizing services, resulting in increased productivity. (3) To provide a process of standardization of services and procedures. This standardization is the central
CMS ECAL Endcap (EE) Dee Assembly - SC mounting on Dee 1
Cockerill, D
2007-01-01
Protection panels on back of Dee 1, Completion of SC mounting, 03/10/2007: Completion of SC mounting (aart from the inner 3-2-1)on the first quadrant of Dee 1 and subsequent survey. 22-28/08/2007: The first supercrystals on Dee1, Dee1 in 867 with the first column of SCs ready for mounting, Dee1 with its protection panels over the laser monitoring fibre system
Liquid hydrogen production and economics for NASA Kennedy Space Center
Block, D. L.
1985-12-01
Detailed economic analyses for the production of liquid hydrogen used to power the Space Shuttle are presented. The hydrogen production and energy needs of the NASA Kennedy Space Center are reviewed, and steam reformation, polygeneration, and electrolysis for liquid hydrogen production are examined on an equal economic basis. The use of photovoltaics as an electrolysis power source is considered. The 1985 present worth is calculated based on life cycle costs over a 21-year period beginning with full operation in 1990. Two different sets of escalation, inflation, and discount rates are used, with revenue credit being given for energy or other products of the hydrogen production process. The results show that the economic analyses are very dependent on the escalation rates used. The least net present value is found for steam reformation of natural gas, while the best net present value is found for the electrolysis process which includes the phasing of photovoltaics.
International Nuclear Information System (INIS)
Rozenak, P.; Eliezer, D.
1984-01-01
Hydrogen embrittlement of 316, 321 and 347 types austenitic stainless steels has been studied by charging thin tensile specimens with hydrogen through cathodic polarization. Throughout this study we have compared solution annealed samples having various prior austenitic grain-size with samples given the additional sensitization treatment. The results show that refined grains improves the resistance to hydrogen cracking regardless of the failure mode. The sensitized specimens were predominantly intergranular, while the annealed specimens show massive regions of microvoid coalescence producing ductile rupture. 347 type stainless steel is much more susceptible to hydrogen embrittlement than 321 type steel, and 316 type is the most resistant to hydrogen embrittlement. the practical implication of the experimental conclusions are discussed
Denardini, Clezio Marcos
2016-07-01
We have developed a tool for measuring the evolutional stage of the space weather regional warning centers using the approach of the innovative evolution starting from the perspective presented by Figueiredo (2009, Innovation Management: Concepts, metrics and experiences of companies in Brazil. Publisher LTC, Rio de Janeiro - RJ). It is based on measuring the stock of technological skills needed to perform a certain task that is (or should) be part of the scope of a space weather center. It also addresses the technological capacity for innovation considering the accumulation of technological and learning capabilities, instead of the usual international indices like number of registered patents. Based on this definition, we have developed a model for measuring the capabilities of the Brazilian Study and Monitoring Program Space Weather (Embrace), a program of the National Institute for Space Research (INPE), which has gone through three national stages of development and an international validation step. This program was created in 2007 encompassing competence from five divisions of INPE in order to carry out the data collection and maintenance of the observing system in space weather; to model processes of the Sun-Earth system; to provide real-time information and to forecast space weather; and provide diagnostic their effects on different technological systems. In the present work, we considered the issues related to the innovation of micro-processes inherent to the nature of the Embrace program, not the macro-economic processes, despite recognizing the importance of these. During the development phase, the model was submitted to five scientists/managers from five different countries member of the International Space Environment Service (ISES) who presented their evaluations, concerns and suggestions. It was applied to the Embrace program through an interview form developed to be answered by professional members of regional warning centers. Based on the returning
The Research-to-Operations-to-Research Cycle at NOAA's Space Weather Prediction Center
Singer, H. J.
2017-12-01
The provision of actionable space weather products and services by NOAA's Space Weather Prediction Center relies on observations, models and scientific understanding of our dynamic space environment. It also depends on a deep understanding of the systems and capabilities that are vulnerable to space weather, as well as national and international partnerships that bring together resources, skills and applications to support space weather forecasters and customers. While these activities have been evolving over many years, in October 2015, with the release of the National Space Weather Strategy and National Space Weather Action Plan (NSWAP) by National Science and Technology Council in the Executive Office of the President, there is a new coordinated focus on ensuring the Nation is prepared to respond to and recover from severe space weather storms. One activity highlighted in the NSWAP is the Operations to Research (O2R) and Research to Operations (R2O) process. In this presentation we will focus on current R2O and O2R activities that advance our ability to serve those affected by space weather and give a vision for future programs. We will also provide examples of recent research results that lead to improved operational capabilities, lessons learned in the transition of research to operations, and challenges for both the science and operations communities.
Dreams, Hopes, Realities: NASA's Goddard Space Flight Center, the First Forty Years
Wallace, Lane E.
1999-01-01
Throughout history, the great achievements of civilizations and cultures have been recorded in lists of dates and events. But to look only at the machinery, discoveries, or milestones is to miss the value of these achievements. Each goal achieved or discovery or made represents a supreme effort on the part of individual people who came and worked together for a purpose greater than themselves. Driven by an innate curiosity of the spirit, we have built civilizations and discovered new worlds, always reaching out beyond what we knew or thought was possible. These efforts may have used ships or machinery, but the achievement was that of the humans who made those machines possible- remarkable people willing to endure discomfort, frustration, fatigue, and the risk of failure in the hope of finding out something new. This is the case with the history of the Goddard Space Flight Center. This publication traces the legacy of successes, risks, disappointments and internationally recognized triumphs of the Center's first 40 years. It is a story of technological achievement and scientific discovery; of reaching back to the dawn of time and opening up a new set of eyes on our own planet Earth. In the end, it is not a story about machinery or discoveries, but a story about ourselves. If we were able to step off our planet, and if we continue to discover new mysteries and better technology, it is because the people who work at Goddard always had a passion for exploration and the dedication to make it happen. The text that follows is a testimony to the challenges people at the Goddard Space Flight Center have faced and overcome over almost half a century. Today, we stand on the threshold of a new and equally challenging era. It will once again test our ingenuity, skills, and flexibility as we find new ways of working with our colleagues in industry, government, and academia. Doing more with less is every bit as ambitious as designing the first science instrument to study the
Rocket ranch the nuts and bolts of the Apollo Moon program at Kennedy Space Center
Ward, Jonathan H
2015-01-01
Jonathan Ward takes the reader deep into the facilities at Kennedy Space Center to describe NASA’s first computer systems used for spacecraft and rocket checkout and explain how tests and launches proceeded. Descriptions of early operations include a harrowing account of the heroic efforts of pad workers during the Apollo 1 fire. A companion to the author’s book Countdown to a Moon Launch: Preparing Apollo for Its Historic Journey, this explores every facet of the facilities that served as the base for the Apollo/Saturn missions. Hundreds of illustrations complement the firsthand accounts of more than 70 Apollo program managers and engineers. The era of the Apollo/Saturn missions was perhaps the most exciting period in American space exploration history. Cape Canaveral and Kennedy Space Center were buzzing with activity. Thousands of workers came to town to build the facilities and launch the missions needed to put an American on the Moon before the end of the decade. Work at KSC involved much more than j...
Yan, Jie; Zhao, Shou-feng; Mao, Ya-fei; Ruan, Ping; Luo, Yi-hui; Li, Shu-ping; Li, Li-wei
2005-01-01
To construct the eukaryotic expression system of L.interrogans lipL32/1-ompL1/1 fusion gene and to identify the immunoreactivity of expression products. PCR with linking primer was used to construct the fusion gene lipL32/1-ompL1/1. The P.pastoris eukaryotic expression system of the fusion gene, pPIC9K-lipL32/1-ompL1/1-P. pastorisGS115, was constructed after the fusion gene was cloned and sequenced. Colony with phenotype His(+)Mut(+) was isolated by using MD and MM plates and His(+) Mut(+) transformant with high resistance to G418 was screened out by using YPD plate. Using lysate of His(+) Mut(+) colony with high copies of the target gene digested with yeast lyase as the template and 5'AOX1 and 3'AOX1 as the primers, the target fusion gene in chromosome DNA of the constructed P. pastoris engineering strain was detected by PCR. Methanol in BMMY medium was used to induce the target recombinant protein rLipL32/1-rOmpL1/1 expression. rLipL32/1-rOmpL1/1 in the medium supernatant was extracted by using ammonium sulfate precipitation and Ni-NTA affinity chromatography. Output and immunoreactivity of rLipL32/1-rOmpL1/1 were measured by SDS-PAGE and Western blot methods, respectively. Amplification fragments of the obtained fusion gene lipL32/1-ompL1/1 was 1794 bp in size. The homogeneity of nucleotide and putative amino acid sequences of the fusion gene were as high as 99.94 % and 100 %, respectively, compared with the sequences of original lipL32/1 and ompL1/1 genotypes. The constructed eukaryotic expression system was able to secrete rLipL32/1-rOmpL1/1 with an output of 10 % of the total proteins in the supernatant, which located the expected position after SDS-PAGE. The rabbit anti-rLipL32/1 and anti-rOmpL1/1 sera could combine the expressed rLipL32/1-rOmpL1/1. An eukaryotic expression system with high efficiency in P.pastoris of L.interrogans lipL32/1-ompL1/1 fusion gene was successfully constructed in this study. The expressed fusion protein shows specific
McRight, P. S.; Sheehy, J. A.; Blevins, J. A.
2005-01-01
NASA s Marshall Space Flight Center (MSFC) is well known for its contributions to large ascent propulsion systems such as the Saturn V rocket and the Space Shuttle external tank, solid rocket boosters, and main engines. This paper highlights a lesser known but very rich side of MSFC-its heritage in the development of in-space chemical propulsion systems and its current capabilities for spacecraft propulsion system development and chemical propulsion research. The historical narrative describes the flight development activities associated with upper stage main propulsion systems such as the Saturn S-IVB as well as orbital maneuvering and reaction control systems such as the S-IVB auxiliary propulsion system, the Skylab thruster attitude control system, and many more recent activities such as Chandra, the Demonstration of Automated Rendezvous Technology (DART), X-37, the X-38 de-orbit propulsion system, the Interim Control Module, the US Propulsion Module, and multiple technology development activities. This paper also highlights MSFC s advanced chemical propulsion research capabilities, including an overview of the center s Propulsion Systems Department and ongoing activities. The authors highlight near-term and long-term technology challenges to which MSFC research and system development competencies are relevant. This paper concludes by assessing the value of the full range of aforementioned activities, strengths, and capabilities in light of NASA s exploration missions.
Surface to 90 km winds for Kennedy Space Center, Florida, and Vandenberg AFB, California
Johnson, D. L.; Brown, S. C.
1979-01-01
Bivariate normal wind statistics for a 90 degree flight azimuth, from 0 through 90 km altitude, for Kennedy Space Center, Florida, and Vandenberg AFB, California are presented. Wind probability distributions and statistics for any rotation of axes can be computed from the five given parameters.
The National Space Science and Technology Center's Education and Public Outreach Program
Cox, G. N.; Denson, R. L.
2004-12-01
The objective of the National Space Science and Technology Center's (NSSTC) Education and Public Outreach program (EPO) is to support K-20 education by coalescing academic, government, and business constituents awareness, implementing best business/education practices, and providing stewardship over funds and programs that promote a symbiotic relationship among these entities, specifically in the area of K-20 Science, Technology, Engineering, and Mathematics (STEM) education. NSSTC EPO Program's long-term objective is to showcase its effective community-based integrated stakeholder model in support of STEM education and to expand its influence across the Southeast region for scaling ultimately across the United States. The Education and Public Outreach program (EPO) is coordinated by a supporting arm of the NSSTC Administrative Council called the EPO Council (EPOC). The EPOC is funded through federal, state, and private grants, donations, and in-kind contributions. It is comprised of representatives of NSSTC Research Centers, both educators and scientists from the Alabama Space Science and Technology Alliance (SSTA) member institutions, the Alabama Space Grant Consortium and the NASA Marshall Space Flight Center's (MSFC) Education Office. Through its affiliation with MSFC and the SSTA - a consortium of Alabama's research universities that comprise the NSSTC, EPO fosters the education and development of the next generation of Alabama scientists and engineers by coordinating activities at the K-20 level in cooperation with the Alabama Department of Education, the Alabama Commission on Higher Education, and Alabama's businesses and industries. The EPO program's primary objective is to be Alabama's premiere organization in uniting academia, government, and private industry by way of providing its support to the State and Federal Departments of Education involved in systemic STEM education reform, workforce development, and innovative uses of technology. The NSSTC EPO
Short, Nick, Jr.; Bedet, Jean-Jacques; Bodden, Lee; Boddy, Mark; White, Jim; Beane, John
1994-01-01
The Goddard Space Flight Center (GSFC) Distributed Active Archive Center (DAAC) has been operational since October 1, 1993. Its mission is to support the Earth Observing System (EOS) by providing rapid access to EOS data and analysis products, and to test Earth Observing System Data and Information System (EOSDIS) design concepts. One of the challenges is to ensure quick and easy retrieval of any data archived within the DAAC's Data Archive and Distributed System (DADS). Over the 15-year life of EOS project, an estimated several Petabytes (10(exp 15)) of data will be permanently stored. Accessing that amount of information is a formidable task that will require innovative approaches. As a precursor of the full EOS system, the GSFC DAAC with a few Terabits of storage, has implemented a prototype of a constraint-based task and resource scheduler to improve the performance of the DADS. This Honeywell Task and Resource Scheduler (HTRS), developed by Honeywell Technology Center in cooperation the Information Science and Technology Branch/935, the Code X Operations Technology Program, and the GSFC DAAC, makes better use of limited resources, prevents backlog of data, provides information about resources bottlenecks and performance characteristics. The prototype which is developed concurrently with the GSFC Version 0 (V0) DADS, models DADS activities such as ingestion and distribution with priority, precedence, resource requirements (disk and network bandwidth) and temporal constraints. HTRS supports schedule updates, insertions, and retrieval of task information via an Application Program Interface (API). The prototype has demonstrated with a few examples, the substantial advantages of using HTRS over scheduling algorithms such as a First In First Out (FIFO) queue. The kernel scheduling engine for HTRS, called Kronos, has been successfully applied to several other domains such as space shuttle mission scheduling, demand flow manufacturing, and avionics communications
Johnson Space Center's Risk and Reliability Analysis Group 2008 Annual Report
Valentine, Mark; Boyer, Roger; Cross, Bob; Hamlin, Teri; Roelant, Henk; Stewart, Mike; Bigler, Mark; Winter, Scott; Reistle, Bruce; Heydorn,Dick
2009-01-01
The Johnson Space Center (JSC) Safety & Mission Assurance (S&MA) Directorate s Risk and Reliability Analysis Group provides both mathematical and engineering analysis expertise in the areas of Probabilistic Risk Assessment (PRA), Reliability and Maintainability (R&M) analysis, and data collection and analysis. The fundamental goal of this group is to provide National Aeronautics and Space Administration (NASA) decisionmakers with the necessary information to make informed decisions when evaluating personnel, flight hardware, and public safety concerns associated with current operating systems as well as with any future systems. The Analysis Group includes a staff of statistical and reliability experts with valuable backgrounds in the statistical, reliability, and engineering fields. This group includes JSC S&MA Analysis Branch personnel as well as S&MA support services contractors, such as Science Applications International Corporation (SAIC) and SoHaR. The Analysis Group s experience base includes nuclear power (both commercial and navy), manufacturing, Department of Defense, chemical, and shipping industries, as well as significant aerospace experience specifically in the Shuttle, International Space Station (ISS), and Constellation Programs. The Analysis Group partners with project and program offices, other NASA centers, NASA contractors, and universities to provide additional resources or information to the group when performing various analysis tasks. The JSC S&MA Analysis Group is recognized as a leader in risk and reliability analysis within the NASA community. Therefore, the Analysis Group is in high demand to help the Space Shuttle Program (SSP) continue to fly safely, assist in designing the next generation spacecraft for the Constellation Program (CxP), and promote advanced analytical techniques. The Analysis Section s tasks include teaching classes and instituting personnel qualification processes to enhance the professional abilities of our analysts
Space Operations Center system analysis. Volume 3, book 2: SOC system definition report, revision A
1982-01-01
The Space Operations Center (SOC) orbital space station program operations are described. A work breakdown structure for the general purpose support equipment, construction and transportation support, and resupply and logistics support systems is given. The basis for the design of each element is presented, and a mass estimate for each element supplied. The SOC build-up operation, construction, flight support, and satellite servicing operations are described. Detailed programmatics and cost analysis are presented.
Youngquist, Robert; Starr, Stanley; Krenn, Angela; Captain, Janine; Williams, Martha
2016-01-01
The National Aeronautics and Space Administration (NASA) is a major user of liquid hydrogen. In particular, NASA's John F. Kennedy (KSC) Space Center has operated facilities for handling and storing very large quantities of liquid hydrogen (LH2) since the early 1960s. Safe operations pose unique challenges and as a result NASA has invested in technology development to improve operational efficiency and safety. This paper reviews recent innovations including methods of leak and fire detection and aspects of large storage tank health and integrity. We also discuss the use of liquid hydrogen in space and issues we are addressing to ensure safe and efficient operations should hydrogen be used as a propellant derived from in-situ volatiles.
Energy Technology Data Exchange (ETDEWEB)
Matadamas C, N
1996-12-31
Titanium stabilized stainless steels have been utilized in sovietic pressurized water reactors (VVER) for avoid the susceptibility to Intergranular Corrosion (IGC) present in other austenitic stainless steels. However the Intergranular Corrosion resistance of this kind of materials has been questioned because of Intergranular Stress Corrosion Cracking failures (IGSCC) have been reported. This paper study the electrochemical behavior of the AISI 321 stainless steel in a H{sub 3}BO{sub 3} Solution contaminated with chlorides and its susceptibility to Intergranular Corrosion.Electrochemical prediction diagrams of the stainless steels AISI 321 and 12X18H10T (sovietic) sensitized (600 Centigrade, 3 h.) were compared. Cylindrical and conical samples were used in Slow Strain Rate Tests (SSRT), to determine the susceptibility to Stress Corrosion Cracking (SCC) in AISI 321 and 12X18H10T stainless steels. The results obtained showed that the temperature of the solution is a very important factor to detect this susceptibility. Fractography studies on the fracture surfaces of the samples obtained in the SSRT at high temperature were realized. Corrosion velocities of both AISI 321 and 12X18H10T stainless steels were determined using conical samples in the CERT system at high temperature. E.D.A.X. analysis was employed in both AISI 321 and 12X18H10T stainless steels in order to explain the degree of sensitization. (Author).
USBI Booster Production Company's Hazardous Waste Management Program at the Kennedy Space Center, FL
Venuto, Charles
1987-01-01
In response to the hazardous-waste generating processes associated with the launch of the Space Shuttle, a hazardous waste management plan has been developed. It includes waste recycling, product substitution, waste treatment, and waste minimization at the source. Waste material resulting from the preparation of the nonmotor segments of the solid rocket boosters include waste paints (primer, topcoats), waste solvents (methylene chloride, freon, acetone, toluene), waste inorganic compounds (aluminum anodizing compound, fixer), and others. Ways in which these materials are contended with at the Kennedy Space Center are discussed.
The proposed EROSpace institute, a national center operated by space grant universities
Smith, Paul L.; Swiden, LaDell R.; Waltz, Frederick A.
1993-01-01
The "EROSpace Institute" is a proposed visiting scientist program in associated with the U.S. Geological Survey's EROS Data Center (EDC). The Institute would be operated by a consortium of universities, possible drawn from NASA's Space Grant College and Fellowship Program consortia and the group of 17 capability-enhancement consortia, or perhaps from consortia though out the nation with a topical interest in remote sensing. The National Center for Atmospheric Research or the Goddard Institute for Space Studies provide models for the structure of such an institute. The objectives of the Institute are to provide ready access to the body of data housed at the EDC and to increase the cadre of knowledgeable and trained scientists able to deal with the increasing volume of remote sensing data to become available from the Earth Observing System. The Institute would have a staff of about 100 scientists at any one time, about half permanent staff, and half visiting scientists. The latter would include graduate and undergraduate students, as well as faculty on temporary visits, summer fellowships, or sabbatical leaves. The Institute would provide office and computing facilities, as well as Internet linkages to the home institutions so that scientists could continue to participate in the program from their home base.
ONAV - An Expert System for the Space Shuttle Mission Control Center
Mills, Malise; Wang, Lui
1992-01-01
The ONAV (Onboard Navigation) Expert System is being developed as a real-time console assistant to the ONAV flight controller for use in the Mission Control Center at the Johnson Space Center. Currently, Oct. 1991, the entry and ascent systems have been certified for use on console as support tools, and were used for STS-48. The rendezvous system is in verification with the goal to have the system certified for STS-49, Intelsat retrieval. To arrive at this stage, from a prototype to real-world application, the ONAV project has had to deal with not only Al issues but operating environment issues. The Al issues included the maturity of Al languages and the debugging tools, verification, and availability, stability and size of the expert pool. The environmental issues included real time data acquisition, hardware suitability, and how to achieve acceptance by users and management.
Homan, Jonathan L.; Cerimele, Mary P.; Montz, Michael E.; Bachtel, Russell; Speed, John; O'Rear, Patrick
2013-01-01
Chamber A is the largest thermal vacuum chamber at the Johnson Space Center and is one of the largest space environment chambers in the world. The chamber is 19.8 m (65 ft) in diameter and 36.6 m (120 ft) tall and is equipped with cryogenic liquid nitrogen panels (shrouds) and gaseous helium shrouds to create a simulated space environment. It was originally designed and built in the mid 1960 s to test the Apollo Command and Service Module and several manned tests were conducted on that spacecraft, contributing to the success of the program. The chamber has been used since that time to test spacecraft active thermal control systems, Shuttle DTO, DOD, and ESA hardware in simulated Low Earth Orbit (LEO) conditions. NASA is now moving from LEO towards exploration of locations with environments approaching those of deep space. Therefore, Chamber A has undergone major modifications to enable it to simulate these deeper space environments. Environmental requirements were driven, and modifications were funded by the James Webb Space Telescope program, and this telescope which will orbit Solar/Earth L2, will be the first test article to benefit from the chamber s new capabilities. To accommodate JWST, the Chamber A high vacuum system has been modernized, additional LN2 shrouds have been installed, the liquid nitrogen system has been modified to remove dependency on electrical power and increase its reliability, a new helium shroud/refrigeration system has been installed to create a colder more stable and uniform heat sink, and the controls have been updated to increase the level of automation and improve operator interfaces. Testing of these major modifications was conducted in August of 2012 and this initial test was very successful, with all major systems exceeding their performance requirements. This paper will outline the changes in overall environmental requirements, discuss the technical design data that was used in the decisions leading to the extensive modifications
Developing empirical lightning cessation forecast guidance for the Kennedy Space Center
Stano, Geoffrey T.
The Kennedy Space Center in east Central Florida is one of the few locations in the country that issues lightning advisories. These forecasts are vital to the daily operations of the Space Center and take on even greater significance during launch operations. The U.S. Air Force's 45th Weather Squadron (45WS), who provides forecasts for the Space Center, has a good record of forecasting the initiation of lightning near their locations of special concern. However, the remaining problem is knowing when to cancel a lightning advisory. Without specific scientific guidelines detailing cessation activity, the Weather Squadron must keep advisories in place longer than necessary to ensure the safety of personnel and equipment. This unnecessary advisory time costs the Space Center millions of dollars in lost manpower each year. This research presents storm and environmental characteristics associated with lightning cessation that then are utilized to create lightning cessation guidelines for isolated thunderstorms for use by the 45WS during the warm season months of May through September. The research uses data from the Lightning Detection and Ranging (LDAR) network at the Kennedy Space Center, which can observe intra-cloud and portions of cloud-to-ground lightning strikes. Supporting data from the Cloud-to-Ground Lightning Surveillance System (CGLSS), radar observations from the Melbourne WSR-88D, and Cape Canaveral morning radiosonde launches also are included. Characteristics of 116 thunderstorms comprising our dataset are presented. Most of these characteristics are based on LDAR-derived spark and flash data and have not been described previously. In particular, the first lightning activity is quantified as either cloud-to-ground (CG) or intra-cloud (IC). Only 10% of the storms in this research are found to initiate with a CG strike. Conversely, only 16% of the storms end with a CG strike. Another characteristic is the average horizontal extent of all the flashes
Vibrational relaxation of NO+ (v=3,2,1) by various neutrals
International Nuclear Information System (INIS)
Dobler, W.; Federer, W.; Howorka, F.; Durup-Ferguson, M.; Lindinger, W.
1983-01-01
The quenching of state selected NO + (v=3,2,1) by various neutrals has been investigated in a SIFDT in the energy range from thermal to about 1 eV, KEsub(cm). With a few exceptions, the quenching rate coefficients decline with increasing KEsub(cm), indicating complex formation. The quenching rate coefficients increase strongly with increasing polarizability of the neutrals, however the rare gases do not fit into this pattern. (Authors)
Environmental Assessment for the California Space Center at Vandenberg Air Force Base, California
2010-04-08
shallow- rooted , mesophylic plant species that Chapter 3. Affected Environment Final Draft Environmental Assessment - California Space Center...buckwheat flowers and buds where the larvae feed until maturation. Upon maturation larvae burrow into the soil and pupate, usually within the root and...terrain, sharp or protruding objects, slippery soils or mud, and biological hazards including vegetation (i.e. poison oak and stinging nettle
Characterization Of Oxide Layers Produced On The AISI 321 Stainless Steel After Annealing
Directory of Open Access Journals (Sweden)
Bochnowski W.
2015-09-01
Full Text Available In this study, the structure, chemical composition and topography of oxide layers produced on the surface of the AISI 321 austenitic steel in the annealing process were analyzed. Heat treatment was done at 980°C temperature for 1 hour time in different conditions. The annealing was done in a ceramic furnace in oxidation atmosphere and in vacuum furnaces with cylindrical molybdenum and graphite chambers. The analysis was carried out using the following methods: a scanning electron microscope (SEM equipped with an energy-dispersive X-ray spectrometer (EDX, a transmission electron microscope (TEM equipped with an energy-dispersive X-ray spectrometer (EDX, an X-ray diffractometer (XRD, a secondary ion mass spectrometer with time-of-flight mass analyzer (TOF SIMS and an atomic force microscope (AFM. The oxide layer formed during annealing of the AISI 321 steel at 980°C consisted of sub-layers, diversified in the chemical composition. The thickness of the oxidized layer is depended on the annealing conditions. In a ceramic furnace in oxidation atmosphere, the thickness of the oxide layer was of 300-500 nm, in a vacuum furnace with molybdenum and graphite heating chambers, it ranged from 40 to 300 nm and from a few to 50 nm, respectively. TOF SIMS method allows to get average (for the surface of 100 μm × 100 μm depth profiles of concentration of particular elements and elements combined with oxygen. In oxide layers formed in vacuum furnaces there are no iron oxides. Titanium, apart from being bounded with carbon in carbides, is a component of the oxide layer formed on the surface of the AISI 321 steel.
Fonder, G. P.; Hack, P. J.; Hughes, M. R.
This paper covers two topics related to Space Fence System development: Sensor Site One / Operations Center construction and integration status including risk reduction integration and test efforts at the Moorestown, NJ Integrated Test Bed (ITB); and the planned capability of Sensor Site Two. The AN/FSY-3 Space Fence System is a ground-based system of S-band radars integrated with an Operations Center designed to greatly enhance the Air Force Space Surveillance network. The radar architecture is based on Digital Beam-forming. This capability permits tremendous user-defined flexibility to customize volume surveillance and track sectors instantaneously without impacting routine surveillance functions. Space Fence provides unprecedented sensitivity, coverage and tracking accuracy, and contributes to key mission threads with the ability to detect, track and catalog small objects in LEO, MEO and GEO. The system is net-centric and will seamlessly integrate into the existing Space Surveillance Network, providing services to external users—such as JSpOC—and coordinating handoffs to other SSN sites. Sensor Site One construction on the Kwajalein Atoll is in progress and nearing completion. The Operations Center in Huntsville, Alabama has been configured and will be integrated with Sensor Site One in the coming months. System hardware, firmware, and software is undergoing integration testing at the Mooretown, NJ ITB and will be deployed at Sensor Site One and the Operations Center. The preliminary design for Sensor Site Two is complete and will provide critical coverage, timeliness, and operational flexibility to the overall system.
NASA Johnson Space Center SBIR STTR Program Technology Innovations
Krishen, Kumar
2007-01-01
The Small Business Innovation Research (SBIR) Program increases opportunities for small businesses to participate in research and development (R&D), increases employment, and improves U.S. competitiveness. Specifically the program stimulates U.S. technological innovation by using small businesses to meet federal R&D needs, increasing private-sector commercialization of innovations derived from federal R&D, and fostering and encouraging the participation of socially disadvantaged businesses. In 2000, the Small Business Technology Transfer (STTR) Program extended and strengthened the SBIR Program, increasing its emphasis on pursuing commercial applications by awarding contracts to small business concerns for cooperative R&D with a nonprofit research institution. Modeled after the SBIR Program, STTR is nevertheless a separately funded activity. Technologies that have resulted from the Johnson Space Center SBIR STTR Program include: a device for regenerating iodinated resin beds; laser-assisted in-situ keratomileusis or LASIK; a miniature physiological monitoring device capable of collecting and analyzing a multitude of real-time signals to transmit medical data from remote locations to medical centers for diagnosis and intervention; a new thermal management system for fibers and fabrics giving rise to new line of garments and thermal-enhancing environments; and a highly electropositive material that attracts and retains electronegative particles in water.
Independence of automorphism group, center, and state space of quantum logics
International Nuclear Information System (INIS)
Navara, M.
1992-01-01
We prove that quantum logics (-orthomodular posets) admit full independence of the attributes important within the foundations of quantum mechanics. Namely, we present the construction of quantum logics with given sublogics (=physical subsystems), automorphism groups, centers (=open-quotes classical partsclose quotes of the systems), and state spaces. Thus, all these open-quotes parametersclose quotes are independent. Our result is rooted in the line of investigation carried out by Greechie; Kallus and Trnkova; Kalmbach; and Navara and Ptak; and considerably enriches the known algebraic methods in orthomodular posets. 19 refs., 1 fig
Kemi, S.; Turner, P.; Norberg, O.
Sounding rocket and balloon launches have been conducted since more than 30 years at ESRANGE - the European Sounding Rocket Launching Range of SSC, the Swedish Space Corporation of Kiruna in North-Sweden. MORABA - the Mobile Rocket Base of DLR German Aerospace Center at München-Oberpfaffenhofen, Germany, has planned and implemented sounding rocket and balloon launches on occasions throughout the globe during more than 30 years. An evolutionary step of sounding rocket launches is undertaken with the creation of EuroLaunch. EuroLaunch has recently been formed by SSC, the Swedish Space Corporation, and DLR, the German Aerospace Center. With EuroLaunch the long-lasting co-operation of the two complementary technical centers ESRANGE and MORABA is being enhanced and intensified, and this co-operation may also be the start of a future European Network of Center for sounding rockets. The comprehensive competence within the scope of the Network of Centers in Europa will be presented. The consolidation of competencies and work distribution among the partners shall be detailed. The managerial structure of EuroLaunch and the embedding in the mother organizations SSC and DLR respectively will be explained. The newly organized EuroLaunch is expected to provide improved services to experimenters in Europe and worldwide with improved competence, capability and efficiency.
42 CFR 447.321 - Outpatient hospital and clinic services: Application of upper payment limits.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Outpatient hospital and clinic services... SERVICES Payment Methods for Other Institutional and Noninstitutional Services Outpatient Hospital and Clinic Services § 447.321 Outpatient hospital and clinic services: Application of upper payment limits...
1996-01-01
Marshall Space Flight Center's (MSFC's) Advanced Studies, Research, Technology, and Technology Transfer projects are summarized in this report. The focus of the report is on the three spotlights at MSFC in 1995: space transportation technology, microgravity research, and technology transfer.
Homan, Jonathan L.; Lauterbach, John; Garcia, Sam
2016-01-01
Chamber A is the largest thermal vacuum chamber at the Johnson Space Center and is one of the largest space environment chambers in the world. The chamber is 19.8 m (65 ft) in diameter and 36.6 m (120 ft) tall and is equipped with cryogenic liquid nitrogen panels (shrouds) and gaseous helium shrouds to create a simulated space environment. The chamber was originally built to support testing of the Apollo Service and Command Module for lunar missions, but underwent major modifications to be able to test the James Webb Space Telescope in a simulated deep space environment. To date seven tests have been performed in preparation of testing the flight optics for the James Webb Space Telescope (JWST). Each test has had a uniquie thermal profile and set of thermal requirements for cooling down and warming up, controlling contamination, and releasing condensed air. These range from temperatures from 335K to 15K, with tight uniformity and controllability for maintining thermal stability and pressure control. One unique requirement for two test was structurally proof loading hardware by creating thermal gradients at specific temperatures. This paper will discuss the thermal requirements and goals of the tests, the original requirements of the chamber thermal systems for planned operation, and how the new requirements were met by the team using the hardware, system flexiblilty, and engineering creativity. It will also discuss the mistakes and successes to meet the unique goals, especially when meeting the thermal proof load.
Bloomfield, H. S.; Sovie, R. J.
1991-01-01
The history of the NASA Lewis Research Center's role in space nuclear power programs is reviewed. Lewis has provided leadership in research, development, and the advancement of space power and propulsion systems. Lewis' pioneering efforts in nuclear reactor technology, shielding, high temperature materials, fluid dynamics, heat transfer, mechanical and direct energy conversion, high-energy propellants, electric propulsion and high performance rocket fuels and nozzles have led to significant technical and management roles in many natural space nuclear power and propulsion programs.
Bloomfield, H. S.; Sovie, R. J.
1991-01-01
The history of the NASA Lewis Research Center's role in space nuclear power programs is reviewed. Lewis has provided leadership in research, development, and the advancement of space power and propulsion systems. Lewis' pioneering efforts in nuclear reactor technology, shielding, high temperature materials, fluid dynamics, heat transfer, mechanical and direct energy conversion, high-energy propellants, electric propulsion and high performance rocket fuels and nozzles have led to significant technical and management roles in many national space nuclear power and propulsion programs.
Noseda, Paula
2017-01-01
A fines de enero de este año 2017, entró en vigencia la Ley N° 14.867 que regula la actividad de engorde intensivo a corral de bovinos y bubalinos en la Provincia de Buenos Aires. Con este comentario se pretende evaluar las ventajas y desventajas de contar con éste nuevo régimen, considerando la normativa agroambiental marco, la posición de la doctrina y la jurisprudencia bonaerense vigente en la materia.
International Nuclear Information System (INIS)
Matadamas C, N.
1995-01-01
Titanium stabilized stainless steels have been utilized in sovietic pressurized water reactors (VVER) for avoid the susceptibility to Intergranular Corrosion (IGC) present in other austenitic stainless steels. However the Intergranular Corrosion resistance of this kind of materials has been questioned because of Intergranular Stress Corrosion Cracking failures (IGSCC) have been reported. This paper study the electrochemical behavior of the AISI 321 stainless steel in a H 3 BO 3 Solution contaminated with chlorides and its susceptibility to Intergranular Corrosion.Electrochemical prediction diagrams of the stainless steels AISI 321 and 12X18H10T (sovietic) sensitized (600 Centigrade, 3 h.) were compared. Cylindrical and conical samples were used in Slow Strain Rate Tests (SSRT), to determine the susceptibility to Stress Corrosion Cracking (SCC) in AISI 321 and 12X18H10T stainless steels. The results obtained showed that the temperature of the solution is a very important factor to detect this susceptibility. Fractography studies on the fracture surfaces of the samples obtained in the SSRT at high temperature were realized. Corrosion velocities of both AISI 321 and 12X18H10T stainless steels were determined using conical samples in the CERT system at high temperature. E.D.A.X. analysis was employed in both AISI 321 and 12X18H10T stainless steels in order to explain the degree of sensitization. (Author)
Kennedy Space Center ITC-1 Internship Overview
Ni, Marcus
2011-01-01
As an intern for Priscilla Elfrey in the ITC-1 department, I was involved in many activities that have helped me to develop many new skills. I supported four different projects during my internship, which included the Center for Life Cycle Design (CfLCD), SISO Space Interoperability Smackdown, RTI Teacher Mentor Program, and the Discrete Event Simulation Integrated Visualization Environment Team (DIVE). I provided the CfLCD with web based research on cyber security initiatives involving simulation, education for young children, cloud computing, Otronicon, and Science, Technology, Engineering, and Mathematics (STEM) education initiatives. I also attended STEM meetings regarding simulation courses, and educational course enhancements. To further improve the SISO Simulation event, I provided observation feedback to the technical advisory board. I also helped to set up a chat federation for HLA. The third project involved the RTI Teacher Mentor program, which I helped to organize. Last, but not least, I worked with the DIVE team to develop new software to help visualize discrete event simulations. All of these projects have provided experience on an interdisciplinary level ranging from speech and communication to solving complex problems using math and science.
International Nuclear Information System (INIS)
Galli, V.L.; Lucki, G.
1980-01-01
Data about influence of neutron irradiation on the microhardness of stainless steel of type AISI 321 with 0.05 and 0.1wt.% Nb additions are presented. The microhardness measurements were made in the range of 300 to 650 0 C, before and after fast neutron irradiation with fluences about 10 17 n/cm 2 . Our results indicate that radiation damage peaks occur around 480 0 C for the stainless steel of type AISI 321 without Nb addition, around 500 0 C for the composition with 0.05 wt.% Nb addition and around 570 0 C for the composition with 0.1 wt.% Nb addition. Microhardness data are in agreement with those obtained by means of electrical resistivity measurements, performed at the same conditions. (Author) [pt
Development of the CELSS emulator at NASA. Johnson Space Center
Cullingford, Hatice S.
1990-01-01
The Closed Ecological Life Support System (CELSS) Emulator is under development. It will be used to investigate computer simulations of integrated CELSS operations involving humans, plants, and process machinery. Described here is Version 1.0 of the CELSS Emulator that was initiated in 1988 on the Johnson Space Center (JSC) Multi Purpose Applications Console Test Bed as the simulation framework. The run model of the simulation system now contains a CELSS model called BLSS. The CELSS simulator empowers us to generate model data sets, store libraries of results for further analysis, and also display plots of model variables as a function of time. The progress of the project is presented with sample test runs and simulation display pages.
Time-resolved plasma parameters in the HiPIMS discharge with Ti target in Ar/O2 atmosphere
Czech Academy of Sciences Publication Activity Database
Čada, Martin; Hubička, Zdeněk; Adámek, Petr; Klusoň, Jan; Jastrabík, Lubomír
2011-01-01
Roč. 205, č. 2 (2011), S317-S321 ISSN 0257-8972 R&D Projects: GA ČR GP202/09/P159; GA AV ČR KJB100100805; GA MŠk(CZ) 1M06002; GA AV ČR KAN400720701; GA ČR GA202/09/0800 Institutional research plan: CEZ:AV0Z10100522 Keywords : HiPIMS * Langmuir probe * ion flux * reactive sputtering Subject RIV: BH - Optics, Masers, Lasers Impact factor: 1.867, year: 2011
Effect of Cl on the corrosive wear of AISI 321 stainless steel in ...
Indian Academy of Sciences (India)
Unknown
2002-07-25
Jul 25, 2002 ... The passivation current oscillates tremendously due to the coexistence of passive and active ions in the solution with 0⋅2 mol/l Cl–. 3.2 Corrosive wear behaviour of 321 stainless steel in Cl– + H2SO4 solution at free corrosion and passive potentials. The relationship between corrosive wear rate and Cl–.
Synthesis of Highly Functionalised Enantiopure Bicyclo[3.2.1]- octane Systems from Carvone
Directory of Open Access Journals (Sweden)
Noelia Vera
2004-04-01
Full Text Available The commercially available monoterpene carvone has been efficiently convertedinto the tricyclo[3.2.1.02.7]octane and bicyclo[3.2.1]octane systems characteristic of somebiologically active compounds. The sequence used for this transformation involves as keyfeatures an intramolecular Diels-Alder reaction of a 5-vinyl-1,3-cyclohexadiene and acyclopropane ring opening.
An evaluation of the Goddard Space Flight Center Library
Herner, S.; Lancaster, F. W.; Wright, N.; Ockerman, L.; Shearer, B.; Greenspan, S.; Mccartney, J.; Vellucci, M.
1979-01-01
The character and degree of coincidence between the current and future missions, programs, and projects of the Goddard Space Flight Center and the current and future collection, services, and facilities of its library were determined from structured interviews and discussions with various classes of facility personnel. In addition to the tabulation and interpretation of the data from the structured interview survey, five types of statistical analyses were performed to corroborate (or contradict) the survey results and to produce useful information not readily attainable through survey material. Conclusions reached regarding compatability between needs and holdings, services and buildings, library hours of operation, methods of early detection and anticipation of changing holdings requirements, and the impact of near future programs are presented along with a list of statistics needing collection, organization, and interpretation on a continuing or longitudinal basis.
Nguyen, Hanson C.; Fraction, James; Ortiz-Acosta, Melyane; Dakermanji, George; Kercheval, Bradford P.; Hernandez-Pellerano, Amri; Kim, David S.; Jung, David S.; Meyer, Steven E.; Mallik, Udayan;
2016-01-01
The Goddard Modular Smallsat Architecture (GMSA) is developed at NASA Goddard Space Flight Center (GSFC) to address future reliability along with minimizing cost and schedule challenges for NASA Cubesat and Smallsat missions.
Souza, Kenneth (Editor); Etheridge, Guy (Editor); Callahan, Paul X. (Editor)
2000-01-01
We have now conducted space life sciences research for more than four decades. The continuing interest in studying the way living systems function in space derives from two main benefits of that research. First, in order for humans to engage in long-term space travel, we must understand and develop measures to counteract the most detrimental effects of space flight on biological systems. Problems in returning to the conditions of Earth must be kept to a manageable level. Second, increasing our understanding of how organisms function in the absence of gravity gives us new understanding of fundamental biological processes. This information can be used to improve human health and the quality of life on Earth.
The precipitation behavior of titanium carbide on the surface of SUS 321 stainless steel
International Nuclear Information System (INIS)
Yoshihara, Kazuhiro; Nii, Kazuyoshi
1982-01-01
The surface composition of SUS 321 stainless steel at high temperatures was observed in vacuum with Auger electron spectroscopy. The precipitation of titanium carbide was found on the surface of SUS 321. The thickness of precipitated titanium carbide layer increased in proportion to the square root of annealing time and became about 0.05 μm after heated at 1100 K for 432 ks. The precipitated titanium carbide was not replaced by the most surface active element sulfur, and remained stable on the surface. The precipitated layer, however, was not even and had many holes about 1 μm in diameter. The bottom of a hole was SUS 321, on which phosphorus, oxygen and sulfur segregated. As the annealing time was prolonged, these segregants were replaced one by one in the order of the surface activity, and finally the most surface active element, sulfur, remained on the bottom of the hole. Moreover, sulfur diffused over the outside of the hole. The precipitation of titanium carbide on the surface occurred according to the following processes: (1) The titanium and carbon which had been dissolved in the bulk diffused onto the surface of the stainless steel. (2) The titanium carbide which had been precipitated in the bulk dissolved because the concentration of titanum and carbon fell under their solubility limits in the bulk. (3) The titanium and carbon diffused onto the surface which was exposed to vacuum. (4) The titanium and carbon recombined into titanium carbide and precipitated on the surface. The growth rate of the thickness of the precipitated layer was controlled by the diffusion of titanium and carbon in the precipitated titanium carbide. (J.P.N.)
Development of a EUV Test Facility at the Marshall Space Flight Center
West, Edward; Pavelitz, Steve; Kobayashi, Ken; Robinson, Brian; Cirtain, Johnathan; Gaskin, Jessica; Winebarger, Amy
2011-01-01
This paper will describe a new EUV test facility that is being developed at the Marshall Space Flight Center (MSFC) to test EUV telescopes. Two flight programs, HiC - high resolution coronal imager (sounding rocket) and SUVI - Solar Ultraviolet Imager (GOES-R), set the requirements for this new facility. This paper will discuss those requirements, the EUV source characteristics, the wavelength resolution that is expected and the vacuum chambers (Stray Light Facility, Xray Calibration Facility and the EUV test chamber) where this facility will be used.
'Death Star' Galaxy Black Hole Fires at Neighboring Galaxy
2008-12-01
This "death star" galaxy was discovered through the combined efforts of both space and ground-based telescopes. NASA's Chandra X-ray Observatory, Hubble Space Telescope, and Spitzer Space Telescope were part of the effort. The Very Large Array telescope, Socorro, N.M., and the Multi-Element Radio Linked Interferometer Network (MERLIN) telescopes in the United Kingdom also were needed for the finding. Illustration of Jet Striking Galaxy (unlabeled) Illustration of Jet Striking Galaxy (unlabeled) "We've seen many jets produced by black holes, but this is the first time we've seen one punch into another galaxy like we're seeing here," said Dan Evans, a scientist at the Harvard-Smithsonian Center for Astrophysics and leader of the study. "This jet could be causing all sorts of problems for the smaller galaxy it is pummeling." Jets from super massive black holes produce high amounts of radiation, especially high-energy X-rays and gamma-rays, which can be lethal in large quantities. The combined effects of this radiation and particles traveling at almost the speed of light could severely damage the atmospheres of planets lying in the path of the jet. For example, protective layers of ozone in the upper atmosphere of planets could be destroyed. X-ray & Radio Full Field Image of 3C321 X-ray & Radio Full Field Image of 3C321 Jets produced by super massive black holes transport enormous amounts of energy far from black holes and enable them to affect matter on scales vastly larger than the size of the black hole. Learning more about jets is a key goal for astrophysical research. "We see jets all over the Universe, but we're still struggling to understand some of their basic properties," said co-investigator Martin Hardcastle of the University of Hertfordshire, United Kingdom. "This system of 3C321 gives us a chance to learn how they're affected when they slam into something - like a galaxy - and what they do after that." Optical Image of 3C321 Optical Image of 3C321 The
Contamination Control and Hardware Processing Solutions at Marshall Space Flight Center
Burns, DeWitt H.; Hampton, Tammy; Huey, LaQuieta; Mitchell, Mark; Norwood, Joey; Lowrey, Nikki
2012-01-01
The Contamination Control Team of Marshall Space Flight Center's Materials and Processes Laboratory supports many Programs/ Projects that design, manufacture, and test a wide range of hardware types that are sensitive to contamination and foreign object damage (FOD). Examples where contamination/FOD concerns arise include sensitive structural bondline failure, critical orifice blockage, seal leakage, and reactive fluid compatibility (liquid oxygen, hydrazine) as well as performance degradation of sensitive instruments or spacecraft surfaces such as optical elements and thermal control systems. During the design phase, determination of the sensitivity of a hardware system to different types or levels of contamination/FOD is essential. A contamination control and FOD control plan must then be developed and implemented through all phases of ground processing, and, sometimes, on-orbit use, recovery, and refurbishment. Implementation of proper controls prevents cost and schedule impacts due to hardware damage or rework and helps assure mission success. Current capabilities are being used to support recent and on-going activities for multiple Mission Directorates / Programs such as International Space Station (ISS), James Webb Space Telescope (JWST), Space Launch System (SLS) elements (tanks, engines, booster), etc. The team also advances Green Technology initiatives and addresses materials obsolescence issues for NASA and external customers, most notably in the area of solvent replacement (e.g. aqueous cleaners containing hexavalent chrome, ozone depleting chemicals (CFC s and HCFC's), suspect carcinogens). The team evaluates new surface cleanliness inspection and cleaning technologies (e.g. plasma cleaning), and maintains databases for processing support materials as well as outgassing and optical compatibility test results for spaceflight environments.
Plasma Liner Research for MTF at NASA Marshall Space Flight Center
Thio, Y. C. F.; Eskridge, R.; Lee, M.; Martin, A.; Smith, J.; Cassibry, J. T.; Wu, S. T.; Kirkpatrick, R. C.; Knapp, C. E.; Turchi, P. J.;
2002-01-01
The current research effort at NASA Marshall Space Flight Center (MSFC) in MTF is directed towards exploring the critical physics issues of potential embodiments of MTF for propulsion, especially standoff drivers involving plasma liners for MTF. There are several possible approaches for forming plasma liners. One approach consists of using a spherical array of plasma jets to form a spherical plasma shell imploding towards the center of a magnetized plasma, a compact toroid. Current experimental plan and status to explore the physics of forming a 2-D plasma liner (shell) by merging plasma jets are described. A first-generation coaxial plasma guns (Mark-1) to launch the required plasma jets have been built and tested. Plasma jets have been launched reproducibly with a low jitter, and velocities in excess of 50 km/s for the leading edge of the plasma jet. Some further refinements are being explored for the plasma gun, Successful completion of these single-gun tests will be followed by an experimental exploration of the problems of launching a multiple number of these jets simultaneously to form a cylindrical plasma liner.
The management approach to the NASA space station definition studies at the Manned Spacecraft Center
Heberlig, J. C.
1972-01-01
The overall management approach to the NASA Phase B definition studies for space stations, which were initiated in September 1969 and completed in July 1972, is reviewed with particular emphasis placed on the management approach used by the Manned Spacecraft Center. The internal working organizations of the Manned Spacecraft Center and its prime contractor, North American Rockwell, are delineated along with the interfacing techniques used for the joint Government and industry study. Working interfaces with other NASA centers, industry, and Government agencies are briefly highlighted. The controlling documentation for the study (such as guidelines and constraints, bibliography, and key personnel) is reviewed. The historical background and content of the experiment program prepared for use in this Phase B study are outlined and management concepts that may be considered for future programs are proposed.
Allen, J. S.
2009-12-01
NASA is eager for students and the public to experience lunar Apollo rocks and regolith soils first hand. Lunar samples embedded in plastic are available for educators to use in their classrooms, museums, science centers, and public libraries for education activities and display. The sample education disks are valuable tools for engaging students in the exploration of the Solar System. Scientific research conducted on the Apollo rocks has revealed the early history of our Earth-Moon system. The rocks help educators make the connections to this ancient history of our planet as well as connections to the basic lunar surface processes - impact and volcanism. With these samples educators in museums, science centers, libraries, and classrooms can help students and the public understand the key questions pursued by missions to Moon. The Office of the Curator at Johnson Space Center is in the process of reorganizing and renewing the Lunar and Meteorite Sample Education Disk Program to increase reach, security and accountability. The new program expands the reach of these exciting extraterrestrial rocks through increased access to training and educator borrowing. One of the expanded opportunities is that trained certified educators from science centers, museums, and libraries may now borrow the extraterrestrial rock samples. Previously the loan program was only open to classroom educators so the expansion will increase the public access to the samples and allow educators to make the critical connections of the rocks to the exciting exploration missions taking place in our solar system. Each Lunar Disk contains three lunar rocks and three regolith soils embedded in Lucite. The anorthosite sample is a part of the magma ocean formed on the surface of Moon in the early melting period, the basalt is part of the extensive lunar mare lava flows, and the breccias sample is an important example of the violent impact history of the Moon. The disks also include two regolith soils and
Myers, Matthew G.; Prokop, Norman F.; Krasowski, Michael J.; Piszczor, Michael F.; McNatt, Jeremiah S.
2016-01-01
Accurate air mass zero (AM0) measurement is essential for the evaluation of new photovoltaic (PV) technology for space solar cells. The NASA Glenn Research Center (GRC) has flown an experiment designed to measure the electrical performance of several solar cells onboard NASA Goddard Space Flight Center's (GSFC) Robotic Refueling Mission's (RRM) Task Board 4 (TB4) on the exterior of the International Space Station (ISS). Four industry and government partners provided advanced PV devices for measurement and orbital environment testing. The experiment was positioned on the exterior of the station for approximately eight months, and was completely self-contained, providing its own power and internal data storage. Several new cell technologies including four-junction (4J) Inverted Metamorphic Multi-Junction (IMM) cells were evaluated and the results will be compared to ground-based measurement methods.
National Aeronautics and Space Administration Manned Spacecraft Center data base requirements study
1971-01-01
A study was conducted to evaluate the types of data that the Manned Spacecraft Center (MSC) should automate in order to make available essential management and technical information to support MSC's various functions and missions. In addition, the software and hardware capabilities to best handle the storage and retrieval of this data were analyzed. Based on the results of this study, recommendations are presented for a unified data base that provides a cost effective solution to MSC's data automation requirements. The recommendations are projected through a time frame that includes the earth orbit space station.
Internal Social Media at Marshall Space Flight Center - An Engineer's Snapshot
Scott, David W.
2013-01-01
In the brief span of about six years (2004-2010), social media radically enhanced people's ways of maintaining recreational friendships. Social media's impact on public affairs (PAO) and community engagement is equally striking: NASA has involved millions of non-NASA viewers in its activities via outward-facing social media, often in a very two-way street fashion. Use of social media as an internal working tool by NASA's tens of thousands of civil servants, onsite contractor employees, and external stakeholders is evolving more slowly. This paper examines, from an engineer's perspective, Marshall Space Flight Center s (MSFC) efforts to bring the power of social media to the daily working environment. Primary emphasis is on an internal Social Networking Service called Explornet that could be scaled Agency-wide. Other topics include MSFC use of other social media day-to-day for non-PAO purposes, some specialized uses of social techniques in space flight control operations, and how to help a community open up so it can discover and adopt what works well.
Ballard, Richard O.
2007-01-01
In 2005-06, the Prometheus program funded a number of tasks at the NASA-Marshall Space Flight Center (MSFC) to support development of a Nuclear Thermal Propulsion (NTP) system for future manned exploration missions. These tasks include the following: 1. NTP Design Develop Test & Evaluate (DDT&E) Planning 2. NTP Mission & Systems Analysis / Stage Concepts & Engine Requirements 3. NTP Engine System Trade Space Analysis and Studies 4. NTP Engine Ground Test Facility Assessment 5. Non-Nuclear Environmental Simulator (NTREES) 6. Non-Nuclear Materials Fabrication & Evaluation 7. Multi-Physics TCA Modeling. This presentation is a overview of these tasks and their accomplishments
Directory of Open Access Journals (Sweden)
Gligorov Joseph
2010-07-01
Full Text Available Abstract Background IMP321 is a recombinant soluble LAG-3Ig fusion protein that binds to MHC class II with high avidity and mediates APC and then antigen-experienced memory CD8+ T cell activation. We report clinical and biological results of a phase I/II in patients with metastatic breast carcinoma (MBC receiving first-line paclitaxel weekly, 3 weeks out of 4. Methods MBC patients were administered one dose of IMP321 s.c. every two weeks for a total of 24 weeks (12 injections. The repeated single doses were administered the day after chemotherapy at D2 and D16 of the 28-day cycles of paclitaxel (80 mg/m2 at D1, D8 and D15, for 6 cycles. Blood samples were taken 13 days after the sixth and the twelfth IMP321 injections to determine sustained APC, NK and memory CD8 T cell responses. Results Thirty MBC patients received IMP321 in three cohorts (doses: 0.25, 1.25 and 6.25 mg. IMP321 induced both a sustained increase in the number and activation of APC (monocytes and dendritic cells and an increase in the percentage of NK and long-lived cytotoxic effector-memory CD8 T cells. Clinical benefit was observed for 90% of patients with only 3 progressors at 6 months. Also, the objective tumor response rate of 50% compared favorably to the 25% rate reported in the historical control group. Conclusions The absence of toxicity and the demonstration of activity strongly support the future development of this agent for clinical use in combined first-line regimens. Trial registration ClinicalTrials.gov NCT00349934
NASA's engineering research centers and interdisciplinary education
Johnston, Gordon I.
1990-01-01
A new program of interactive education between NASA and the academic community aims to improve research and education, provide long-term, stable funding, and support cross-disciplinary and multi-disciplinary research. The mission of NASA's Office of Aeronautics, Exploration and Technology (OAET) is discussed and it is pointed out that the OAET conducts about 10 percent of its total R&D program at U.S. universities. Other NASA university-based programs are listed including the Office of Commercial Programs Centers for the Commercial Development of Space (CCDS) and the National Space Grant program. The importance of university space engineering centers and the selection of the nine current centers are discussed. A detailed composite description is provided of the University Space Engineering Research Centers. Other specialized centers are described such as the Center for Space Construction, the Mars Mission Research Center, and the Center for Intelligent Robotic Systems for Space Exploration. Approaches to educational outreach are discussed.
Energy Technology Data Exchange (ETDEWEB)
Lin Yimin [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, 18 Middle Tianshui Road, Lanzhou 730000 (China) and Graduate School of the Chinese Academy of Sciences, Beijing 100039 (China)]. E-mail: linyimin_2001@yahoo.com.cn; Lu Jian [LASMIS, University of Technology of Troyes, 10000 Troyes (France); Wang Liping [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, 18 Middle Tianshui Road, Lanzhou 730000 (China); Graduate School of the Chinese Academy of Sciences, Beijing 100039 (China); Xu Tao [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, 18 Middle Tianshui Road, Lanzhou 730000 (China); Xue Qunji [State Key Laboratory of Solid Lubrication, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, 18 Middle Tianshui Road, Lanzhou 730000 (China)]. E-mail: qjxue@ns.lzb.ac.cn
2006-12-15
A plastic deformation surface layer with nanocrystalline grains was produced on AISI 321 austenitic stainless steel by means of surface mechanical attrition treatment (SMAT). Low-temperature nitriding of SMAT and un-SMAT AISI 321 stainless steel was carried out in pulsed-DC glow discharge. The effect of SMAT pretreatment on the microstructure and properties of the stainless steel were investigated using X-ray diffraction, scanning electron microscopy, transmission electron microscopy, Vickers hardness tester and UMT-2MT tribometer. The results show that the plasma nitriding of AISI 321 steel can be enhanced considerably by means of SMAT process before nitriding, and a much thicker nitrogen diffusion layer with higher hardness was obtained for the SMAT samples when compared with un-SMAT samples. In addition, the wear resistance and load capacity of the nitrided layers on the SMAT samples was much higher than that of the un-SMAT samples due to the thicker S phase case and the gradient nitrogen diffusion layer.
Kennedy Space Center Timing and Countdown Interface to Kennedy Ground Control Subsystem
Olsen, James C.
2015-01-01
Kennedy Ground Control System (KGCS) engineers at the National Aeronautics and Space Administration (NASA) Kennedy Space Center (KSC) are developing a time-tagging process to enable reconstruction of the events during a launch countdown. Such a process can be useful in the case of anomalies or other situations where it is necessary to know the exact time an event occurred. It is thus critical for the timing information to be accurate. KGCS will synchronize all items with Coordinated Universal Time (UTC) obtained from the Timing and Countdown (T&CD) organization. Network Time Protocol (NTP) is the protocol currently in place for synchronizing UTC. However, NTP has a peak error that is too high for today's standards. Precision Time Protocol (PTP) is a newer protocol with a much smaller peak error. The focus of this project has been to implement a PTP solution on the network to increase timing accuracy while introducing and configuring the implementation of a firewall between T&CD and the KGCS network.
Influence of Atomic Oxygen Exposure on Friction Behavior of 321 Stainless Steel
Liu, Y.; Yang, J.; Ye, Z.; Dong, S.; Zhang, L.; Zhang, Z.
Atomic oxygen (AO) exposure testing has been conducted on a 321 stainless steel rolled 1 mm thick sheet to simulate the effect of AO environment on steel in low Earth orbit (LEO). An atomic oxygen exposure facility was employed to carry out AO experiments with the fluence up to ~1021 atom/cm2. The AO exposed specimens were evaluated in air at room temperature using a nanoindenter and a tribological system. The exposed surfaces were analyzed usign XPS technique.
Mankari, Kamal; Acharyya, Swati Ghosh
2017-12-01
We hereby report a simple surface engineering technique to make AISI grade 321 stainless steel (SS) welds resistant to stress corrosion cracking (SCC) in chloride environment. Heat exchanger tubes of AISI 321 SS, welded either by (a) laser beam welding (LBW) or by (b) metal inert gas welding (MIG) were used for the study. The welds had high magnitude of tensile residual stresses and had undergone SCC in chloride environment while in service. The welds were characterized using field emission scanning electron microscopy (FESEM) and X-ray diffraction (XRD). Subsequently, the welded surfaces were subjected to buffing operation followed by determination of residual stress distribution and surface roughness by XRD and surface profilometer measurements respectively. The susceptibility of the welds to SCC was tested in buffed and un-buffed condition as per ASTM G-36 in boiling MgCl2 for 5 h and 10 h, followed by microstructural characterization by using optical microscope and FESEM. The results showed that the buffed surfaces (both welds and base material) were resistant to SCC even after 10 h of exposure to boiling MgCl2 whereas the un-buffed surfaces underwent severe SCC for the same exposure time. Buffing imparted high magnitude of compressive stresses on the surface of stainless steel together with reduction in its surface roughness and reduction in plastic strain on the surface which made the welded surface, resistant to chloride assisted SCC. Buffing being a very simple, portable and economic technique can be easily adapted by the designers as the last step of component fabrication to make 321 stainless steel welds resistant to chloride assisted SCC.
Denardini, Clezio Marcos; Dal Lago, Alisson; Mendes, Odim; Batista, Inez S.; SantAnna, Nilson; Gatto, Rubens; Takahashi, Hisao; Costa, D. Joaquim; Banik Padua, Marcelo; Campos Velho, Haroldo
2016-07-01
On August 2007 the National Institute for Space Research started a task force to develop and operate a space weather program, which is known by the acronyms Embrace that stands for the Portuguese statement "Estudo e Monitoramento BRAasileiro de Clima Espacial" Program (Brazilian Space Weather Study and Monitoring program). The mission of the Embrace/INPE program is to monitor the Solar-Terrestrial environment, the magnetosphere, the upper atmosphere and the ground induced currents to prevent effects on technological and economic activities. The Embrace/INPE system monitors the physical parameters of the Sun-Earth environment, such as Active Regions (AR) in the Sun and solar radiation by using radio telescope, Coronal Mass Ejection (CME) information by satellite and ground-based cosmic ray monitoring, geomagnetic activity by the magnetometer network, and ionospheric disturbance by ionospheric sounders and using data collected by four GPS receiver network, geomagnetic activity by a magnetometer network, and provides a forecasting for Total Electronic Content (TEC) - 24 hours ahead - using a version of the SUPIM model which assimilates the two latter data using nudging approach. Most of these physical parameters are daily published on the Brazilian space weather program web portal, related to the entire network sensors available. Regarding outreach, it has being published a daily bulletin in Portuguese and English with the status of the space weather environment on the Sun, the Interplanetary Medium and close to the Earth. Since December 2011, all these activities are carried out at the Embrace Headquarter, a building located at the INPE's main campus. Recently, a comprehensive data bank and an interface layer are under commissioning to allow an easy and direct access to all the space weather data collected by Embrace through the Embrace web Portal. The information being released encompasses data from: (a) the Embrace Digisonde Network (Embrace DigiNet) that monitors
NASA Marshall Space Flight Center Controls Systems Design and Analysis Branch
Gilligan, Eric
2014-01-01
Marshall Space Flight Center maintains a critical national capability in the analysis of launch vehicle flight dynamics and flight certification of GN&C algorithms. MSFC analysts are domain experts in the areas of flexible-body dynamics and control-structure interaction, thrust vector control, sloshing propellant dynamics, and advanced statistical methods. Marshall's modeling and simulation expertise has supported manned spaceflight for over 50 years. Marshall's unparalleled capability in launch vehicle guidance, navigation, and control technology stems from its rich heritage in developing, integrating, and testing launch vehicle GN&C systems dating to the early Mercury-Redstone and Saturn vehicles. The Marshall team is continuously developing novel methods for design, including advanced techniques for large-scale optimization and analysis.
Optical Characteristics of the Marshall Space Flight Center Solar Ultraviolet Magnetograph
West, E. A.; Porter, J. G.; Davis, J. M.; Gary, G. A.; Adams, M.; Smith, S.; Hraba, J. F.
2001-01-01
This paper will describe the scientific objectives of the Marshall Space Flight Center (MSFC) Solar Ultraviolet Magnetograph Investigation (SUMI) and the optical components that have been developed to meet those objectives. In order to test the scientific feasibility of measuring magnetic fields in the UV, a sounding rocket payload is being developed. This paper will discuss: (1) the scientific measurements that will be made by the SUMI sounding rocket program, (2) how the optics have been optimized for simultaneous measurements of two magnetic lines CIV (1550 Angstroms) and MgII (2800 Angstroms), and (3) the optical, reflectance, transmission and polarization measurements that have been made on the SUMI telescope mirror and polarimeter.
Voltage profile program for the Kennedy Space Center electric power distribution system
1976-01-01
The Kennedy Space Center voltage profile program computes voltages at all busses greater than 1 Kv in the network under various conditions of load. The computation is based upon power flow principles and utilizes a Newton-Raphson iterative load flow algorithm. Power flow conditions throughout the network are also provided. The computer program is designed for both steady state and transient operation. In the steady state mode, automatic tap changing of primary distribution transformers is incorporated. Under transient conditions, such as motor starts etc., it is assumed that tap changing is not accomplished so that transformer secondary voltage is allowed to sag.
Two X-38 Ship Demonstrators in Development at NASA Johnson Space Flight Center
1999-01-01
This photo shows two X-38 Crew Return Vehicle technology demonstrators under development at NASA's Johnson Space Flight Center, Houston, Texas. The X-38 Crew Return Vehicle (CRV) research project is designed to develop the technology for a prototype emergency crew return vehicle, or lifeboat, for the International Space Station. The project is also intended to develop a crew return vehicle design that could be modified for other uses, such as a joint U.S. and international human spacecraft that could be launched on the French Ariane-5 Booster. The X-38 project is using available technology and off-the-shelf equipment to significantly decrease development costs. Original estimates to develop a capsule-type crew return vehicle were estimated at more than $2 billion. X-38 project officials have estimated that development costs for the X-38 concept will be approximately one quarter of the original estimate. Off-the-shelf technology is not necessarily 'old' technology. Many of the technologies being used in the X-38 project have never before been applied to a human-flight spacecraft. For example, the X-38 flight computer is commercial equipment currently used in aircraft and the flight software operating system is a commercial system already in use in many aerospace applications. The video equipment for the X-38 is existing equipment, some of which has already flown on the space shuttle for previous NASA experiments. The X-38's primary navigational equipment, the Inertial Navigation System/Global Positioning System, is a unit already in use on Navy fighters. The X-38 electromechanical actuators come from previous joint NASA, U.S. Air Force, and U.S. Navy research and development projects. Finally, an existing special coating developed by NASA will be used on the X-38 thermal tiles to make them more durable than those used on the space shuttles. The X-38 itself was an unpiloted lifting body designed at 80 percent of the size of a projected emergency crew return vehicle
Wang, Rui-Long; Zhu-Salzman, Keyan; Baerson, Scott R; Xin, Xiao-Wei; Li, Jun; Su, Yi-Juan; Zeng, Ren-Sen
2017-04-01
Insect cytochrome P450 monooxygenases (CYPs or P450s) play an important role in detoxifying insecticides leading to resistance in insect populations. A polyphagous pest, Spodoptera litura, has developed resistance to a wide range of insecticides. In the present study, a novel P450 gene, CYP321B1, was cloned from S. litura. The function of CYP321B1 was assessed using RNA interference (RNAi) and monitoring resistance levels for three commonly used insecticides, including chlorpyrifos, β-cypermethrin and methomyl. The full-length complementary DNA sequence of CYP321B1 is 1814 bp long with an open reading frame of 1 488 bp encoding 495 amino acid residues. Quantitative reverse-transcriptase polymerase chain reaction analyses during larval and pupal development indicated that CYP321B1 expression was highest in the midgut of fifth-instar larvae, followed by fat body and cuticle. The expression of CYP321B1 in the midgut was up-regulated by chlorpyrifos, β-cypermethrin and methomyl with both lethal concentration at 15% (LC 15 ) (50, 100 and 150 μg/mL, respectively) and 50%(LC 50 ) dosages (100, 200 and 300 μg/mL, respectively). Addition of piperonyl butoxide (PBO) significantly increased the toxicity of chlorpyrifos, β-cypermethrin and methomyl to S. litura, suggesting a marked synergism of the three insecticides with PBO and P450-mediated detoxification. RNAi-mediated silencing of CYP321B1 further increased mortality by 25.6% and 38.9% when the fifth-instar larvae were exposed to chlorpyrifos and β-cypermethrin, respectively, at the LC 50 dose levels. The results demonstrate that CYP321B1 might play an important role in chlorpyrifos and β-cypermethrin detoxification in S. litura. © 2016 Institute of Zoology, Chinese Academy of Sciences.
Doshi, Aalap; Clay, Christina
2017-06-01
Space matters. We read space like we read people's faces. Space is an instrument of collaboration and innovation. At the University of Michigan's Institute for Clinical and Health Research (MICHR), a team was created to creatively and economically enhance our operating space into a flexible workspace that supports privacy, innovation, creativity, and most important, a culture of collaboration. The team used a human-centered design process to creatively engage the staff at large into analyzing our existing space, identifying latent needs, proposing solutions, generating feedback, and economically building the rethought process. The redesigned workspace embraces the differences among MICHR's teams while encouraging collaboration and teamwork and keeping costs at a minimum. It has resulted in a flexible space that includes co-located teams, spaces dedicated to different work goals, an open area for collaboration, quiet zones for focused work, and better wayfinding. Through our Rethink Space project, we hope to have demonstrated that, by initiating the project internally and by engaging the users of the space themselves in an empathetic, visual, and human-centered way, a space redesign can be undertaken economically while also leading to improved levels of employee and team satisfaction.
Directory of Open Access Journals (Sweden)
D. S. Blinov
2017-01-01
Full Text Available One of the most important trends in development of machine engineering is to improve load capacity of mechanisms, assemblies and parts without increasing their overall dimensions and weight. This is also relevant to the most promising items so far, i.e. orbital roller drives (ORD, which are the rotational-to-progressive motion converters widely used in vehicles. The previously published article suggested increasing a load capacity (by about 15% through reducing a thread turn section angle of the threaded ORD components and change of the radius of roller thread turn section outline. Due to such ORD modification, a number of the most critical ORD parameters are to be changed thereby demanding further research. Further, the article published suggests a method considering the abovementioned changes to calculate the dimensions of ORD main components and their tolerance ranges.Though this method being not complete as the increment of ORD center-to-center spacing in relation to its rated value, required for assembly, is unknown; and to determine the ORD center-to-center spacing increment, outer diameters of the roller and screw threads are to be known. Hence, these two methods are interconnected.This article presents the numerical calculation method, mathematical support and method to determine the increment of ORD center-to-center spacing and initial contact point of the mating roller and screw thread turns. Due to considerable scope of calculations, the method was turned into the software.Similar calculation methods and techniques were developed to a particular case, where the thread turn section angle of the threaded components was of 90°, and the roller thread turn section outline was a circular arc centered to the roller axis. Hence the developed numerical calculation method, mathematical support and technique refer to the general case which is to determine the ORD center-to-center spacing increment and initial contact point of the mating roller
Roberts, Barry C.
2016-01-01
The following is a summary of the major meteorological/atmospheric projects and research that have been or currently are being accomplished at Marshall Space Flight Center (MSFC). Listed below are highlights of work done during the past 6 months in the Engineering Directorate (ED) and in the Science and Mission Systems Office (ZP).
Allen, Jaclyn; Luckey, M.; McInturff, B.; Huynh, P.; Tobola, K.; Loftin, L.
2010-01-01
NASA is eager for students and the public to experience lunar Apollo samples and meteorites first hand. Lunar rocks and soil, embedded in Lucite disks, are available for educators to use in their classrooms, museums, science centers, and public libraries for education activities and display. The sample education disks are valuable tools for engaging students in the exploration of the Solar System. Scientific research conducted on the Apollo rocks reveals the early history of our Earth-Moon system and meteorites reveal much of the history of the early solar system. The rocks help educators make the connections to this ancient history of our planet and solar system and the basic processes accretion, differentiation, impact and volcanism. With these samples, educators in museums, science centers, libraries, and classrooms can help students and the public understand the key questions pursued by many NASA planetary missions. The Office of the Curator at Johnson Space Center is in the process of reorganizing and renewing the Lunar and Meteorite Sample Education Disk Program to increase reach, security and accountability. The new program expands the reach of these exciting extraterrestrial rocks through increased access to training and educator borrowing. One of the expanded opportunities is that trained certified educators from science centers, museums, and libraries may now borrow the extraterrestrial rock samples. Previously the loan program was only open to classroom educators so the expansion will increase the public access to the samples and allow educators to make the critical connections to the exciting exploration missions taking place in our solar system. Each Lunar Disk contains three lunar rocks and three regolith soils embedded in Lucite. The anorthosite sample is a part of the magma ocean formed on the surface of Moon in the early melting period, the basalt is part of the extensive lunar mare lava flows, and the breccias sample is an important example of the
49 CFR 40.321 - What is the general confidentiality rule for drug and alcohol test information?
2010-10-01
... Transportation PROCEDURES FOR TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Confidentiality and Release of Information § 40.321 What is the general confidentiality rule for drug and alcohol test... DOT drug or alcohol testing process, you are prohibited from releasing individual test results or...
International Nuclear Information System (INIS)
Tiamiyu, A.A.; Eskandari, M.; Sanayei, Mohsen; Odeshi, A.G.; Szpunar, J.A.
2016-01-01
The impact response of three regions (top, mid and center) across the thickness of AISI 321 austenitic stainless steel plate at high strain rates (>6000 s −1 ) was studied using the split Hopkinson pressure bar system. The result shows that texture and stored energy heterogeneity across plate thickness influenced the mechanical responses of the investigated steel in these regions. Microstructural evaluation using high-resolution electron backscattered diffraction (HR-EBSD) analysis showed that strengthening in AISI 321 steel originates from the evolution of strain-induced martensite and formation of nano-carbides in addition to plastic deformation by mechanical twinning and slip. This resulted in a desirable combination of high strength and good ductility (approx. 2000 MPa at 0.42 true strain). Phase transformation, dynamic recrystallization and formation of nano-carbides were confirmed within the adiabatic shear band (ASB) region. The average dynamic recrystallized (DRX) grain size in the shear band region is 0.28 µm in comparison to grain size of 15 µm outside the shear bands. The nano-sized grain inside the shear bands is proposed to form by rotational dynamic recrystallization. A comparative study of the alloy's behavior under dynamic and quasi-static compression shows that the stability of austenite is higher at high strain rates and lower at a low strain rate. The strength in the dynamically impacted specimen is compromised as a result of the suppressed evolution of strain-induced martensite and mechanical twin. Martensitic transformation under both loading conditions follows the FCC É£-austenite→BCC ά-martensite kinetic path and both phases obey the Kurdjumov-Sachs' {(111)É£||(110)ά and <−101>É£||<1–11>ά} orientation relationship.
Energy Technology Data Exchange (ETDEWEB)
Tiamiyu, A.A., E-mail: ahmed.tiamiyu@usask.ca [Department of Mechanical Engineering, University of Saskatchewan, Saskatoon, Sask. (Canada); Eskandari, M. [Department of Materials Science & Engineering, Faculty of Engineering, Shahid Chamran University of Ahvaz, Ahvaz (Iran, Islamic Republic of); Sanayei, Mohsen; Odeshi, A.G.; Szpunar, J.A. [Department of Mechanical Engineering, University of Saskatchewan, Saskatoon, Sask. (Canada)
2016-09-15
The impact response of three regions (top, mid and center) across the thickness of AISI 321 austenitic stainless steel plate at high strain rates (>6000 s{sup −1}) was studied using the split Hopkinson pressure bar system. The result shows that texture and stored energy heterogeneity across plate thickness influenced the mechanical responses of the investigated steel in these regions. Microstructural evaluation using high-resolution electron backscattered diffraction (HR-EBSD) analysis showed that strengthening in AISI 321 steel originates from the evolution of strain-induced martensite and formation of nano-carbides in addition to plastic deformation by mechanical twinning and slip. This resulted in a desirable combination of high strength and good ductility (approx. 2000 MPa at 0.42 true strain). Phase transformation, dynamic recrystallization and formation of nano-carbides were confirmed within the adiabatic shear band (ASB) region. The average dynamic recrystallized (DRX) grain size in the shear band region is 0.28 µm in comparison to grain size of 15 µm outside the shear bands. The nano-sized grain inside the shear bands is proposed to form by rotational dynamic recrystallization. A comparative study of the alloy's behavior under dynamic and quasi-static compression shows that the stability of austenite is higher at high strain rates and lower at a low strain rate. The strength in the dynamically impacted specimen is compromised as a result of the suppressed evolution of strain-induced martensite and mechanical twin. Martensitic transformation under both loading conditions follows the FCC É£-austenite→BCC ά-martensite kinetic path and both phases obey the Kurdjumov-Sachs' {(111)É£||(110)ά and <−101>É£||<1–11>ά} orientation relationship.
The age of fathers in the USA is rising: an analysis of 168 867 480 births from 1972 to 2015.
Khandwala, Yash S; Zhang, Chiyuan A; Lu, Ying; Eisenberg, Michael L
2017-10-01
How has the mean paternal age in the USA changed over the past 4 decades? The age at which men are fathering children in the USA has been increasing over time, although it varies by race, geographic region and paternal education level. While the rise in mean maternal age and its implications for fertility, birth outcomes and public health have been well documented, little is known about paternal characteristics of births within the USA. A retrospective data analysis of paternal age and reporting patterns for 168 867 480 live births within the USA since 1972 was conducted. All live births within the USA collected through the National Vital Statistics System (NVSS) of the Centers for Disease Control and Prevention (CDC) were evaluated. Inverse probability weighting (IPW) was used to reduce bias due to missing paternal records. Mean paternal age has increased over the past 44 years from 27.4 to 30.9 years. College education and Northeastern birth states were associated with higher paternal age. Racial/ethnic differences were also identified, whereby Asian fathers were the oldest and Black fathers were the youngest. The parental age difference (paternal age minus maternal age) has decreased over the past 44 years. Births to Black and Native American mothers were most often lacking paternal data, implying low paternal reporting. Paternal reporting was higher for older and more educated women. Although we utilized IPW to reduce the impact of paternal reporting bias, our estimates may still be influenced by the missing data in the NVSS. Paternal age is rising within the USA among all regions, races and education levels. Given the implications for offspring health and demographic patterns, further research on this trend is warranted. No funding was received for this study and there are no competing interests. N/A. © The Author 2017. Published by Oxford University Press on behalf of the European Society of Human Reproduction and Embryology. All rights reserved. For
USRA's NCSEFSE: a new National Center for Space, Earth, and Flight Sciences Education
Livengood, T. A.; Goldstein, J.; Vanhala, H.; Hamel, J.; Miller, E. A.; Pulkkinen, K.; Richards, S.
2005-08-01
A new National Center for Space, Earth, and Flight Sciences Education (NCSEFSE) has been created in the Washington, DC metropolitan area under the auspices of the Universities Space Research Association. The NCSEFSE provides education and public outreach services in the areas of NASA's research foci in programs of both national and local scope. Present NCSEFSE programs include: Journey through the Universe, which unites formal and informal education within communities and connects a nationally-distributed network of communities from Hilo, HI to Washington, DC with volunteer Visiting Researchers and thematic education modules; the Voyage Scale Model Solar System exhibition on the National Mall, a showcase for planetary science placed directly outside the National Air and Space Museum; educational module development and distribution for the MESSENGER mission to Mercury through a national cadre of MESSENGER Educator Fellows; Teachable Moments in the News, which capitalizes on current events in space, Earth, and flight sciences to teach the science that underlies students' natural interests; the Voyages Across the Universe Speakers' Bureau; and Family Science Night at the National Air and Space Museum, which reaches audiences of 2000--3000 each year, drawn from the Washington metropolitan area. Staff scientists of NCSEFSE maintain active research programs, presently in the areas of planetary atmospheric composition, structure, and dynamics, and in solar system formation. NCSEFSE scientists thus are able to act as authentic representatives of frontier scientific research, and ensure accuracy, relevance, and significance in educational products. NCSEFSE instructional designers and educators ensure pedagogic clarity and effectiveness, through a commitment to quantitative assessment.
Green Monopropellant Status at Marshall Space Flight Center
Burnside, Christopher G.; Pierce, Charles W.; Pedersen, Kevin W.
2016-01-01
NASA Marshall Space Flight Center is continuing investigations into the use of green monopropellants as a replacement for hydrazine in spacecraft propulsion systems. Work to date has been to push technology development through multiple activities designed to understand the capabilities of these technologies. Future work will begin to transition to mission pull as these technologies are mature while still keeping a solid goal of pushing technology development as opportunities become available. The AF-M315E activities began with hot-fire demonstration testing of a 1N monopropellant thruster in FY 14 and FY15. Following successful completion of the preliminary campaign, changes to the test stand to accommodate propellant conditioning capability and better control of propellant operations was incorporated to make testing more streamlined. The goal is to conduct hot-fire testing with warm and cold propellants using the existing feed system and original thruster design. Following the 1N testing, a NASA owned 100 mN thruster will be hot-fire tested in the same facility to show feasibility of scaling to smaller thrusters for cubesat applications. The end goal is to conduct a hot-fire test of an integrated cubesat propulsion system using an SLM printed propellant tank, an MSFC designed propulsion system electronic controller and the 100 mN thruster. In addition to the AF-M315E testing, MSFC is pursuing hot-fire testing with LMP-103S. Following our successful hot-fire testing of the 22N thruster in April 2015, a test campaign was proposed for a 440N LMP-103S thruster with Orbital ATK and Plasma Processes. This activity was funded through the Space Technology Mission Directorate (STMD) ACO funding call in the last quarter of CY15. Under the same funding source a test activity with Busek and Glenn Research Center for testing of 5N AF-M315E thrusters was proposed and awarded. Both activities are in-work with expected completion of hot-fire testing by the end of FY17. MSFC is
Sol–gel derived solar selective coatings on SS 321 substrates for solar thermal applications
Energy Technology Data Exchange (ETDEWEB)
Subasri, R., E-mail: subasri@arci.res.in; Soma Raju, K.R.C.; Reddy, D.S.; Hebalkar, Neha Y.; Padmanabham, G.
2016-01-01
Sol–gel derived multilayered solar selective coatings were generated on AISI SS 321 substrates using Ag-TiO{sub 2} as the cermet layer, titania and silica as the dielectric layers with high and low refractive indices respectively. The phase compositions of the individual layers were independently confirmed using grazing angle incidence X-ray diffraction, which was corroborated by X-ray photoelectron spectroscopic analysis. Thickness of the layers was measured using variable angle spectroscopic ellipsometry. The solar absorbance was measured over the UV–Vis-NIR wavelength range. Thermal emissivity was determined using FTIR spectroscopic analysis. The durability of the coatings was ascertained using accelerated corrosion testing methods as well as by measuring the optical properties after thermal cycling experiments. The promising nature of hexavalent chrome-free, environmental friendly, multilayered solar selective coating was ascertained with respect to amenability to scale-up. - Highlights: • Sol–gel derived multilayered solar selective coatings developed on SS321 • Solar absorptance and thermal emittance at par with toxic chrome coating • Thermal stability and corrosion resistance of coatings studied • Coating performance found to be promising for large scale applications • Scale-up amenability investigated by coating generation on 1 m tubes.
Sol–gel derived solar selective coatings on SS 321 substrates for solar thermal applications
International Nuclear Information System (INIS)
Subasri, R.; Soma Raju, K.R.C.; Reddy, D.S.; Hebalkar, Neha Y.; Padmanabham, G.
2016-01-01
Sol–gel derived multilayered solar selective coatings were generated on AISI SS 321 substrates using Ag-TiO_2 as the cermet layer, titania and silica as the dielectric layers with high and low refractive indices respectively. The phase compositions of the individual layers were independently confirmed using grazing angle incidence X-ray diffraction, which was corroborated by X-ray photoelectron spectroscopic analysis. Thickness of the layers was measured using variable angle spectroscopic ellipsometry. The solar absorbance was measured over the UV–Vis-NIR wavelength range. Thermal emissivity was determined using FTIR spectroscopic analysis. The durability of the coatings was ascertained using accelerated corrosion testing methods as well as by measuring the optical properties after thermal cycling experiments. The promising nature of hexavalent chrome-free, environmental friendly, multilayered solar selective coating was ascertained with respect to amenability to scale-up. - Highlights: • Sol–gel derived multilayered solar selective coatings developed on SS321 • Solar absorptance and thermal emittance at par with toxic chrome coating • Thermal stability and corrosion resistance of coatings studied • Coating performance found to be promising for large scale applications • Scale-up amenability investigated by coating generation on 1 m tubes
International Nuclear Information System (INIS)
Perovic, N.L.; Maglic, K.D.; Stanimirovic, A.M.; Vukovic, G.S.
1995-01-01
The study of the thermophysical properties of AISI 321 stainless steel was the last part of work within the IAEA-coordinated Research Programme for the Establishment of a Database of Thermophysical Properties of LW and HW Reactor Materials (IAEA CRP) effected at the Institute of Nuclear Sciences Vinca (NIV). The AISI 321 stainless steel belongs to the group of construction materials whose thermophysical and calorimetric properties have significance for the IAEA CRP. Because there have been few investigations of the thermal properties of this material, the CRP foresaw the need for new measurements, which are reported in this paper. Experimental research performed at NIV consisted of the investigation of thermal diffusivity, electric resistivity, and specific heat capacity of this austenitic stainless steel. The thermal diffusivity was measured by the laser pulse technique, and the elastic resistivity and specific heat capacity were determined by use of millisecond-resolution pulse calorimetry. All measurements were performed from ambient temperature to above 1000 o C, within which temperature range the material maintains its structure and stable thermophysical properties. Values for the thermal conductivity were computed from data on the thermal diffusivity, specific heat capacity, and the room-temperature density. (author)
Hu, Z; Lin, Q; Chen, H; Li, Z; Yin, F; Feng, X
2014-12-01
Insect cytochrome P450 monooxygenases (P450s) play an important role in catalysis of many reactions leading to insecticides resistance. Our previous studies on transcriptome analysis of chlorantraniliprole-resistant development in the diamondback moth, Plutella xylostella revealed that up-regulation of cytochrome P450s are one of the main factors leading to the development of chlorantraniliprole resistance. Here, we report for the first time a novel cytochrome P450 gene CYP321E1, which belongs to the cytochrome P450 gene family CYP321. Real-time quantitative PCR (RT-qPCR) analyses indicated that CYP321E1 was expressed at all developmental stages of P. xylostella but was highest in the fourth-instar larvae; furthermore, the relatively high expression was observed in the midgut of the fourth-instar larvae, followed by fat bodies and epidermis. The expression of CYP321E1 in P. xylostella was differentially affected by three representative insecticides, including alphamethrin, abamectin and chlorantraniliprole. Among them, the exposure to chlorantraniliprole resulted in the largest transcript level of this cytochrome P450 gene. The findings suggested potential involvement of CYP321E1 in chlorantraniliprole resistance of P. xylostella. To assess the functional link of CYP321E1 to chlorantraniliprole resistance, RNA interference (RNAi)-mediated gene silencing by double stranded RNA (dsRNA) injecting was used. Results revealed that injection delivery of dsRNA can greatly reduce gene expression after 24 h. As a consequence of RNAi, a significant increment in mortality of larvae injected CYP321E1 dsRNA was observed after 24 h of exposure to chlorantraniliprole. These results strongly support our notion that this novel cytochrome P450 gene plays an important role in chlorantraniliprole detoxification in the diamondback moth and is partly responsible for its resistance.
Compliance with recommended care at trauma centers: association with patient outcomes.
Shafi, Shahid; Barnes, Sunni A; Rayan, Nadine; Kudyakov, Rustam; Foreman, Michael; Cryer, H Gil; Alam, Hasan B; Hoff, William; Holcomb, John
2014-08-01
State health departments and the American College of Surgeons focus on the availability of optimal resources to designate hospitals as trauma centers, with little emphasis on actual delivery of care. There is no systematic information on clinical practices at designated trauma centers. The objective of this study was to measure compliance with 22 commonly recommended clinical practices at trauma centers and its association with in-hospital mortality. This retrospective observational study was conducted at 5 Level I trauma centers across the country. Participants were adult patients with moderate to severe injuries (n = 3,867). The association between compliance with 22 commonly recommended clinical practices and in-hospital mortality was measured after adjusting for patient demographics and injuries and their severity. Compliance with individual clinical practices ranged from as low as 12% to as high as 94%. After adjusting for patient demographics and injury severity, each 10% increase in compliance with recommended care was associated with a 14% reduction in the risk of death. Patients who received all recommended care were 58% less likely to die (odds ratio = 0.42; 95% CI, 0.28-0.62) compared with those who did not. Compliance with commonly recommended clinical practices remains suboptimal at designated trauma centers. Improved adoption of these practices can reduce mortality. Copyright © 2014 American College of Surgeons. Published by Elsevier Inc. All rights reserved.
Lehtonen, Ken
1999-01-01
This is a report to the Third Annual International Virtual Company Conference, on The Development of a Virtual Company to Support the Reengineering of the NASA/Goddard Hubble Space Telescope (HST) Control Center System. It begins with a HST Science "Commercial": Brief Tour of Our Universe showing various pictures taken from the Hubble Space Telescope. The presentation then reviews the project background and goals. Evolution of the Control Center System ("CCS Inc.") is then reviewed. Topics of Interest to "virtual companies" are reviewed: (1) "How To Choose A Team" (2) "Organizational Model" (3) "The Human Component" (4) "'Virtual Trust' Among Teaming Companies" (5) "Unique Challenges to Working Horizontally" (6) "The Cultural Impact" (7) "Lessons Learned".
National Research Council Canada - National Science Library
2007-01-01
.... The 50th Space Wing makes available by permit two buildings on the base's real property records, 720 and 730, to the Joint National Integration Center, a Component of the Missile Defense Agency...
Mendoza, A. M. M.; Rastaetter, L.; Kuznetsova, M. M.; Mays, M. L.; Chulaki, A.; Shim, J. S.; MacNeice, P. J.; Taktakishvili, A.; Collado-Vega, Y. M.; Weigand, C.; Zheng, Y.; Mullinix, R.; Patel, K.; Pembroke, A. D.; Pulkkinen, A. A.; Boblitt, J. M.; Bakshi, S. S.; Tsui, T.
2017-12-01
The Community Coordinated Modeling Center (CCMC), with the fundamental goal of aiding the transition of modern space science models into space weather forecasting while supporting space science research, has been serving as an integral hub for over 15 years, providing invaluable resources to both space weather scientific and operational communities. CCMC has developed and provided innovative web-based point of access tools varying from: Runs-On-Request System - providing unprecedented global access to the largest collection of state-of-the-art solar and space physics models, Integrated Space Weather Analysis (iSWA) - a powerful dissemination system for space weather information, Advanced Online Visualization and Analysis tools for more accurate interpretation of model results, Standard Data formats for Simulation Data downloads, and Mobile apps to view space weather data anywhere to the scientific community. In addition to supporting research and performing model evaluations, CCMC also supports space science education by hosting summer students through local universities. In this poster, we will showcase CCMC's latest innovative tools and services, and CCMC's tools that revolutionized the way we do research and improve our operational space weather capabilities. CCMC's free tools and resources are all publicly available online (http://ccmc.gsfc.nasa.gov).
Bagg, Thomas C., III; Brumfield, Mark D.; Jamison, Donald E.; Granata, Raymond L.; Casey, Carolyn A.; Heller, Stuart
2003-01-01
The Systems Engineering Education Development (SEED) Program at NASA Goddard Space Flight Center develops systems engineers from existing discipline engineers. The program has evolved significantly since the report to INCOSE in 2003. This paper describes the SEED Program as it is now, outlines the changes over the last year, discusses current status and results, and shows the value of human systems and leadership skills for practicing systems engineers.
Mathematical model for adaptive control system of ASEA robot at Kennedy Space Center
Zia, Omar
1989-01-01
The dynamic properties and the mathematical model for the adaptive control of the robotic system presently under investigation at Robotic Application and Development Laboratory at Kennedy Space Center are discussed. NASA is currently investigating the use of robotic manipulators for mating and demating of fuel lines to the Space Shuttle Vehicle prior to launch. The Robotic system used as a testbed for this purpose is an ASEA IRB-90 industrial robot with adaptive control capabilities. The system was tested and it's performance with respect to stability was improved by using an analogue force controller. The objective of this research project is to determine the mathematical model of the system operating under force feedback control with varying dynamic internal perturbation in order to provide continuous stable operation under variable load conditions. A series of lumped parameter models are developed. The models include some effects of robot structural dynamics, sensor compliance, and workpiece dynamics.
Latham, James
1995-01-01
The Maryland/Goddard Space Flight Center (GSFC) Earth and Environmental Science Teacher Ambassador Program was designed to enhance classroom instruction in the Earth and environmental science programs in the secondary schools of the state of Maryland. In October 1992, more than 100 school system administrators from the 24 local Maryland school systems, the Maryland State Department of Education, and the University of Maryland met with NASA GSFC scientists and education officers to propose a cooperative state-wide secondary school science teaching enhancement initiative.
Collins, Emmanuel G., Jr.; Phillips, Douglas; Hyland, David C.
1990-01-01
An experiment was conducted to design controllers that would provide substantial reduction of line-of-sight control errors. The satisfaction of this objective required the controllers to attenuate the beam vibration significantly. Particular emphasis was placed on controller simplicity (i.e., reduced-order and decentralized controller architectures). Complexity reduction in control law implementation is of paramount interest due to stringent limitations on throughput of even state-of-the-art space qualified processors. The results of this experiment successfully demonstrate active vibrator control for a flexible structure. The testbed is the ACES structure at the NASA Marshall Space Flight Center. The ACES structure is dynamically traceable to future space systems and especially allows the study of line-of-sight control issues.
Corrosion Behavior of Heat Affected Zone of AISI 321 stainless steel
International Nuclear Information System (INIS)
Ahn, Yong Sik; Park, Hwa Soon; Kim, Yeong Hwan; Won, Tae Yeon; Lee, Sang Lae
1994-01-01
Intergranular corrosion behavior of heat affected zone(HAZ) has been investigated for Ti-stabilized austenitic stainless steel AISI 321. It was observed that grain boundaries at HAZ of the steel with Ti/C ratio of 6.2 were corroded significantly after sensitization heat treatment. The increase of the Ti/C ratio up to 9.6 results in the evident decrease of intergranular corrosion. Weld simulation and intergranular corrosion test in 65% HNO 3 was performed. Influence of various thermal cycles on the intergranular corrosion was investigated. These results are discussed in terms of the behavior of TiC and Cr 23 C 6 precipitates
Digital Beamforming Synthetic Aperture Radar Developments at NASA Goddard Space Flight Center
Rincon, Rafael; Fatoyinbo, Temilola; Osmanoglu, Batuhan; Lee, Seung Kuk; Du Toit, Cornelis F.; Perrine, Martin; Ranson, K. Jon; Sun, Guoqing; Deshpande, Manohar; Beck, Jaclyn;
2016-01-01
Advanced Digital Beamforming (DBF) Synthetic Aperture Radar (SAR) technology is an area of research and development pursued at the NASA Goddard Space Flight Center (GSFC). Advanced SAR architectures enhances radar performance and opens a new set of capabilities in radar remote sensing. DBSAR-2 and EcoSAR are two state-of-the-art radar systems recently developed and tested. These new instruments employ multiple input-multiple output (MIMO) architectures characterized by multi-mode operation, software defined waveform generation, digital beamforming, and configurable radar parameters. The instruments have been developed to support several disciplines in Earth and Planetary sciences. This paper describes the radars advanced features and report on the latest SAR processing and calibration efforts.
Watson, Andrew I.; Holle, Ronald L.; Lopez, Raul E.; Nicholson, James R.
1990-01-01
In 1987 NASA expanded its surface wind network onto the mainland west of Kennedy Space Center, increasing the network area from nearly 800 sq km to over 1600 sq km. Here, the results of this expansion are reported using three years of wind and lightning information collected during June, July, August, and September of 1987, 1988, and 1989. The divergence-lightning relationships and the importance of wind direction are addressed, and the verification is summarized.
Myagkova, Irina; Kalegaev, Vladimir; Panasyuk, Mikhail; Svertilov, Sergey; Bogomolov, Vitaly; Bogomolov, Andrey; Barinova, Vera; Barinov, Oleg; Bobrovnikov, Sergey; Dolenko, Sergey; Mukhametdinova, Ludmila; Shiroky, Vladimir; Shugay, Julia
2016-04-01
Radiation Environment of Near-Earth space is one of the most important factors of space weather. Space Monitoring Data Center of Moscow State University provides operational control of radiation conditions at Low Earth's Orbits (LEO) of the near-Earth space using data of recent (Vernov, CORONAS series), current (Meteor-M, Electro-L series) and future (Lomonosov) space missions. Internet portal of Space Monitoring Data Center of Skobeltsyn Institute of Nuclear Physics of Lomonosov Moscow State University (SINP MSU) http://swx.sinp.msu.ru/ provides possibilities to control and analyze the space radiation conditions in the real time mode together with the geomagnetic and solar activity including hard X-ray and gamma- emission of solar flares. Operational data obtained from space missions at L1, GEO and LEO and from the Earth's magnetic stations are used to represent radiation and geomagnetic state of near-Earth environment. The models of space environment that use space measurements from different orbits were created. Interactive analysis and operational neural network forecast services are based on these models. These systems can automatically generate alerts on particle fluxes enhancements above the threshold values, both for SEP and relativistic electrons of outer Earth's radiation belt using data from GEO and LEO as input. As an example of LEO data we consider data from Vernov mission, which was launched into solar-synchronous orbit (altitude 640 - 83 0 km, inclination 98.4°, orbital period about 100 min) on July 8, 2014 and began to receive scientific information since July 20, 2014. Vernov mission have provided studies of the Earth's radiation belt relativistic electron precipitation and its possible connection with atmosphere transient luminous events, as well as the solar hard X-ray and gamma-emission measurements. Radiation and electromagnetic environment monitoring in the near-Earth Space, which is very important for space weather study, was also realised
Balasubramaniam, K. S.; West, E. A.
1991-01-01
The Marshall Space Flight Center (MSFC) vector magnetograph is a tunable filter magnetograph with a bandpass of 125 mA. Results are presented of the inversion of Stokes polarization profiles observed with the MSFC vector magnetograph centered on a sunspot to recover the vector magnetic field parameters and thermodynamic parameters of the spectral line forming region using the Fe I 5250.2 A spectral line using a nonlinear least-squares fitting technique. As a preliminary investigation, it is also shown that the recovered thermodynamic parameters could be better understood if the fitted parameters like Doppler width, opacity ratio, and damping constant were broken down into more basic quantities like temperature, microturbulent velocity, or density parameter.
Micale, Barbara L.
2009-01-01
Elements of dance and dance-theatre -- including movement and exercise, flowing costumes, and expressive lighting --inspired students in the Architecture Master's design studio at the Washington Alexandria Architecture Center to imagine innovative ways of merging public and private space for a dance studio in nearby Arlington.
Lee, S. C.; Lollar, Louis F.
1988-01-01
The overall approach currently being taken in the development of AMPERES (Autonomously Managed Power System Extendable Real-time Expert System), a knowledge-based expert system for fault monitoring and diagnosis of space power systems, is discussed. The system architecture, knowledge representation, and fault monitoring and diagnosis strategy are examined. A 'component-centered' approach developed in this project is described. Critical issues requiring further study are identified.
Reliability Centered Maintenance - Methodologies
Kammerer, Catherine C.
2009-01-01
Journal article about Reliability Centered Maintenance (RCM) methodologies used by United Space Alliance, LLC (USA) in support of the Space Shuttle Program at Kennedy Space Center. The USA Reliability Centered Maintenance program differs from traditional RCM programs because various methodologies are utilized to take advantage of their respective strengths for each application. Based on operational experience, USA has customized the traditional RCM methodology into a streamlined lean logic path and has implemented the use of statistical tools to drive the process. USA RCM has integrated many of the L6S tools into both RCM methodologies. The tools utilized in the Measure, Analyze, and Improve phases of a Lean Six Sigma project lend themselves to application in the RCM process. All USA RCM methodologies meet the requirements defined in SAE JA 1011, Evaluation Criteria for Reliability-Centered Maintenance (RCM) Processes. The proposed article explores these methodologies.
RECENT ACTIVITIES AT THE CENTER FOR SPACE NUCLEAR RESEARCH FOR DEVELOPING NUCLEAR THERMAL ROCKETS
International Nuclear Information System (INIS)
O'Brien, Robert C.
2001-01-01
Nuclear power has been considered for space applications since the 1960s. Between 1955 and 1972 the US built and tested over twenty nuclear reactors/ rocket-engines in the Rover/NERVA programs. However, changes in environmental laws may make the redevelopment of the nuclear rocket more difficult. Recent advances in fuel fabrication and testing options indicate that a nuclear rocket with a fuel form significantly different from NERVA may be needed to ensure public support. The Center for Space Nuclear Research (CSNR) is pursuing development of tungsten based fuels for use in a NTR, for a surface power reactor, and to encapsulate radioisotope power sources. The CSNR Summer Fellows program has investigated the feasibility of several missions enabled by the NTR. The potential mission benefits of a nuclear rocket, historical achievements of the previous programs, and recent investigations into alternatives in design and materials for future systems will be discussed.
NASA Kennedy Space Center: Contributions to Sea Turtle Science and Conservation
Provancha, Jane A.; Phillips, Lynne V.; Mako, Cheryle L.
2018-01-01
The National Aeronautics and Space Administration (NASA) is a United States (US) federal agency that oversees US space exploration and aeronautical research. NASA's primary launch site, Kennedy Space Center (KSC) is located along the east coast of Florida, on Cape Canaveral and the western Atlantic Ocean. The natural environment within KSC's large land boundaries, not only functions as an extensive safety buffer-area, it performs simultaneously as a wildlife refuge and a national seashore. In the early 1960s, NASA was developing KSC for rocket launches and the US was establishing an awareness of, and commitment to protecting the environment. The US began creating regulations that required the consideration of the environment when taking action on federal land or with federal funds. The timing of the US Endangered Species Act (1973), the US National Environmental Policy Act (1972), coincided with the planning and implementation of the US Space Shuttle Program. This resulted in the first efforts to evaluate the impacts of space launch operation operations on waterways, air quality, habitats, and wildlife. The first KSC fauna and flora baseline studies were predominantly performed by University of Central Florida (then Florida Technological University). Numerous species of relative importance were observed and sea turtles were receiving regulatory review and protection as surveys by Dr. L Ehrhart (UCF) from 1973-1978 described turtles nesting along the KSC beaches and foraging in the KSC lagoon systems. These data were used in the first NASA Environmental Impact Statement for the Space Transportation System (shuttle program) in 1980. In 1982, NASA began a long term ecological monitoring program with contracted scientists on site. This included efforts to track sea turtle status and trends at KSC and maintain protective measures for these species. Many studies and collaborations have occurred on KSC over these last 45 years with agencies (USFWS, NOAA, NAVY), students
Antoine, Lisa
1992-01-01
An outline of the Project Operations Branch at Goddard Space Flight Center is presented that describes the management of the division and each subgroup's responsibility. The paper further describes the development of software tools for the Macintosh personal computer, and their impending implementation. A detailed step by step procedure is given for using these software tools.
Space Environmental Effects (SEE) Testing Capability: NASA/Marshall Space Flight Center
DeWittBurns, H.; Crave, Paul; Finckenor, Miria; Finchum, Charles; Nehls, Mary; Schneider, Todd; Vaughn, Jason
2012-01-01
Understanding the effects of the space environment on materials and systems is fundamental and essential for mission success. If not properly understood and designed for, the space environment can lead to materials degradation, reduction of functional lifetime, and system failure. Ground based testing is critical in predicting performance NASA/MSFC's expertise and capabilities make up the most complete SEE testing capability available.
X-Ray Optics at NASA Marshall Space Flight Center
O'Dell, Stephen L.; Atkins, Carolyn; Broadway, David M.; Elsner, Ronald F.; Gaskin, Jessica A.; Gubarev, Mikhail V.; Kilaru, Kiranmayee; Kolodziejczak, Jeffery J.; Ramsey, Brian D.; Roche, Jacqueline M.;
2015-01-01
NASA's Marshall Space Flight Center (MSFC) engages in research, development, design, fabrication, coating, assembly, and testing of grazing-incidence optics (primarily) for x-ray telescope systems. Over the past two decades, MSFC has refined processes for electroformed-nickel replication of grazing-incidence optics, in order to produce high-strength, thin-walled, full-cylinder x-ray mirrors. In recent years, MSFC has used this technology to fabricate numerous x-ray mirror assemblies for several flight (balloon, rocket, and satellite) programs. Additionally, MSFC has demonstrated the suitability of this technology for ground-based laboratory applications-namely, x-ray microscopes and cold-neutron microscopes and concentrators. This mature technology enables the production, at moderately low cost, of reasonably lightweight x-ray telescopes with good (15-30 arcsecond) angular resolution. However, achieving arcsecond imaging for a lightweight x-ray telescope likely requires development of other technologies. Accordingly, MSFC is conducting a multi-faceted research program toward enabling cost-effective production of lightweight high-resolution x-ray mirror assemblies. Relevant research topics currently under investigation include differential deposition for post-fabrication figure correction, in-situ monitoring and control of coating stress, and direct fabrication of thin-walled full-cylinder grazing-incidence mirrors.
Kubicko, Richard M.; Bingham, Lindy
1995-01-01
Goddard Space Flight Center (GSFC) on site and leased warehouses contain thousands of items of ground support equipment (GSE) and flight hardware including spacecraft, scaffolding, computer racks, stands, holding fixtures, test equipment, spares, etc. The control of these warehouses, and the management, accountability, and control of the items within them, is accomplished by the Logistics Management Division. To facilitate this management and tracking effort, the Logistics and Transportation Management Branch, is developing a system to provide warehouse personnel, property owners, and managers with storage and inventory information. This paper will describe that PC-based system and address how it will improve GSFC warehouse and storage management.
Training for life science experiments in space at the NASA Ames Research Center
Rodrigues, Annette T.; Maese, A. Christopher
1993-01-01
As this country prepares for exploration to other planets, the need to understand the affects of long duration exposure to microgravity is evident. The National Aeronautics and Space Administration (NASA) Ames Research Center's Space Life Sciences Payloads Office is responsible for a number of non-human life sciences payloads on NASA's Space Shuttle's Spacelab. Included in this responsibility is the training of those individuals who will be conducting the experiments during flight, the astronauts. Preparing a crew to conduct such experiments requires training protocols that build on simple tasks. Once a defined degree of performance proficiency is met for each task, these tasks are combined to increase the complexity of the activities. As tasks are combined into in-flight operations, they are subjected to time constraints and the crew enhances their skills through repetition. The science objectives must be completely understood by the crew and are critical to the overall training program. Completion of the in-flight activities is proof of success. Because the crew is exposed to the background of early research and plans for post-flight analyses, they have a vested interest in the flight activities. The salient features of this training approach is that it allows for flexibility in implementation, consideration of individual differences, and a greater ability to retain experiment information. This training approach offers another effective alternative training tool to existing methodologies.
Report on the intercomparison run IAEA-321 radionuclides in milk powder
International Nuclear Information System (INIS)
Strachnov, V.; Burns, K.; Dekner, R.
1990-01-01
This report contains the results of the intercomparison IAEA-321 on the determination of radionuclides in milk powder. Initially participants were requested to determine the levels of 134 Cs, 137 Cs, 40 K, 90 Sr and invited to provide data for other radionuclides. The participants included 61 laboratories located in 29 countries, and statistical evaluation of their data yield recommended values for these four radionuclides. Additional radionuclides reported were 226 Ra and 232 Th, however insufficient data exists to statistically determine recommended values for these radionuclides. The recommended values for radionuclide determination are: 134 Cs: 15.5 Bq/kg; 137 Cs: 72.6 Bq/Kg; 40 K: 552 Bq/kg; 90 Sr: 3.3 Bq/kg. Tabs
Center for Adaptive Optics | Center
Astronomy, UCSC's CfAO and ISEE, and Maui Community College, runs education and internship programs in / Jacobs Retina Center Department of Psychology University of California, San Francisco Department of University School of Optometry Maui Community College Maui Community College Space Grant Program Montana
Roberts, Barry C.
2017-01-01
The following is a summary of the major meteorological/atmospheric projects and research that have been or currently are being accomplished at Marshall Space Flight Center (MSFC). Listed below are highlights of work done during the past 6 months in the Engineering Directorate (ED) and in the Science and Technology Office (ST).
Barbre, Robert E., Jr.
2012-01-01
This paper presents the process used by the Marshall Space Flight Center Natural Environments Branch (EV44) to quality control (QC) data from the Kennedy Space Center's 50-MHz Doppler Radar Wind Profiler for use in vehicle wind loads and steering commands. The database has been built to mitigate limitations of using the currently archived databases from weather balloons. The DRWP database contains wind measurements from approximately 2.7-18.6 km altitude at roughly five minute intervals for the August 1997 to December 2009 period of record, and the extensive QC process was designed to remove spurious data from various forms of atmospheric and non-atmospheric artifacts. The QC process is largely based on DRWP literature, but two new algorithms have been developed to remove data contaminated by convection and excessive first guess propagations from the Median Filter First Guess Algorithm. In addition to describing the automated and manual QC process in detail, this paper describes the extent of the data retained. Roughly 58% of all possible wind observations exist in the database, with approximately 100 times as many complete profile sets existing relative to the EV44 balloon databases. This increased sample of near-continuous wind profile measurements may help increase launch availability by reducing the uncertainty of wind changes during launch countdown
The Hayabusa Curation Facility at Johnson Space Center
Zolensky, M.; Bastien, R.; McCann, B.; Frank, D.; Gonzalez, C.; Rodriguez, M.
2013-01-01
The Japan Aerospace Exploration Agency (JAXA) Hayabusa spacecraft made contact with the asteroid 25143 Itokawa and collected regolith dust from Muses Sea region of smooth terrain [1]. The spacecraft returned to Earth with more than 10,000 grains ranging in size from just over 300 µm to less than 10 µm [2, 3]. These grains represent the only collection of material returned from an asteroid by a spacecraft. As part of the joint agreement between JAXA and NASA for the mission, 10% of the Hayabusa grains are being transferred to NASA for parallel curation and allocation. In order to properly receive process and curate these samples, a new curation facility was established at Johnson Space Center (JSC). Since the Hayabusa samples within the JAXA curation facility have been stored free from exposure to terrestrial atmosphere and contamination [4], one of the goals of the new NASA curation facility was to continue this treatment. An existing lab space at JSC was transformed into a 120 sq.ft. ISO class 4 (equivalent to the original class 10 standard) clean room. Hayabusa samples are stored, observed, processed, and packaged for allocation inside a stainless steel glove box under dry N2. Construction of the clean laboratory was completed in 2012. Currently, 25 Itokawa particles are lodged in NASA's Hayabusa Lab. Special care has been taken during lab construction to remove or contain materials that may contribute contaminant particles in the same size range as the Hayabusa grains. Several witness plates of various materials are installed around the clean lab and within the glove box to permit characterization of local contaminants at regular intervals by SEM and mass spectrometry, and particle counts of the lab environment are frequently acquired. Of particular interest is anodized aluminum, which contains copious sub-mm grains of a multitude of different materials embedded in its upper surface. Unfortunately the use of anodized aluminum was necessary in the construction
Johnson Space Center Health and Medical Technical Authority
Fogarty, Jennifer A.
2010-01-01
1.HMTA responsibilities: a) Assure program/project compliance with Agency health and medical requirements at identified key decision points. b) Certify that programs/projects comply with Agency health and medical requirements prior to spaceflight missions. c) Assure technical excellence. 2. Designation of applicable NASA Centers for HMTA implementation and Chief Medical Officer (CMO) appointment. 3. Center CMO responsible for HMTA implementation for programs and projects at the center. JSC HMTA captured in "JSC HMTA Implementation Plan". 4. Establishes specifics of dissenting opinion process consistent with NASA procedural requirements.
Doreswamy, Rajiv
1990-01-01
The Marshall Space Flight Center (MSFC) owns and operates a space station module power management and distribution (SSM-PMAD) testbed. This system, managed by expert systems, is used to analyze and develop power system automation techniques for Space Station Freedom. The Lewis Research Center (LeRC), Cleveland, Ohio, has developed and implemented a space station electrical power system (EPS) testbed. This system and its power management controller are representative of the overall Space Station Freedom power system. A virtual link is being implemented between the testbeds at MSFC and LeRC. This link would enable configuration of SSM-PMAD as a load center for the EPS testbed at LeRC. This connection will add to the versatility of both systems, and provide an environment of enhanced realism for operation of both testbeds.
Thibodeau, Patricia L
2010-01-01
The Duke University Medical Center Library and Archives is located in the heart of the Duke Medicine campus, surrounded by Duke Hospital, ambulatory clinics, and numerous research facilities. Its location is considered prime real estate, given its adjacency to patient care, research, and educational activities. In 2005, the Duke University Library Space Planning Committee had recommended creating a learning center in the library that would support a variety of educational activities. However, the health system needed to convert the library's top floor into office space to make way for expansion of the hospital and cancer center. The library had only five months to plan the storage and consolidation of its journal and book collections, while working with the facilities design office and architect on the replacement of key user spaces on the top floor. Library staff worked together to develop plans for storing, weeding, and consolidating the collections and provided input into renovation plans for users spaces on its mezzanine level. The library lost 15,238 square feet (29%) of its net assignable square footage and a total of 16,897 (30%) gross square feet. This included 50% of the total space allotted to collections and over 15% of user spaces. The top-floor space now houses offices for Duke Medicine oncology faculty and staff. By storing a large portion of its collection off-site, the library was able to remove more stacks on the remaining stack level and convert them to user spaces, a long-term goal for the library. Additional space on the mezzanine level had to be converted to replace lost study and conference room spaces. While this project did not match the recommended space plans for the library, it underscored the need for the library to think creatively about the future of its facility and to work toward a more cohesive master plan.
Kennedy Space Center Press Site (SWMU 074) Interim Measure Report
Applegate, Joseph L.
2015-01-01
This report summarizes the Interim Measure (IM) activities conducted at the Kennedy Space Center (KSC) Press Site ("the Press Site"). This facility has been designated as Solid Waste Management Unit 074 under KSC's Resource Conservation and Recovery Act Corrective Action program. The activities were completed as part of the Vehicle Assembly Building (VAB) Area Land Use Controls Implementation Plan (LUCIP) Elimination Project. The purpose of the VAB Area LUCIP Elimination Project was to delineate and remove soil affected with constituents of concern (COCs) that historically resulted in Land Use Controls (LUCs). The goal of the project was to eliminate the LUCs on soil. LUCs for groundwater were not addressed as part of the project and are not discussed in this report. This report is intended to meet the Florida Department of Environmental Protection (FDEP) Corrective Action Management Plan requirement as part of the KSC Hazardous and Solid Waste Amendments permit and the U.S. Environmental Protection Agency's (USEPA's) Toxic Substance Control Act (TSCA) self-implementing polychlorinated biphenyl (PCB) cleanup requirements of 40 Code of Federal Regulations (CFR) 761.61(a).
SUS 321 HTB boiler tubing with fire grained internal surface resistant to steam-induced oxidation
International Nuclear Information System (INIS)
Kanero, Takahiro; Minami, Yuusuke; Kodera, Toshihide
1981-01-01
Considerable amount of scale is produced by high temperature steam on the austenitic stainless steel tubes used for the superheaters and reheaters of large boilers for power generation. The scale of outer layer separates off due to the thermal stress at the time of starting-up and stopping, and causes the blocking of pipes and the erosion of turbine blades. Following the increase of nuclear power generation, large boilers are used for medium load, accordingly it is expected that the troubles like these increase. In this paper, the manufacturing method and the properties of SUS 321 HTB with fine grain internal surface are reported, which was developed to reduce the rate of growth of scale and to prevent the separation of scale. In order to prevent the separation of scale from austenitic stainless steel tubes, the reduction of scale thickness, surface treatment such as chrome plating, the use of alloys with excellent oxidation resistance, the formation of chrome-rich film rapidly, the heat treatment of cold-worked tubes and so on were carried out. The nitrification of SUS 321 H steel brought about two-phase structure of the fine grain internal surface with excellent oxidation resistance and the rest of coarse grains with high creep strength. (Kako, I.)
Launch Vehicle Control Center Architectures
Watson, Michael D.; Epps, Amy; Woodruff, Van; Vachon, Michael Jacob; Monreal, Julio; Williams, Randall; McLaughlin, Tom
2014-01-01
This analysis is a survey of control center architectures of the NASA Space Launch System (SLS), United Launch Alliance (ULA) Atlas V and Delta IV, and the European Space Agency (ESA) Ariane 5. Each of these control center architectures have similarities in basic structure, and differences in functional distribution of responsibilities for the phases of operations: (a) Launch vehicles in the international community vary greatly in configuration and process; (b) Each launch site has a unique processing flow based on the specific configurations; (c) Launch and flight operations are managed through a set of control centers associated with each launch site, however the flight operations may be a different control center than the launch center; and (d) The engineering support centers are primarily located at the design center with a small engineering support team at the launch site.
SPASE: The Connection Among Solar and Space Physics Data Centers
Thieman, James R.; King, Todd A.; Roberts, D. Aaron
2011-01-01
The Space Physics Archive Search and Extract (SPASE) project is an international collaboration among Heliophysics (solar and space physics) groups concerned with data acquisition and archiving. Within this community there are a variety of old and new data centers, resident archives, "virtual observatories", etc. acquiring, holding, and distributing data. A researcher interested in finding data of value for his or her study faces a complex data environment. The SPASE group has simplified the search for data through the development of the SPASE Data Model as a common method to describe data sets in the various archives. The data model is an XML-based schema and is now in operational use. There are both positives and negatives to this approach. The advantage is the common metadata language enabling wide-ranging searches across the archives, but it is difficult to inspire the data holders to spend the time necessary to describe their data using the Model. Software tools have helped, but the main motivational factor is wide-ranging use of the standard by the community. The use is expanding, but there are still other groups who could benefit from adopting SPASE. The SPASE Data Model is also being expanded in the sense of providing the means for more detailed description of data sets with the aim of enabling more automated ingestion and use of the data through detailed format descriptions. We will discuss the present state of SPASE usage and how we foresee development in the future. The evolution is based on a number of lessons learned - some unique to Heliophysics, but many common to the various data disciplines.
Human-Centered Design Capability
Fitts, David J.; Howard, Robert
2009-01-01
For NASA, human-centered design (HCD) seeks opportunities to mitigate the challenges of living and working in space in order to enhance human productivity and well-being. Direct design participation during the development stage is difficult, however, during project formulation, a HCD approach can lead to better more cost-effective products. HCD can also help a program enter the development stage with a clear vision for product acquisition. HCD tools for clarifying design intent are listed. To infuse HCD into the spaceflight lifecycle the Space and Life Sciences Directorate developed the Habitability Design Center. The Center has collaborated successfully with program and project design teams and with JSC's Engineering Directorate. This presentation discusses HCD capabilities and depicts the Center's design examples and capabilities.
Kennedy Space Center Coronary Heart Disease Risk Screening Program
Tipton, David A.; Scarpa, Philip J.
1999-01-01
The number one cause of death in the U.S. is coronary heart disease (CHD). It is probably a major cause of death and disability in the lives of employees at Kennedy Space Center (KSC) as well. The KSC Biomedical Office used a multifactorial mathematical formula from the Framingham Heart Study to calculate CHD risk probabilities for individuals in a segment of the KSC population that required medical evaluation for job certification. Those assessed to be high-risk probabilities will be targeted for intervention. Every year, several thousand KSC employees require medical evaluations for job related certifications. Most medical information for these evaluations is gathered on-site at one of the KSC or Cape Canaveral Air Station (CCAS) medical clinics. The formula used in the Framingham Heart Study allows calculation of a person's probability of acquiring CHD within 10 years. The formula contains the following variables: Age, Diabetes, Smoking, Left Ventricular Hypertrophy, Blood Pressure (Systolic or Diastolic), Cholesterol, and HDL cholesterol. The formula is also gender specific. It was used to calculate the 10-year probabilities of CHD in KSC employees who required medical evaluations for job certifications during a one-year time frame. This KSC population was profiled and CHD risk reduction interventions could be targeted to those at high risk. Population risk could also be periodically reevaluated to determine the effectiveness of intervention. A 10-year CHD risk probability can be calculated for an individual quite easily while gathering routine medical information. An employee population's CHD risk probability can be profiled graphically revealing high risk segments of the population which can be targeted for risk reduction intervention. The small audience of NASA/contractor physicians, nurses and exercise/fitness professionals at the breakout session received the lecture very well. Approximately one third indicated by a show of hands that they would be
Implementing a Reliability Centered Maintenance Program at NASA's Kennedy Space Center
National Research Council Canada - National Science Library
Tuttle, Raymond
1998-01-01
.... A reliability centered maintenance (RCM) program seeks to offer equal or greater reliability at decreased cost by insuring only applicable, effective maintenance is performed and by in large part replacing time based maintenance...
Clausewitz on Space: Developing Military Space Theory Through a Comparative Analysis
National Research Council Canada - National Science Library
Streland, Arnold
1999-01-01
.... Our commercial space industry has become a huge economic center of gravity for our nation. Our enemies are discovering the benefits of space by developing their own systems and purchasing commercial space services...
Digital Data Matrix Scanner Developnent At Marshall Space Flight Center
2004-01-01
Research at NASA's Marshall Space Flight Center has resulted in a system for reading hidden identification codes using a hand-held magnetic scanner. It's an invention that could help businesses improve inventory management, enhance safety, improve security, and aid in recall efforts if defects are discovered. Two-dimensional Data Matrix symbols consisting of letters and numbers permanently etched on items for identification and resembling a small checkerboard pattern are more efficient and reliable than traditional bar codes, and can store up to 100 times more information. A team led by Fred Schramm of the Marshall Center's Technology Transfer Department, in partnership with PRI,Torrance, California, has developed a hand-held device that can read this special type of coded symbols, even if covered by up to six layers of paint. Before this new technology was available, matrix symbols were read with optical scanners, and only if the codes were visible. This latest improvement in digital Data Matrix technologies offers greater flexibility for businesses and industries already using the marking system. Paint, inks, and pastes containing magnetic properties are applied in matrix symbol patterns to objects with two-dimensional codes, and the codes are read by a magnetic scanner, even after being covered with paint or other coatings. The ability to read hidden matrix symbols promises a wide range of benefits in a number of fields, including airlines, electronics, healthcare, and the automotive industry. Many industries would like to hide information on a part, so it can be read only by the party who put it there. For instance, the automotive industry uses direct parts marking for inventory control, but for aesthetic purposes the marks often need to be invisible. Symbols have been applied to a variety of materials, including metal, plastic, glass, paper, fabric and foam, on everything from electronic parts to pharmaceuticals to livestock. The portability of the hand
Antarctic Martian Meteorites at Johnson Space Center
Funk, R. C.; Satterwhite, C. E.; Righter, K.; Harrington, R.
2018-01-01
This past year marked the 40th anniversary of the first Martian meteorite found in Antarctica by the ANSMET Antarctic Search for Meteorites) program, ALH 77005. Since then, an additional 14 Martian meteorites have been found by the ANSMET program making for a total of 15 Martian meteorites in the U. S. Antarctic meteorite collection at Johnson Space Center (JSC). Of the 15 meteorites, some have been paired so the 15 meteorites actually represent a total of approximately 9 separate samples. The first Martian meteorite found by ANSMET was ALH 77005 (482.500 g), a lherzolitic shergottite. When collected, this meteorite was split as a part of the joint expedition with the National Institute of Polar Research (NIPR) Japan. Originally classified as an "achondrite-unique", it was re-classified as a Martian lherzolitic shergottite in 1982. This meteorite has been allocated to 137 scientists for research and there are 180.934 g remaining at JSC. Two years later, one of the most significant Martian meteorites of the collection at JSC was found at Elephant Moraine, EET 79001 (7942.000 g), a shergottite. This meteorite is the largest in the Martian collection at JSC and was the largest stony meteorite sample collected during the 1979 season. In addition to its size, this meteorite is of particular interest because it contains a linear contact separating two different igneous lithologies, basaltic and olivine-phyric. EET 79001 has glass inclusions that contain noble gas and nitrogen compositions that are proportionally identical to the Martian atmosphere, as measured by the Viking spacecraft. This discovery helped scientists to identify where the "SNC" meteorite suite had originated, and that we actually possessed Martian samples. This meteorite has been allocated to 205 scientists for research and 5,298.435 g of sample is available.
Erikson, Jon D.
1994-01-01
This paper presents an overview of the proposed Lyndon B. Johnson Space Center (JSC) precompetitive, dual-use technology investment project in robotics. New robotic technology in advanced robots, which can recognize and respond to their environments and to spoken human supervision so as to perform a variety of combined mobility and manipulation tasks in various sectors, is an obejective of this work. In the U.S. economy, such robots offer the benefits of improved global competitiveness in a critical industrial sector; improved productivity by the end users of these robots; a growing robotics industry that produces jobs and profits; lower cost health care delivery with quality improvements; and, as these 'intelligent' robots become acceptable throughout society, an increase in the standard of living for everyone. In space, such robots will provide improved safety, reliability, and productivity as Space Station evolves, and will enable human space exploration (by human/robot teams). The proposed effort consists of partnerships between manufacturers, universities, and JSC to develop working production prototypes of these robots by leveraging current development by both sides. Currently targeted applications are in the manufacturing, health care, services, and construction sectors of the U.S. economy and in the inspection, servicing, maintenance, and repair aspects of space exploration. But the focus is on the generic software architecture and standardized interfaces for custom modules tailored for the various applications allowing end users to customize a robot as PC users customize PC's. Production prototypes would be completed in 5 years under this proposal.
Introduction to the Navigation Team: Johnson Space Center EG6 Internship
Gualdoni, Matthew
2017-01-01
The EG6 navigation team at NASA Johnson Space Center, like any team of engineers, interacts with the engineering process from beginning to end; from exploring solutions to a problem, to prototyping and studying the implementations, all the way to polishing and verifying a final flight-ready design. This summer, I was privileged enough to gain exposure to each of these processes, while also getting to truly experience working within a team of engineers. My summer can be broken up into three projects: i) Initial study and prototyping: investigating a manual navigation method that can be utilized onboard Orion in the event of catastrophic failure of navigation systems; ii) Finalizing and verifying code: altering a software routine to improve its robustness and reliability, as well as designing unit tests to verify its performance; and iii) Development of testing equipment: assisting in developing and integrating of a high-fidelity testbed to verify the performance of software and hardware.
ASTEC and MODEL: Controls software development at Goddard Space Flight Center
Downing, John P.; Bauer, Frank H.; Surber, Jeffrey L.
1993-01-01
The ASTEC (Analysis and Simulation Tools for Engineering Controls) software is under development at the Goddard Space Flight Center (GSFC). The design goal is to provide a wide selection of controls analysis tools at the personal computer level, as well as the capability to upload compute-intensive jobs to a mainframe or supercomputer. In the last three years the ASTEC (Analysis and Simulation Tools for Engineering Controls) software has been under development. ASTEC is meant to be an integrated collection of controls analysis tools for use at the desktop level. MODEL (Multi-Optimal Differential Equation Language) is a translator that converts programs written in the MODEL language to FORTRAN. An upgraded version of the MODEL program will be merged into ASTEC. MODEL has not been modified since 1981 and has not kept with changes in computers or user interface techniques. This paper describes the changes made to MODEL in order to make it useful in the 90's and how it relates to ASTEC.
Zhdanko, I M; Vorona, A A; Lapa, V V; Khomenko, M N
2015-03-01
The article is devoted to the history of the Research Test Center Aviation and Space Medicine and military ergonomics, now included in the Central Research Institute of the Air Force Defense Ministry. The center throughout 80 years history is a leding research organization in the country for the integrated study of the human factor in aviation and problems connected with it. The world-famous scientific schools in aviation physiology, hygiene and radiolorgy, emergency medicine, aviation psychology and ergonomics have been grounded on the basis of this center. With a high qualified scientific staff and laboratory-and-bench-scale base including unique seminatural airplanes and helicopters complexes, posters and installation simulating the impact of flight factors (centrifuge, hyperbaric chambers, shakenr vestibulyar-WIDE stands, etc.) the center has. successfully slved tasks concerning an improvement of flight crews protection from occupational hazards, ergonomic demands to capabilities of aircraft, professional and psycho-physiological training. Automatic systems of medical decision-making on assessment of the health status in the medical-flight expertise and dynamic medical supervision, planning, treatment and preventive and remedial actions aircrew training are currently 'being developed
Liu, Hong; Cheng, Tie-Ming; Zhang, Hong-Mei; Li, Run-Tao
2003-11-01
Based on the structure characteristics of the lead compounds, 1, 1' octanedioyl-4, 4'-dimethyl-4, 4'-dibenzyl dipiperazinium dibromide (2) and 3, 8-disubstituted-3, 8-diazabicyclo [3.2.1]octanes (DBO), di-(3, 8-diazabicyclo [3.2.1]octane) diquaternary ammonium salts 3 a-c were designed and synthesized through a highly practical procedure. Target compounds 3 a-c and the hydrochloride salts of their precursors 10 a-c were evaluated for their in vivo analgesic and sedative activities. Interestingly, the introduction of an endoethylenic bridge in the piperazine of lead compound 2 causes loss of the analgesic activity and increases the toxicity dramatically. This result shows that the flexible conformation of piperazine in compound 2 is favorable for interaction with the receptor, and the quaternization of compounds 10 a-c is the main reason for the toxicity increase.
Peripersonal space in the brain.
di Pellegrino, Giuseppe; Làdavas, Elisabetta
2015-01-01
Research in neuroscience reveals that the brain constructs multiple representation of space. Here, we primarily focus on peripersonal space (PPS) representation, the region of space immediately surrounding our bodies and in which objects can be grasped and manipulated. We review convergent results from several generations of studies, including neurophysiological studies in animals, neuropsychological investigations in monkeys and brain-damaged patients with spatial cognition disorders, as well as recent neuroimaging experiments in neurologically normal individuals. Collectively, these studies show that the primate brain constructs multiple, rapidly modifiable representations of space, centered on different body parts (i.e., hand-centered, head-centered, and trunk-centered), which arise through extensive multisensory interactions within a set of interconnected parietal and frontal regions. PPS representations are pivotal in the sensory guidance of motor behavior, allowing us to interact with objects and, as demonstrated by recent studies, with other people in the space around us. Copyright © 2014 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Barnes, G.D.
1982-01-01
The feasibility of a polygeneration plant at Kennedy Space Center was studied. Liquid hydrogen and gaseous nitrogen are the two principal products in consideration. Environmental parameters (air quality, water quality, biological diversity and hazardous waste disposal) necessary for the feasibility study were investigated. A National Environmental Policy Act (NEPA) project flow sheet was to be formulated for the environmental impact statement. Water quality criteria for Florida waters were to be established
Directory of Open Access Journals (Sweden)
Zhao Xin
2015-01-01
Full Text Available Vaccination is an effective strategy to prevent leptospirosis, a global zoonotic disease caused by infection with pathogenic Leptospira species. However, the currently used multiple-valence vaccine, which is prepared with whole cells of several Leptospira serovars, has major side effects, while its cross-immunogenicity among different Leptospira serovars is weak. LipL32, LipL21 and 2 OmpL1 have been confirmed as surface-exposed antigens in all pathogenic Leptospira strains, but their immunoprotective efficiency needs to be improved. In the present study, we generated a fusion gene lipL32/1-lipL21-ompL1/2 using primer-linking PCR and an engineered E. coli strain to express the recombinant fusion protein rLipL32/1-LipL21-OmpL1/2 (rLLO. Subsequently, the expression conditions were optimized using a central composite design that increased the fusion protein yield 2.7-fold. Western blot assays confirmed that rLLO was recognized by anti-rLipL32/1, anti-rLipL21, and anti-rOmpL1/2 sera as well as 98.5% of the sera from leptospirosis patients. The microscopic agglutination test (MAT demonstrated that rLLO antiserum had a stronger ability to agglutinate the strains of different Leptospira serovars than the rLipL32/1, rLipL21, and rOmpL1/2 antisera. More importantly, tests in hamsters showed that rLLO provided higher immunoprotective rates (91.7% than rLipL32/1, rLipL21 and rOmpL1/2 (50.0-75.0%. All the data indicate that rLLO, a recombinant fusion protein incorporating three antigens, has increased antigenicity and immunoprotective effects, and so can be used as a novel immunogen to develop a universal genetically engineered vaccine against leptospirosis.
Directory of Open Access Journals (Sweden)
Maryse C Cnossen
Full Text Available The strength of evidence underpinning care and treatment recommendations in traumatic brain injury (TBI is low. Comparative effectiveness research (CER has been proposed as a framework to provide evidence for optimal care for TBI patients. The first step in CER is to map the existing variation. The aim of current study is to quantify variation in general structural and process characteristics among centers participating in the Collaborative European NeuroTrauma Effectiveness Research in Traumatic Brain Injury (CENTER-TBI study.We designed a set of 11 provider profiling questionnaires with 321 questions about various aspects of TBI care, chosen based on literature and expert opinion. After pilot testing, questionnaires were disseminated to 71 centers from 20 countries participating in the CENTER-TBI study. Reliability of questionnaires was estimated by calculating a concordance rate among 5% duplicate questions.All 71 centers completed the questionnaires. Median concordance rate among duplicate questions was 0.85. The majority of centers were academic hospitals (n = 65, 92%, designated as a level I trauma center (n = 48, 68% and situated in an urban location (n = 70, 99%. The availability of facilities for neuro-trauma care varied across centers; e.g. 40 (57% had a dedicated neuro-intensive care unit (ICU, 36 (51% had an in-hospital rehabilitation unit and the organization of the ICU was closed in 64% (n = 45 of the centers. In addition, we found wide variation in processes of care, such as the ICU admission policy and intracranial pressure monitoring policy among centers.Even among high-volume, specialized neurotrauma centers there is substantial variation in structures and processes of TBI care. This variation provides an opportunity to study effectiveness of specific aspects of TBI care and to identify best practices with CER approaches.
Space Operations Learning Center Facebook Application
Lui, Ben; Milner, Barbara; Binebrink, Dan; Kuok, Heng
2012-01-01
The proposed Space Operations Learning Center (SOLC) Facebook module, initially code-named Spaceville, is intended to be an educational online game utilizing the latest social networking technology to reach a broad audience base and inspire young audiences to be interested in math, science, and engineering. Spaceville will be a Facebook application/ game with the goal of combining learning with a fun game and social environment. The mission of the game is to build a scientific outpost on the Moon or Mars and expand the colony. Game activities include collecting resources, trading resources, completing simple science experiments, and building architectures such as laboratories, habitats, greenhouses, machine shops, etc. The player is awarded with points and achievement levels. The player s ability increases as his/her points and levels increase. A player can interact with other players using multiplayer Facebook functionality. As a result, a player can discover unexpected treasures through scientific missions, engineering, and working with others. The player creates his/her own avatar with his/her selection of its unique appearance, and names the character. The player controls the avatar to perform activities such as collecting oxygen molecules or building a habitat. From observations of other successful social online games such as Farmville and Restaurant City, a common element of these games is having eye-catching and cartoonish characters, and interesting animations for all activities. This will create a fun, educational, and rewarding environment. The player needs to accumulate points in order to be awarded special items needed for advancing to higher levels. Trophies will be awarded to the player when certain goals are reached or tasks are completed. In order to acquire some special items needed for advancement in the game, the player will need to visit his/her neighboring towns to discover the items. This is the social aspect of the game that requires the
Development of Ultra-Fine-Grained Structure in AISI 321 Austenitic Stainless Steel
Tiamiyu, A. A.; Szpunar, J. A.; Odeshi, A. G.; Oguocha, I.; Eskandari, M.
2017-12-01
Ultra-fine-grained (UFG) structure was developed in AISI 321 austenitic stainless steel (ASS) using cryogenic rolling followed by annealing treatments at 923 K, 973 K, 1023 K, and 1073 K (650 °C, 700 °C, 750 °C, and 800 °C) for different lengths of time. The α'-martensite to γ-austenite reversion behavior and the associated texture development were analyzed in the cryo-rolled specimens after annealing. The activation energy, Q, required for the reversion of α'-martensite to γ-austenite in the steel was estimated to be 80 kJ mol-1. TiC precipitates and unreversed triple junction α'-martensite played major roles in the development of UFG structure through the Zener pinning of grain boundaries. The optimum annealing temperature and time for the development of UFG structure in the cryo-rolled AISI 321 steel are (a) 923 K (650 °C) for approximately 28800 seconds and (b) 1023 K (750 °C) for 600 seconds, with average grain sizes of 0.22 and 0.31 µm, respectively. Annealing at 1023 K (750 °C) is considered a better alternative since the volume fraction of precipitated carbides in specimens annealed at 1023 K (750 °C) are less than those annealed at 923 K (650 °C). More so, the energy consumption during prolonged annealing time to achieve an UFG structure at 923 K (650 °C) is higher due to low phase reversion rate. The hardness of the UFG specimens is 195 pct greater than that of the as-received steel. The higher volume fraction of TiC precipitates in the UFG structure may be an additional source of hardening. Micro and macrotexture analysis indicated {110}〈uvw〉 as the major texture component of the austenite grains in the UFG structure. Its intensity is stronger in the specimen annealed at low temperatures.
Czech Academy of Sciences Publication Activity Database
Teslová, P.; Kalina, J.; Urban, Otmar
2010-01-01
Roč. 104, č. 9 (2010), s. 867-870 E-ISSN 1213-7103 R&D Projects: GA ČR GA522/06/0930 Institutional research plan: CEZ:AV0Z60870520 Keywords : anthron reagent * spectrophotometry * calibration factor * non-structural saccharides * starch * norway spruce * carbon dioxide * picea abies * european beech * fagus sylvatica Subject RIV: CB - Analytical Chemistry, Separation
Computations on the massively parallel processor at the Goddard Space Flight Center
Strong, James P.
1991-01-01
Described are four significant algorithms implemented on the massively parallel processor (MPP) at the Goddard Space Flight Center. Two are in the area of image analysis. Of the other two, one is a mathematical simulation experiment and the other deals with the efficient transfer of data between distantly separated processors in the MPP array. The first algorithm presented is the automatic determination of elevations from stereo pairs. The second algorithm solves mathematical logistic equations capable of producing both ordered and chaotic (or random) solutions. This work can potentially lead to the simulation of artificial life processes. The third algorithm is the automatic segmentation of images into reasonable regions based on some similarity criterion, while the fourth is an implementation of a bitonic sort of data which significantly overcomes the nearest neighbor interconnection constraints on the MPP for transferring data between distant processors.
Chapman, K. B.; Cox, C. M.; Thomas, C. W.; Cuevas, O. O.; Beckman, R. M.
1994-01-01
The Flight Dynamics Facility (FDF) at the NASA Goddard Space Flight Center (GSFC) generates numerous products for NASA-supported spacecraft, including the Tracking and Data Relay Satellites (TDRS's), the Hubble Space Telescope (HST), the Extreme Ultraviolet Explorer (EUVE), and the space shuttle. These products include orbit determination data, acquisition data, event scheduling data, and attitude data. In most cases, product generation involves repetitive execution of many programs. The increasing number of missions supported by the FDF has necessitated the use of automated systems to schedule, execute, and quality assure these products. This automation allows the delivery of accurate products in a timely and cost-efficient manner. To be effective, these systems must automate as many repetitive operations as possible and must be flexible enough to meet changing support requirements. The FDF Orbit Determination Task (ODT) has implemented several systems that automate product generation and quality assurance (QA). These systems include the Orbit Production Automation System (OPAS), the New Enhanced Operations Log (NEOLOG), and the Quality Assurance Automation Software (QA Tool). Implementation of these systems has resulted in a significant reduction in required manpower, elimination of shift work and most weekend support, and improved support quality, while incurring minimal development cost. This paper will present an overview of the concepts used and experiences gained from the implementation of these automation systems.
NASA Dryden Flight Research Center's Space Weather Needs
Wiley, Scott
2011-01-01
Presentation involves educating Goddard Space Weather staff about what our needs are, what type of aircraft we have and to learn what we have done in the past to minimize our exposure to Space Weather Hazards.
Analysis of complex wind regimes at Kennedy Space Center for radiological assessment
International Nuclear Information System (INIS)
Taylor, G.E.; Parks, C.R.; Atchison, M.K.
1989-01-01
Galileo and Ulysses will be launched from the Kennedy Space Center (KSC) during October 1989 and October 1990, respectively. These deep-space probes will contain a radioactive thermoelectric generator as a power source. An accidental breach of the containment vessel housing the generator could cause a leak of radioactive material to the atmosphere. If this occurred, the radioactive cloud would move with the prevailing wind flow pattern and pose a serious health threat to all in its path. Since the KSC/Cape Canaveral (KSC/CC) area of Florida is located in a coastal environment with several different land/water interfaces, complex low-level wind circulation patterns exist throughout the year. Thus, if any transport and diffusion model is to correctly predict the movement of effluent near KSC, it must be able to accurately portray the characteristics of the land/sea breeze flow pattern. To evaluate models used at KSC, the KSC Atmospheric Boundary Layer Experiment (KABLE) has been designed to provide a data set to better define the characteristics of these mesoscale circulations. Data collection for KABLE occurred from November 1, 1988, to October 31, 1989. This paper presents analyses for 1 day during November 1988 that demonstrate the complexity of the local meteorological conditions at KSC/CC. The NUS Corporation has used these data and empirical sea breeze parameters to evaluate their Emergency Dose Assessment System, EMERGE
Applied Virtual Reality Research and Applications at NASA/Marshall Space Flight Center
Hale, Joseph P.
1995-01-01
A Virtual Reality (VR) applications program has been under development at NASA/Marshall Space Flight Center (MSFC) since 1989. The objectives of the MSFC VR Applications Program are to develop, assess, validate, and utilize VR in hardware development, operations development and support, mission operations training and science training. Before this technology can be utilized with confidence in these applications, it must be validated for each particular class of application. That is, the precision and reliability with which it maps onto real settings and scenarios, representative of a class, must be calculated and assessed. The approach of the MSFC VR Applications Program is to develop and validate appropriate virtual environments and associated object kinematic and behavior attributes for specific classes of applications. These application-specific environments and associated simulations will be validated, where possible, through empirical comparisons with existing, accepted tools and methodologies. These validated VR analytical tools will then be available for use in the design and development of space systems and operations and in training and mission support systems. Specific validation studies for selected classes of applications have been completed or are currently underway. These include macro-ergonomic "control-room class" design analysis, Spacelab stowage reconfiguration training, a full-body micro-gravity functional reach simulator, and a gross anatomy teaching simulator. This paper describes the MSFC VR Applications Program and the validation studies.
Decker, Ryan K.; Barbre, Robert E., Jr.; Huddleston, Lisa; Brauer, Thomas; Wilfong, Timothy
2018-01-01
The NASA Kennedy Space Center (KSC) operates a 48-MHz Tropospheric/Stratospheric Doppler Radar Wind Profiler (TDRWP) on a continual basis generating wind profiles between 2-19 km in the support of space launch vehicle operations. A benefit of the continual operability of the system is the ability to provide unique observations of severe weather events such as hurricanes. Over the past two Atlantic Hurricane seasons the TDRWP has made high temporal resolution wind profile observations of Hurricane Irma in 2017 and Hurricane Matthew in 2016. Hurricane Irma was responsible for power outages to approximately 2/3 of Florida's population during its movement over the state(Stein,2017). An overview of the TDRWP system configuration, brief summary of Hurricanes Irma and Matthew storm track in proximity to KSC, characteristics of the tropospheric wind observations from the TDRWP during both events, and discussion of the dissemination of TDRWP data during the event will be presented.
Ding, Jeff; Carter, Bob; Lawless, Kirby; Nunes, Arthur; Russell, Carolyn; Suites, Michael; Schneider, Judy
2006-01-01
Welding at NASA's Marshall Space Flight Center (MSFC), Huntsville, Alabama, has taken a new direction through the last 10 years. Fusion welding processes, namely variable polarity plasma arc (VPPA) and tungsten inert gas (TIG) were once the corner stone of welding development in the Space Flight Center's welding laboratories, located in the part of MSFC know as National Center for Advanced Manufacturing (NCM). Developed specifically to support the Shuttle Program's External Tank and later International Space Station manufacturing programs, was viewed as the paragon of welding processes for joining aluminum alloys. Much has changed since 1994, however, when NASA's Jeff Ding brought the FSW process to the NASA agency. Although, at that time, FSW was little more than a "lab curiosity", NASA researchers started investigating where the FSW process would best fit NASA manufacturing programs. A laboratory FSW system was procured and the first welds were made in fall of 1995. The small initial investment NASA made into the first FSW system has certainly paid off for the NASA agency in terms of cost savings, hardware quality and notoriety. FSW is now a part of Shuttle External Tank (ET) production and the preferred weld process for the manufacturing of components for the new Crew Launch Vehicle (CLV) and Heavy Lift Launch Vehicle (HLLV) that will take this country back to the moon. It is one of the solid state welding processes being considered for on-orbit space welding and repair, and is of considerable interest for Department of Defense @OD) manufacturing programs. MSFC involvement in these and other programs makes NASA a driving force in this country's development of FSW and other solid state welding technologies. Now, a decade later, almost the entire on-going welding R&D at MSFC now focuses on FSW and other more advanced solid state welding processes.
Novel 2,3-Dihydro-1H-pyrrolo[3,2,1-ij]quinazolin-1-ones: Synthesis and Biological Evaluation
Directory of Open Access Journals (Sweden)
Malose J. Mphahlele
2016-12-01
Full Text Available Herein we describe the synthesis and evaluation of a series of novel 2,3-dihydro-1H-pyrrolo[3,2,1-ij]quinazolin-1-ones for in vitro cytotoxicity against three human cancer cell lines as well as for potential antimalarial activity against the chloroquine-sensitive strain 3D7 of Plasmodium falciparum. The title compounds were prepared via PdCl2-mediated endo-dig cyclization of 2-aryl-8-(arylethynyl-6-bromo-2,3-dihydroquinazolin-4(1H-ones. The latter were prepared, in turn, via initial Sonogashira cross-coupling of 2-amino-5-bromo-3-iodobenzamide with aryl acetylenes followed by boric acid-mediated cyclocondensation of the intermediate 2-amino-3-(arylethynyl-5-bromobenzamides with benzaldehyde derivatives. The 2,3-dihydro-1H-pyrrolo[3,2,1-ij]quinazolin-1-ones 4a–k were evaluated for potential in vitro cytotoxicity against the breast (MCF-7, melanoma (B16 and endothelioma (sEnd.2 cell lines. All of the compounds except 4h and 4i were found to be inactive against the three cancer cell lines. Compound 4h substituted with a 4-methoxyphenyl and 4-fluorophenyl groups at the 3- and 5-positions was found to exhibit significant cytotoxicity against the three cancer cell lines. The presence of phenyl and 3-chlorophenyl groups at the 3- and 5-posiitons of the pyrroloquinazolinone 4i, on the other hand, resulted in significant cytotoxicity against vascular tumour endothelial cells (sEnd.2, but reduced activity against the melanoma (B16 and breast cancer (MCF-7 cells except at higher concentrations. The 2,3-dihydro-1H-pyrrolo[3,2,1-ij]quinazolin-1-ones 4a–l were found to be inactive against the chloroquine sensitive 3D7 strain of Plasmodium falciparum.
Wheeler, R. M.; Sager, J. C.; Prince, R. P.; Knott, W. M.; Mackowiak, C. L.; Stutte, G. W.; Yorio, N. C.; Ruffe, L. M.; Peterson, B. V.; Goins, G. D.
2003-01-01
The use of plants for bioregenerative life support for space missions was first studied by the US Air Force in the 1950s and 1960s. Extensive testing was also conducted from the 1960s through the 1980s by Russian researchers located at the Institute of Biophysics in Krasnoyarsk, Siberia, and the Institute for Biomedical Problems in Moscow. NASA initiated bioregenerative research in the 1960s (e.g., Hydrogenomonas) but this research did not include testing with plants until about 1980, with the start of the Controlled Ecological Life Support System (CELSS) Program. The NASA CELSS research was carried out at universities, private corporations, and NASA field centers, including Kennedy Space Center (KSC). The project at KSC began in 1985 and was called the CELSS Breadboard Project to indicate the capability for plugging in and testing various life support technologies; this name has since been dropped but bioregenerative testing at KSC has continued to the present under the NASA s Advanced Life Support (ALS) Program. A primary objective of the KSC testing was to conduct pre-integration tests with plants (crops) in a large, atmospherically closed test chamber called the Biomass Production Chamber (BPC). Test protocols for the BPC were based on observations and growing procedures developed by university investigators, as well as procedures developed in plant growth chamber studies at KSC. Growth chamber studies to support BPC testing focused on plant responses to different carbon dioxide (CO2) concentrations, different spectral qualities from various electric lamps, and nutrient film hydroponic culture techniques.
Surface Alloying of SUS 321 Chromium-Nickel Steel by an Electron-Plasma Process
Ivanov, Yu. F.; Teresov, A. D.; Petrikova, E. A.; Krysina, O. V.; Ivanova, O. V.; Shugurov, V. V.; Moskvin, P. V.
2017-07-01
The mechanisms of forming nanostructured, nanophase layers are revealed and analyzed in austenitic steel subjected to surface alloying using an electron-plasma process. Nanostructured, nanophase layers up to 30 μm in thickness were formed by melting of the film/substrate system with an electron beam generated by a SOLO facility (Institute of High Current Electronics, SB RAS), Tomsk), which ensured crystallization and subsequent quenching at the cooling rates within the range 105-108 K/s. The surface was modified with structural stainless steel specimens (SUS 321 steel). The film/substrate system (film thickness 0.5 μm) was formed by a plasma-assisted vacuum-arc process by evaporating a cathode made from a sintered pseudoalloy of the following composition: Zr - 6 at.% Ti - 6 at.% Cu. The film deposition was performed in a QUINTA facility equipped with a PINK hot-cathode plasma source and DI-100 arc evaporators with accelerated cooling of the process cathode, which allowed reducing the size and fraction of the droplet phase in the deposited film. It is found that melting of the film/substrate system (Zr-Ti-Cu)/(SUS 321 steel) using a high-intensity pulsed electron beam followed by the high-rate crystallization is accompanied by the formation of α-iron cellular crystallization structure and precipitation of Cr2Zr, Cr3C2 and TiC particles on the cell boundaries, which as a whole allowed increasing microhardness by a factor of 1.3, Young's modulus - by a factor of 1.2, wear resistance - by a factor of 2.7, while achieving a three-fold reduction in the friction coefficient.
Short-term forecasting of thunderstorms at Kennedy Space Center, based on the surface wind field
Watson, Andrew I.; Lopez, Raul E.; Holle, Ronald L.; Daugherty, John R.; Ortiz, Robert
1989-01-01
Techniques incorporating wind convergence that can be used for the short-term prediction of thunderstorm development are described. With these techniques, the convergence signal is sensed by the wind network array 15 to 90 min before actual storm development. Particular attention is given to the convergence cell technique (which has been applied at the Kennedy Space Center) where each convective region is analyzed independently. It is noted that, while the monitoring of areal and cellular convergence can be used to help locate the seeds of developing thunderstorms and pinpoint the lightning threat areas, this forecasting aid cannot be used in isolation.
Johnson, D.R.; Funicelli, N.A.; Bohnsack, James A.
1999-01-01
Approximately 22% of the waters of the Merritt Island National Wildlife Refuge, which encompasses the Kennedy Space Center, Florida, have been closed to public access and fishing since 1962. These closed areas offer an opportunity to test the effectiveness of 'no-take' sanctuaries by analyzing two replicated estuarine areas. Areas open and closed to fishing were sampled from November 1986 to January 1990 with 653 random trammel-net sets, each enclosing 3,721 m2. Samples from no-fishing areas had significantly (P studies documented export of important sport fish from protected areas to fished areas.
Processes and Procedures of the Higher Education Programs at Marshall Space Flight Center
Heard, Pamala D.
2002-01-01
The purpose of my research was to investigate the policies, processes, procedures and timelines for the higher education programs at Marshall Space Flight Center. The three higher education programs that comprised this research included: the Graduate Student Researchers Program (GSRP), the National Research Council/Resident Research Associateships Program (NRC/RRA) and the Summer Faculty Fellowship Program (SFFP). The GSRP award fellowships each year to promising U.S. graduate students whose research interest coincides with NASA's mission. Fellowships are awarded for one year and are renewable for up to three years to competitively selected students. Each year, the award provides students the opportunity to spend a period in residence at a NASA center using that installation's unique facilities. This program is renewable for three years, students must reapply. The National Research Council conducts the Resident Research Associateships Program (NRC/RRA), a national competition to identify outstanding recent postdoctoral scientists and engineers and experience senior scientists and engineers, for tenure as guest researchers at NASA centers. The Resident Research Associateship Program provides an opportunity for recipients of doctoral degrees to concentrate their research in association with NASA personnel, often as a culmination to formal career preparation. The program also affords established scientists and engineers an opportunity for research without any interruptions and distracting assignments generated from permanent career positions. All opportunities for research at NASA Centers are open to citizens of the U.S. and to legal permanent residents. The Summer Faculty Fellowship Program (SFFP) is conducted each summer. NASA awards research fellowships to university faculty through the NASA/American Society for Engineering Education. The program is designed to promote an exchange of ideas between university faculties, NASA scientists and engineers. Selected
Johnson, K.; Kim, R.; Echeverry, J.
The Joint Space Operations Center (JSpOC) is a command and control center focused on executing the Space Control mission of the Joint Functional Component Command for Space (JFCC-SPACE) to ensure freedom of action of United States (US) space assets, while preventing adversary use of space against the US. To accomplish this, the JSpOC tasks a network of space surveillance sensors to collect Space Situational Awareness (SSA) data on resident space objects (RSOs) in near earth and deep space orbits. SSA involves the ingestion of data sources and use of algorithms and tools to build, maintain, and disseminate situational awareness of RSOs in space. On the heels of emergent and complex threats to space assets, the JSpOC's capabilities are limited by legacy systems and CONOPs. The JSpOC Mission System (JMS) aims to consolidate SSA efforts across US agencies, international partners, and commercial partners. The JMS program is intended to deliver a modern service-oriented architecture (SOA) based infrastructure with increased process automation and improved tools to remove the current barriers to JSpOC operations. JMS has been partitioned into several developmental increments. Increment 1, completed and operational in early 2013, and Increment 2, which is expected to be completed in 2016, will replace the legacy Space Defense Operations Center (SPADOC) and Astrodynamics Support Workstation (ASW) capabilities. In 2017 JMS Increment 3 will continue to provide additional SSA and C2 capabilities that will require development of new applications and procedures as well as the exploitation of new data sources. Most importantly, Increment 3 is uniquely postured to evolve the JSpOC into the centralized and authoritative source for all Space Control applications by using its SOA to aggregate information and capabilities from across the community. To achieve this goal, Scitor Corporation has supported the JMS Program Office as it has entered into a partnership with AFRL/RD (Directed
2010-10-01
... disclosed by the safety audit will result in a notice to a new entrant that its USDOT new entrant... MOTOR CARRIER SAFETY REGULATIONS SAFETY FITNESS PROCEDURES New Entrant Safety Assurance Program § 385.321 What failures of safety management practices disclosed by the safety audit will result in a notice...
Aspects of plasma arc cutting process in the AISI 321 type stainless steel
International Nuclear Information System (INIS)
Souza Barros, I. de.
1985-01-01
Some aspects of plasma arc cutting process in the AISI321 stainless steel, used in nuclear industry, are analysed. The maximum values of the velocity of cutting and, the minimum quantity of energy per unit of length necesary for the plasma were determined. The localization of irregularities in the cut surface in function of the velocity of cutting was investigated. The cut surfaces were evaluated by surface roughness, using as measurement parameter, the distance between the sharpest salience and the deepest reentrance of the sample profile. The width of layer from thermal action of the plasma was influenced by the velocity of cutting. (Author) [pt
Climate Change Adaptation Activities at the NASA John F. Kennedy Space Center, FL., USA
Hall, Carlton; Phillips, Lynne
2016-01-01
In 2010, the Office of Strategic Infrastructure and Earth Sciences established the Climate Adaptation Science Investigators (CASI) program to integrate climate change forecasts and knowledge into sustainable management of infrastructure and operations needed for the NASA mission. NASA operates 10 field centers valued at $32 billion dollars, occupies 191,000 acres and employs 58,000 people. CASI climate change and sea-level rise forecasts focus on the 2050 and 2080 time periods. At the 140,000 acre Kennedy Space Center (KSC) data are used to simulate impacts on infrastructure, operations, and unique natural resources. KSC launch and processing facilities represent a valued national asset located in an area with high biodiversity including 33 species of special management concern. Numerical and advanced Bayesian and Monte Carlo statistical modeling is being conducted using LiDAR digital elevation models coupled with relevant GIS layers to assess potential future conditions. Results are provided to the Environmental Management Branch, Master Planning, Construction of Facilities, Engineering Construction Innovation Committee and our regional partners to support Spaceport development, management, and adaptation planning and design. Potential impacts to natural resources include conversion of 50% of the Center to open water, elevation of the surficial aquifer, alterations of rainfall and evapotranspiration patterns, conversion of salt marsh to mangrove forest, reductions in distribution and extent of upland habitats, overwash of the barrier island dune system, increases in heat stress days, and releases of chemicals from legacy contamination sites. CASI has proven successful in bringing climate change planning to KSC including recognition of the need to increase resiliency and development of a green managed shoreline retreat approach to maintain coastal ecosystem services while maximizing life expectancy of Center launch and payload processing resources.
Climate Change Adaptation Activities at the NASA John F. Kennedy Space Center, Fl., USA
Hall, C. R.; Phillips, L. V.; Foster, T.; Stolen, E.; Duncan, B.; Hunt, D.; Schaub, R.
2016-12-01
In 2010, the Office of Strategic Infrastructure and Earth Sciences established the Climate Adaptation Science Investigators (CASI) program to integrate climate change forecasts and knowledge into sustainable management of infrastructure and operations needed for the NASA mission. NASA operates 10 field centers valued at $32 billion dollars, occupies 191,000 acres and employs 58,000 people. CASI climate change and sea-level rise forecasts focus on the 2050 and 2080 time periods. At the 140,000 acre Kennedy Space Center (KSC) data are used to simulate impacts on infrastructure, operations, and unique natural resources. KSC launch and processing facilities represent a valued national asset located in an area with high biodiversity including 33 species of special management concern. Numerical and advanced Bayesian and Monte Carlo statistical modeling is being conducted using LiDAR digital elevation models coupled with relevant GIS layers to assess potential future conditions. Results are provided to the Environmental Management Branch, Master Planning, Construction of Facilities, Engineering Construction Innovation Committee and our regional partners to support Spaceport development, management, and adaptation planning and design. Potential impacts to natural resources include conversion of 50% of the Center to open water, elevation of the surficial aquifer, alterations of rainfall and evapotranspiration patterns, conversion of salt marsh to mangrove forest, reductions in distribution and extent of upland habitats, overwash of the barrier island dune system, increases in heat stress days, and releases of chemicals from legacy contamination sites. CASI has proven successful in bringing climate change planning to KSC including recognition of the need to increase resiliency and development of a green managed shoreline retreat approach to maintain coastal ecosystem services while maximizing life expectancy of Center launch and payload processing resources.
National Oceanic and Atmospheric Administration, Department of Commerce — Collection includes presentation materials and outputs from operational space environment models produced by the NOAA Space Weather Prediction Center (SWPC) and...
Accuracy determination of dose calibrators in Nuclear Medicine Centers using Tl-201
International Nuclear Information System (INIS)
Sattari, A.; Feizi, H.; Ghafoori, M.
2008-01-01
Full text: Correct administrated activity of radiopharmaceuticals is an important factor to ensure that administrated radiopharmaceutical is accurately measured and to avoid unnecessary exposure to patients. In this article, nuclear medicine group and Secondary Standard Dosimetry Laboratory (SSDL), has introduced a comparison study with 201 Tl to check the accuracy of dose calibrators in some nuclear medicine centers. First, the dose calibrator in cyclotron department was calibrated by SSDL using 133 Ba, 57 Co, 137 Cs and standard Europium sources. Then, 2ml produced 201 Tl solution containing 16±0.1 mCi was accurately sub-divided into a series of 10 ml Schott vials and delivered to 12 nuclear medicine centers that have been participated in this study. Participants were requested to assay their Schott vials in their dose calibrators at the same time and report the result on the especial sheet. Difference between the activities values reported by participants (A p ) with assayed activity on cyclotron department (Ac), defined as error value. In comparison of A c with A p , 10 centers (83%) has positive and 2 others (17%) has negative error. The range of positive error 2.6% -17.9% and range of negative error 5%-8.5%, by the average of 8.67 and %SD = 7.39 have been calculated. In conclusion, although nuclear medicine centers do calibration on their dose calibrators but establishment a regular audit system seems to be necessary. (author)
Energy Technology Data Exchange (ETDEWEB)
Arafin, M.A. [Department of Mechanical and Industrial Engineering, Concordia University, Montreal, H3G 1M8 (Canada)], E-mail: ma_arafi@encs.concordia.ca; Medraj, M. [Department of Mechanical and Industrial Engineering, Concordia University, Montreal, H3G 1M8 (Canada)], E-mail: mmedraj@encs.concordia.ca; Turner, D.P. [Metallurgical Planning, Pratt and Whitney Canada, Longueuil, Que., J4G 1A1 (Canada)], E-mail: Daniel.P.Turner@pwc.ca; Bocher, P. [Department de Genie Mecanique, Ecole de Technologie Superieure, Montreal, H3C 1K3 (Canada)], E-mail: Philippe.Bocher@etsmtl.ca
2007-11-15
The random diffusion of solute atoms during transient liquid phase (TLP) bonding of SS 410 and 321 with nickel-based brazing filler alloy BNi-2 have been modeled using Random Walk Modeling technique. Cumulative probability distributions and probability density functions of isothermal solidification times have been calculated for different process conditions and verified with experimental data. The solubility limit of boron has been found to have decreased from 0.3 at.% at higher temperature bonding operations (1358-1394 K) because of substantial iron-rich base metal dissolution when SS 410 was used as base metals; whereas it remained unchanged for SS 321/BNi-2 combination because of high concentrations of nickel and chromium in the base metal. Silicon diffusion model, based on the EDS analysis, also predicted the isothermal solidification times reasonably well.
Calle, Luz Marina
2015-01-01
The marine environment at NASAs Kennedy Space Center (KSC) has been documented by ASM International (formerly American Society for Metals) as the most corrosive in North America. With the introduction of the Space Shuttle in 1981, the already highly corrosive conditions at the launch pads were rendered even more severe by the highly corrosive hydrochloric acid (HCl) generated by the solid rocket boosters (SRBs). Numerous failures at the launch pads are caused by corrosion. The structural integrity of ground infrastructure and flight hardware is critical to the success, safety, cost, and sustainability of space missions. NASA has over fifty years of experience dealing with unexpected failures caused by corrosion and has developed expertise in corrosion control in the launch and other environments. The Corrosion Technology Laboratory at KSC evolved, from what started as an atmospheric exposure test site near NASAs launch pads, into a capability that provides technical innovations and engineering services in all areas of corrosion for NASA, external partners, and customers.This paper provides a chronological overview of NASAs role in anticipating, managing, and preventing corrosion in highly corrosive environments. One important challenge in managing and preventing corrosion involves the detrimental impact on humans and the environment of what have been very effective corrosion control strategies. This challenge has motivated the development of new corrosion control technologies that are more effective and environmentally friendly. Strategies for improved corrosion protection and durability can have a huge impact on the economic sustainability of human spaceflight operations.
Chassay, Charles
1987-01-01
The integration process of activities conducted at the NASA Lyndon B. Johnson Space Center (JSC) for the Experimental Assembly of Structures in Extravehicular activity (EASE)/Assembly Concept for Construction of Erectable Space Structures (ACCESS) payload is provided as a subset to the standard payload integration process used by the NASA Space Transportation System (STS) to fly payloads on the Space Shuttle. The EASE/ACCESS payload integration activities are chronologically reviewed beginning with the initiation of the flight manifesting and integration process. The development and documentation of the EASE/ACCESS integration requirements are also discussed along with the implementation of the mission integration activities and the engineering assessments supporting the flight integration process. In addition, the STS management support organizations, the payload safety process leading to the STS 61-B flight certification, and the overall EASE/ACCESS integration schedule are presented.
14 CFR 27.1519 - Weight and center of gravity.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Weight and center of gravity. 27.1519 Section 27.1519 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... Operating Limitations § 27.1519 Weight and center of gravity. The weight and center of gravity limitations...
14 CFR 29.1519 - Weight and center of gravity.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Weight and center of gravity. 29.1519 Section 29.1519 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... Operating Limitations § 29.1519 Weight and center of gravity. The weight and center of gravity limitations...
14 CFR 23.1519 - Weight and center of gravity.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Weight and center of gravity. 23.1519 Section 23.1519 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION... Limitations and Information § 23.1519 Weight and center of gravity. The weight and center of gravity...
Applications of Low Density Flow Techniques and Catalytic Recombination at the Johnson Space Center
Scott, Carl D.
2000-01-01
The talk presents a brief background on defInitions of catalysis and effects associated with chemically nonequilibrium and low-density flows of aerospace interest. Applications of catalytic recombination on surfaces in dissociated flow are given, including aero heating on reentry spacecraft thermal protection surfaces and reflection of plume flow on pressure distributions associated with the space station. Examples include aero heating predictions for the X-38 test vehicle, the inlet of a proposed gas-sampling probe used in high enthalpy test facilities, and a parabolic body at angle of attack. The effect of accommodation coefficients on thruster induced pressure distributions is also included. Examples of tools used include simple aero heating formulas based on boundary layer solutions, an engineering approximation that uses axisymmetric viscous shock layer flow to simulate full three dimensional flow, full computational fluid dynamics, and direct simulation Monte-Carlo calculations. Methods of determining catalytic recombination rates in arc jet flow are discus ed. An area of catalysis not fully understood is the formation of single-wall carbon nanotubes (SWNT) with gas phase or nano-size metal particles. The Johnson Space Center is making SWNTs using both a laser ablation technique and an electric arc vaporization technique.
Effect of process parameters on the residual stresses in AA5083-H321 friction stir welds
Energy Technology Data Exchange (ETDEWEB)
Lombard, H. [NMMU, Gardham Avenue, PO Box 77000, 6031 Port Elizabeth (South Africa); University of Plymouth, Drake Circus, Plymouth PL4 8AA (United Kingdom); Hattingh, D.G. [NMMU, Gardham Avenue, PO Box 77000, 6031 Port Elizabeth (South Africa); Steuwer, A. [NMMU, Gardham Avenue, PO Box 77000, 6031 Port Elizabeth (South Africa); FaME38 at the ILL-ESRF, 6 rue J Horowitz, 38042 Grenoble (France); University of Plymouth, Drake Circus, Plymouth PL4 8AA (United Kingdom)], E-mail: steuwer@ill.fr; James, M.N. [NMMU, Gardham Avenue, PO Box 77000, 6031 Port Elizabeth (South Africa); University of Plymouth, Drake Circus, Plymouth PL4 8AA (United Kingdom)
2009-02-15
This paper investigates the effect of varying welding parameters on the residual stress profiles in friction stir welds of aluminium alloy AA5083-H321, which were created on a fully instrumented friction welding machine. The residual stresses were determined non-destructively using synchrotron X-ray diffraction. The width and maximum of the residual stress profile show clear correlation with the heat input, and in particular feed rate, which was found to be the dominant parameter.
Axes of resistance for tooth movement: does the center of resistance exist in 3-dimensional space?
Viecilli, Rodrigo F; Budiman, Amanda; Burstone, Charles J
2013-02-01
The center of resistance is considered the most important reference point for tooth movement. It is often stated that forces through this point will result in tooth translation. The purpose of this article is to report the results of numeric experiments testing the hypothesis that centers of resistance do not exist in space as 3-dimensional points, primarily because of the geometric asymmetry of the periodontal ligament. As an alternative theory, we propose that, for an arbitrary tooth, translation references can be determined by 2-dimensional projection intersections of 3-dimensional axes of resistance. Finite element analyses were conducted on a maxillary first molar model to determine the position of the axes of rotation generated by 3-dimensional couples. Translation tests were performed to compare tooth movement by using different combinations of axes of resistance as references. The couple-generated axes of rotation did not intersect in 3 dimensions; therefore, they do not determine a 3-dimensional center of resistance. Translation was obtained by using projection intersections of the 2 axes of resistance perpendicular to the force direction. Three-dimensional axes of resistance, or their 2-dimensional projection intersections, should be used to plan movement of an arbitrary tooth. Clinical approximations to a small 3-dimensional "center of resistance volume" might be adequate in nearly symmetric periodontal ligament cases. Copyright © 2013 American Association of Orthodontists. Published by Mosby, Inc. All rights reserved.
Mars Atmospheric In Situ Resource Utilization Projects at the Kennedy Space Center
Muscatello, A. C.; Hintze, P. E.; Caraccio, A. J.; Bayliss, J. A.; Karr, L. J.; Paley, M. S.; Marone, M. J.; Gibson, T. L.; Surma, J. M.; Mansell, J. M.;
2016-01-01
The atmosphere of Mars, which is approximately 95% carbon dioxide (CO2), is a rich resource for the human exploration of the red planet, primarily by the production of rocket propellants and oxygen for life support. Three recent projects led by NASA's Kennedy Space Center have been investigating the processing of CO2. The first project successfully demonstrated the Mars Atmospheric Processing Module (APM), which freezes CO2 with cryocoolers and combines sublimated CO2 with hydrogen to make methane and water. The second project absorbs CO2 with Ionic Liquids and electrolyzes it with water to make methane and oxygen, but with limited success so far. A third project plans to recover up to 100% of the oxygen in spacecraft respiratory CO2. A combination of the Reverse Water Gas Shift reaction and the Boudouard reaction eventually fill the reactor up with carbon, stopping the process. A system to continuously remove and collect carbon is under construction.
Mars Atmospheric In Situ Resource Utilization Projects at the Kennedy Space Center
Muscatello, Anthony; Hintze, Paul; Meier, Anne; Bayliss, Jon; Karr, Laurel; Paley, Steve; Marone, Matt; Gibson, Tracy; Surma, Jan; Mansell, Matt;
2016-01-01
The atmosphere of Mars, which is 96 percent carbon dioxide (CO2), is a rich resource for the human exploration of the red planet, primarily by the production of rocket propellants and oxygen for life support. Three recent projects led by NASAs Kennedy Space Center have been investigating the processing of CO2. The first project successfully demonstrated the Mars Atmospheric Processing Module (APM), which freezes CO2 with cryocoolers and combines sublimated CO2 with hydrogen to make methane and water. The second project absorbs CO2 with Ionic Liquids and electrolyzes it with water to make methane and oxygen, but with limited success so far. A third project plans to recover up to 100 of the oxygen in spacecraft respiratory CO2. A combination of the Reverse Water Gas Shift reaction and the Boudouard reaction eventually fill the reactor up with carbon, stopping the process. A system to continuously remove and collect carbon has been tested with encouraging results.
Constitutive Soil Properties for Mason Sand and Kennedy Space Center
Thomas, Michael A.; Chitty, Daniel E.
2011-01-01
Accurate soil models are required for numerical simulations of land landings for the Orion Crew Exploration Vehicle (CEV). This report provides constitutive material models for two soil conditions at Kennedy Space Center (KSC) and four conditions of Mason Sand. The Mason Sand is the test sand for LaRC s drop tests and swing tests of the Orion. The soil models are based on mechanical and compressive behavior observed during geotechnical laboratory testing of remolded soil samples. The test specimens were reconstituted to measured in situ density and moisture content. Tests included: triaxial compression, hydrostatic compression, and uniaxial strain. A fit to the triaxial test results defines the strength envelope. Hydrostatic and uniaxial tests define the compressibility. The constitutive properties are presented in the format of LSDYNA Material Model 5: Soil and Foam. However, the laboratory test data provided can be used to construct other material models. The soil models are intended to be specific to the soil conditions they were tested at. The two KSC models represent two conditions at KSC: low density dry sand and high density in-situ moisture sand. The Mason Sand model was tested at four conditions which encompass measured conditions at LaRC s drop test site.
Initial Growth Process of Magnetron Sputtering 321 Stainless Steel Films Observed by Afm
Jin, Yongzhong; Wu, Wei; Liu, Dongliang; Chen, Jian; Sun, Yali
To investigate the initial morphological evolution of 321 stainless steel (SS) films, we examined the effect of sputtering time on the morphology of 321 SS film. In this study, a group of samples were prepared at nine different sputtering times within 20 s using radio-frequency (r.f.) magnetron sputtering and characterized by atomic force microscopy (AFM). Only globular-like grains were formed on mica substrates within 6 s, whose average grain size is ~ 21-44 nm. Meanwhile, few grains with larger size are subject to settle at the defect sites of mica substrates. At 8 s, we found large columnar crystallites with the average grain size of 61 nm. From 10 to 14 s, islands grew continuously and coalesced in order to form an interconnected structure containing irregular channels or grooves, with a depth of ~ 3.5-5 nm. Up to 16 s, a nearly continuous film was formed and some new globular-like grains were again present on the film. Study of the AFM image at 20 s suggests that the watercolor masking method designed by us is an effective method, by which we can prepare thin films with steps for the measurement of the thickness of continuous thin films. It is also found that the coverage rate of films increases with the increase in sputtering time (from 2 to 16 s). On the other hand, the increase in root mean square (RMS) roughness is much more significant from 6 to 10 s, and there is a maximum value, 2.81 nm at 10 s due to more islands during deposition. However, RMS roughness decreases with the decrease in length and width of channels or grooves from 10 to 16 s. Especially, a lower RMS roughness of 0.73 nm occurs at 16 s, because of the continuous film produced with a large coverage rate of 98.43%.
Taylor, Gary O.
2001-01-01
John C. Stennis Space Center continues to support the Propulsion community in an effort to validate High-Test Peroxide as an alternative to existing/future oxidizers. This continued volume of peroxide test/handling activity at Stennis Space Center (SSC) provides numerous opportunities for the SSC team to build upon previously documented 'lessons learned'. SSC shall continue to strive to document their experience and findings as H2O2 issues surface. This paper is intended to capture all significant peroxide issues that we have learned over the last three years. This data (lessons learned) has been formulated from practical handling, usage, storage, operations, and initial development/design of our systems/facility viewpoint. The paper is intended to be an information type tool and limited in technical rational; therefore, presenting the peroxide community with some issues to think about as the continued interest in peroxide evolves and more facilities/hardware are built. These lessons learned are intended to assist industry in mitigating problems and identifying potential pitfalls when dealing with the requirements for handling high-test peroxide.
2002-01-01
International Flavors and Fragrances (IFF), Inc., discovered a new scent by flying a miniature rose plant aboard NASA's Space Shuttle Discovery Flight STS-95. IFF and the Wisconsin Center for Space Automation and Robotics (WCSAR) partnered to fly the rose plant in the commercial plant research facility, ASTROCULTURE(TM), for reduced-gravity environment research. IFF commercialized the space rose note, which is now a fragrance ingredient in a perfume developed by Shiseido Cosmetics (America), Ltd. In addition to providing a light crisp scent, the oil from the space rose can also serve as a flavor enhancer. ASTROCULTURE(TM) is a trademark of the Wisconsin Center for Space Automation and Robotics.
Davis, V. Leon; Nordeen, Ross
1988-01-01
A laboratory for developing robotics technology for hazardous and repetitive Shuttle and payload processing activities is discussed. An overview of the computer hardware and software responsible for integrating the laboratory systems is given. The center's anthropomorphic robot is placed on a track allowing it to be moved to different stations. Various aspects of the laboratory equipment are described, including industrial robot arm control, smart systems integration, the supervisory computer, programmable process controller, real-time tracking controller, image processing hardware, and control display graphics. Topics of research include: automated loading and unloading of hypergolics for space vehicles and payloads; the use of mobile robotics for security, fire fighting, and hazardous spill operations; nondestructive testing for SRB joint and seal verification; Shuttle Orbiter radiator damage inspection; and Orbiter contour measurements. The possibility of expanding the laboratory in the future is examined.
Spruce, Joseph P.; Ross, Kenton W.; Graham, William D.
2007-01-01
Hurricane Katrina hit southwestern Mississippi on August 29, 2005, at 9:45 a.m. CDT as a category 3 storm with surges up to approx. 9 m and sustained winds of approx. 120 mph. The hurricane's wind, rain, and flooding devastated several coastal towns, from New Orleans through Mobile. The storm also caused significant damage to infrastructure and vegetation of NASA's SSC (Stennis Space Center). Storm recovery at SSC involved not only repairs of critical infrastructure but also forest damage mitigation (via timber harvests and control burns to reduce fire risk). This presentation discusses an effort to use commercially available high spatial resolution multispectral IKONOS data for vegetation damage assessment, based on data collected over SSC on September 2, 2005.
He, Chi; Bai, Zengbing; Hu, Jialei; Wang, Bingnan; Xie, Hujun; Yu, Lei; Ding, Hanfeng
2017-07-25
A solvent-dependent oxidative dearomatization-induced divergent [5+2] cascade approach to bicyclo[3.2.1]octanes was described. This novel protocol enables a facile synthesis of a series of diversely functionalized ent-kaurene and cedrene-type skeletons in good yields and excellent diastereoselectivities.
2012-11-28
graduation, Capt Chang’s next assignment is at Los Angeles Air Force Base in the Space and Missile Systems Center (SMC). Capt Chang is unmarried with... married to the former Ms. Laura Hazzard, and they have three children, Madden, and twins Aubrey and Tyler. Captain Keith V. Philaphandeth is an Air...2012 SPONSORED RESEARCH TOPICS Acquisition Management Acquiring Combat Capability via Public-Private Partnerships (PPPs) BCA: Contractor vs
Science Outreach at NASA's Marshall Space Flight Center
Lebo, George
2002-07-01
At the end of World War II Duane Deming, an internationally known economist enunciated what later came to be called "Total Quality Management" (TQM). The basic thrust of this economic theory called for companies and governments to identify their customers and to do whatever was necessary to meet their demands and to keep them satisfied. It also called for companies to compete internally. That is, they were to build products that competed with their own so that they were always improving. Unfortunately most U.S. corporations failed to heed this advice. Consequently, the Japanese who actively sought Deming's advice and instituted it in their corporate planning, built an economy that outstripped that of the U.S. for the next three to four decades. Only after U.S. corporations reorganized and fashioned joint ventures which incorporated the tenets of TQM with their Japanese competitors did they start to catch up. Other institutions such as the U.S. government and its agencies and schools face the same problem. While the power of the U.S. government is in no danger of being usurped, its agencies and schools face real problems which can be traced back to not heeding Deming's advice. For example, the public schools are facing real pressure from private schools and home school families because they are not meeting the needs of the general public, Likewise, NASA and other government agencies find themselves shortchanged in funding because they have failed to convince the general public that their missions are important. In an attempt to convince the general public that its science mission is both interesting and important, in 1998 the Science Directorate at NASA's Marshall Space Flight Center (MSFC) instituted a new outreach effort using the interact to reach the general public as well as the students. They have called it 'Science@NASA'.
Nuclear waste disposal in space
Burns, R. E.; Causey, W. E.; Galloway, W. E.; Nelson, R. W.
1978-01-01
Work on nuclear waste disposal in space conducted by the George C. Marshall Space Flight Center, National Aeronautics and Space Administration, and contractors are reported. From the aggregate studies, it is concluded that space disposal of nuclear waste is technically feasible.
Brenton, James C.; Barbre. Robert E., Jr.; Decker, Ryan K.; Orcutt, John M.
2018-01-01
The National Aeronautics and Space Administration's (NASA) Marshall Space Flight Center (MSFC) Natural Environments Branch (EV44) has provided atmospheric databases and analysis in support of space vehicle design and day-of-launch operations for NASA and commercial launch vehicle programs launching from the NASA Kennedy Space Center (KSC), co-located on the United States Air Force's Eastern Range (ER) at the Cape Canaveral Air Force Station. The ER complex is one of the most heavily instrumented sites in the United States with over 31 towers measuring various atmospheric parameters on a continuous basis. An inherent challenge with large sets of data consists of ensuring erroneous data is removed from databases, and thus excluded from launch vehicle design analyses. EV44 has put forth great effort in developing quality control (QC) procedures for individual meteorological instruments, however no standard QC procedures for all databases currently exists resulting in QC databases that have inconsistencies in variables, methodologies, and periods of record. The goal of this activity is to use the previous efforts by EV44 to develop a standardized set of QC procedures from which to build meteorological databases from KSC and the ER, while maintaining open communication with end users from the launch community to develop ways to improve, adapt and grow the QC database. Details of the QC procedures will be described. As the rate of launches increases with additional launch vehicle programs, it is becoming more important that weather databases are continually updated and checked for data quality before use in launch vehicle design and certification analyses.
Johnson Space Center's Free Range Bicycle Program.- Fall 2015 Intern Report
Lee-Stockton, Willem
2015-01-01
NASA's Johnson Space Center is a big place, encompassing 1,620 acres and more than a hundred buildings. Furthermore, there are reportedly 15 thousand employees, all of which have somewhere to be. To facilitate the movement of all these people JSC has historically relied on human power. Pedaling their way towards deep space, bicycles have been the go to method. Currently there are about 200 Free Range Bicycles at JSC. Free Range Bicycles belong to nobody, except NASA, and are available for anybody to use. They are not to be locked or hidden (although frequently are) and the intention is that there will always be a bike to hop on to get where you're going (although it may not be the bike you rode in on). Although not without its own shortcomings, the Free Range Bicycle Program has continued to provide low cost, simple transportation for NASA's JSC. In addition to the approximately 200 Free Range Bicycles, various larger divisions (like engineering) will often buy a few dozen bikes for their team members to use or individuals will bring their own personal bike to either commute or use on site. When these bicycles fall into disrepair or are abandoned (from retirees etc) they become a problem at JSC. They are an eye sore, create a safety hazard and make it harder to find a working bike in a time of need. The Free Range Program hopes to address this first problem by "tagging out" abandoned or out of service bicycles. A bright orange "DO NOT OPERATE" tag is placed on the bike and given a serial number for tracking purposes. See picture to the right. If the bike has an active owner with intentions to repair the bike the bottom of the tag has instructions for how to claim the abandoned bicycle. After being tagged the owner of the bicycle has 30 days to claim the bicycle and either haul it off site or get it repaired (and labeled) in accordance with Johnson's Bicycle Policy. If the abandoned bicycle is not claimed within 30 days it becomes the property of the Government. The
Banded versus Single-sided bonded space maintainers: A Comparative Study
Directory of Open Access Journals (Sweden)
Sudhir Mittal
2018-01-01
Full Text Available Background: The present study is conducted to evaluate and compare the clinical performance of conventional band and loop space maintainer and fiber reinforced composite resin (FRCR space maintainers. Materials and Methods: A total of 45 extraction sites in the age group of 6–9 years having premature loss of primary molars or indicated for extraction were selected for the study. The patients were randomly divided into three groups as Group I, in which conventional band and loop space maintainer was given, Group II and Group III (FRCR, in which FRCR (everStick CandB and impregnated glass fibers (Interlig space maintainers were given, respectively. Patients were recalled at 3, 6, and 12-month interval for evaluation of all the three types of space maintainer. Results: Overall success rate of Group I was 86.7%, for Group II was 80%, and for Group III was 73.3% at the end of the study. Patient acceptability was significantly higher in Group II and Group III (FRCR as compared to Group I (Conventional band and loop. In Group I, cement loss and fracture of loop, whereas in Group II and Group III, debonding at enamel composite was the most common failure followed by debonding at fiber composite and fiber fracture. FRCR space maintainers were found to be cost-effective as compared to Group I. More linear changes and angular changes were recorded in Group I as compared to Group II and Group III but difference was not significant (P > 0.05. Conclusion: Only single (buccal surface application of FRCR space maintainers showed almost equal clinical efficacy compared to conventional band and loop space maintainer with significantly better patient acceptability, less cost, and time taken.
International Nuclear Information System (INIS)
Dagkesamanskii, Rustam D
2009-01-01
The development of Russian (formerly Soviet) radio astronomy is indissolubly linked with the P N Lebedev Physical Institute (LPI), Russian Academy of Sciences. From the late 1940s, the institute conducted most of its radio astronomy research in the Crimea, at stations or on field trips; in the late 1950s, the center of gravity of research moved to the southern Moscow region, where one of the largest radio astronomy observatories in the country and in the world was developed within less than twenty years. The observatory unique instrumentation system is briefly reviewed in a historical perspective. Key research areas and some major achievements are outlined, and the prospects of the observatory as (currently) part of the LPI Astro Space Center are examined. (conferences and symposia)
Energy Technology Data Exchange (ETDEWEB)
Dagkesamanskii, Rustam D [Pushchino Radio Astronomy Observatory, Astro Space Center, Lebedev Physical Institute, Russian Academy of Sciences, Pushchino, Moscow region (Russian Federation)
2009-11-30
The development of Russian (formerly Soviet) radio astronomy is indissolubly linked with the P N Lebedev Physical Institute (LPI), Russian Academy of Sciences. From the late 1940s, the institute conducted most of its radio astronomy research in the Crimea, at stations or on field trips; in the late 1950s, the center of gravity of research moved to the southern Moscow region, where one of the largest radio astronomy observatories in the country and in the world was developed within less than twenty years. The observatory unique instrumentation system is briefly reviewed in a historical perspective. Key research areas and some major achievements are outlined, and the prospects of the observatory as (currently) part of the LPI Astro Space Center are examined. (conferences and symposia)
Hot compression deformation behavior of AISI 321 austenitic stainless steel
Haj, Mehdi; Mansouri, Hojjatollah; Vafaei, Reza; Ebrahimi, Golam Reza; Kanani, Ali
2013-06-01
The hot compression behavior of AISI 321 austenitic stainless steel was studied at the temperatures of 950-1100°C and the strain rates of 0.01-1 s-1 using a Baehr DIL-805 deformation dilatometer. The hot deformation equations and the relationship between hot deformation parameters were obtained. It is found that strain rate and deformation temperature significantly influence the flow stress behavior of the steel. The work hardening rate and the peak value of flow stress increase with the decrease of deformation temperature and the increase of strain rate. In addition, the activation energy of deformation ( Q) is calculated as 433.343 kJ/mol. The microstructural evolution during deformation indicates that, at the temperature of 950°C and the strain rate of 0.01 s-1, small circle-like precipitates form along grain boundaries; but at the temperatures above 950°C, the dissolution of such precipitates occurs. Energy-dispersive X-ray analyses indicate that the precipitates are complex carbides of Cr, Fe, Mn, Ni, and Ti.
Kalcic, Maria; Turowski, Mark; Hall, Callie
2010-01-01
Presentation topics include: importance of salinity of coastal waters, habitat switching algorithm, habitat switching module, salinity estimates from Landsat for Sabine Calcasieu Basin, percent of time inundated in 2006, salinity data, prototyping the system, system as packaged for field tests, salinity probe and casing, opening for water flow, cellular antenna used to transmit data, preparing to launch, system is launched in the Pearl River at Stennis Space Center, data are transmitted to Twitter by cell phone modem every 15 minutes, Google spreadsheet I used to import the data from the Twitter feed and to compute salinity (from conductivity) and display charts of salinity and temperature, results are uploaded to NASA's Applied Science and Technology Project Office Webpage.
Energy Technology Data Exchange (ETDEWEB)
Schey, Stephen [Idaho National Lab. (INL), Idaho Falls, ID (United States); Francfort, Jim [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2015-05-01
Federal agencies are mandated to purchase alternative fuel vehicles, increase consumption of alternative fuels, and reduce petroleum consumption. Available plug-in electric vehicles (PEVs) provide an attractive option in the selection of alternative fuel vehicles. PEVs, which consist of both battery electric vehicles (BEVs) and plug-in hybrid electric vehicles (PHEVs), have significant advantages over internal combustion engine (ICE) vehicles in terms of energy efficiency, reduced petroleum consumption, and reduced production of greenhouse gas (GHG) emissions, and they provide performance benefits with quieter, smoother operation. This study intended to evaluate the extent to which NASA Stennis Space Center (Stennis) could convert part or all of their fleet of vehicles from petroleum-fueled vehicles to PEVs.
Space Weather Forecasting at IZMIRAN
Gaidash, S. P.; Belov, A. V.; Abunina, M. A.; Abunin, A. A.
2017-12-01
Since 1998, the Institute of Terrestrial Magnetism, Ionosphere, and Radio Wave Propagation (IZMIRAN) has had an operating heliogeophysical service—the Center for Space Weather Forecasts. This center transfers the results of basic research in solar-terrestrial physics into daily forecasting of various space weather parameters for various lead times. The forecasts are promptly available to interested consumers. This article describes the center and the main types of forecasts it provides: solar and geomagnetic activity, magnetospheric electron fluxes, and probabilities of proton increases. The challenges associated with the forecasting of effects of coronal mass ejections and coronal holes are discussed. Verification data are provided for the center's forecasts.
Parker, L.; Minow, J.; Pulkkinen, A.; Fry, D.; Semones, E.; Allen, J.; St Cyr, C.; Mertens, C.; Jun, I.; Onsager, T.; Hock, R.
2018-02-01
NASA's Engineering and Space Center (NESC) is conducting an independent technical assessment of space environment monitoring and forecasting architecture options to support human and robotic deep space exploration.
Center Innovation Fund: AFRC CIF Program
National Aeronautics and Space Administration — The Armstrong Flight Research Center is NASA’s primary center for atmospheric flight research and operations, with a vision “to fly what others only...
Distribution of specialized care centers in the United States.
Wang, Henry E; Yealy, Donald M
2012-11-01
As a recommended strategy for optimally managing critical illness, regionalization of care involves matching the needs of the target population with available hospital resources. The national supply and characteristics of hospitals providing specialized critical care services is currently unknown. We seek to characterize the current distribution of specialized care centers in the United States. Using public data linked with the American Hospital Association directory and US Census, we identified US general acute hospitals providing specialized care for ST-segment elevation myocardial infarction (STEMI) (≥40 annual primary percutaneous coronary interventions reported in Medicare Hospital Compare), stroke (The Joint Commission certified stroke centers), trauma (American College of Surgeons or state-designated, adult or pediatric, level I or II), and pediatric critical care (presence of a pediatric ICU) services. We determined the characteristics and state-level distribution and density of specialized care centers (centers per state and centers per state population). Among 4,931 acute care hospitals in the United States, 1,325 (26.9%) provided one of the 4 defined specialized care services, including 574 STEMI, 763 stroke, 508 trauma, and 457 pediatric critical care centers. Approximately half of the 1,325 hospitals provided 2 or more specialized services, and one fifth provided 3 or 4 specialized services. There was variation in the number of each type of specialized care center in each state: STEMI median 7 interquartile range (IQR 2 to 14), stroke 8 (IQR 3 to 17), trauma 6 (IQR 3 to 11), pediatric specialized care 6 (IQR 3 to 11). Similarly, there was variation in the number of each type of specialized care center per population: STEMI median 1 center per 585,135 persons (IQR 418,729 to 696,143), stroke 1 center per 412,188 persons (IQR 321,604 to 572,387), trauma 1 center per 610,589 persons (IQR 406,192 to 917,588), and pediatric critical care 1 center per 665
DEFF Research Database (Denmark)
Jørgensen, Mariane Ellen; Folmer, Mette Blicher; Mullins, Michael
SPACE FOR INTERACTION QUALIFYING GROUP TREATMENT FOR PATIENTS WITH CHRONIC PAIN THROUGH OPTIMIZATION(?) OF SPACE. A RANDOMIZED PILOT STUDY. In a Ph-D. Mariane Ellen Jørgensen / Nurse + psykoterapist / maej@rn.dk / Pain Center / Aalborg University Hospital / Denmark / Mette Blicher Folmer / Archit...
Kent in space: Cosmic dust to space debris
McDonnell, J. A. M.
1994-10-01
The dusty heritage of the University of Kent's Space Group commenced at Jodrell Bank, Cheshire, U.K., the home of the largest steerable radio telescope. While Professor Bernard Lovell's 250 ft. diameter telescope was used to command the U.S. deep space Pioneer spacecraft, Professor Tony McDonnell, as a research student in 1960, was developing a space dust detector for the US-UK Ariel program. It was successful. With a Ph.D. safely under the belt, it seemed an inevitable step to go for the next higher degree, a B.T.A.] Two years with NASA at Goddard Space Flight Center, Greenbelt, provided excellent qualifications for such a graduation ('Been to America'). A spirited return to the University of Kent at Canterbury followed, to one of the green field UK University sites springing from the Robbins Report on Higher Education. Swimming against the current of the brain drain, and taking a very considerable reduction in salary, it was with some disappointment that he found that the UK Premier Harold Wilson's 'white-hot technological revolution' never quite seemed to materialize in terms of research funding] Research expertise, centered initially on cosmic dust, enlarged to encompass planetology during the Apollo program, and rightly acquired international acclaim, notching up a history of space missions over 25 years. The group now comprises 38 people supported by four sources: the government's Research Councils, the University, the Space Agencies and Industry. This paper describes the thrust of the group's Research Plan in Space Science and Planetology; not so much based on existing international space missions, but more helping to shape the direction and selection of space missions ahead.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Inapplicability of âretail conceptâ to some types of sales... DIRECTLY RELATED TO REGULATIONS THE FAIR LABOR STANDARDS ACT AS APPLIED TO RETAILERS OF GOODS OR SERVICES... Retailâ § 779.321 Inapplicability of “retail concept” to some types of sales or services of an eligible...
Packard, Kathryn; Goodman, Doug; Whittington, James
2016-01-01
The NASA Small Business Innovation Research (SBIR) Program has served as a beneficial funding vehicle to both US small technology businesses and the Federal Agencies that participate in the program. This paper, to the extent possible, while observing Intellectual Property (IP) laws, will discuss the many SBIR and STTR (SBIR Technology Transfer) successes in the recent history of the NASA Johnson Space Center (JSC). Many of the participants of the International Conference on Environmental Systems (ICES) have based their research and papers on technologies that were made possible by SBIR/STTR awards and post award funding. Many SBIR/STTR successes have flown on Space Shuttle missions, Space X Dragons, and other spacecraft. SBIR/STTR technologies are currently infused on the International Space Station (ISS) and satellites, one of which was a NASA/JAXA (Japanese Space Agency) joint venture. Many of these companies have commercialized their technologies and grown as businesses while helping the economy through the creation of new jobs. In addition, this paper will explore the opportunity for international partnership with US SBIR/STTR companies as up to 49% of the makeup of the company is not required to be American owned. Although this paper will deal with technical achievements, it does not purport to be technical in nature. It will address the many requests for information on successes and opportunities within NASA SBIR and the virtually untapped potential of international partnering.
Sequence and annotation of the 314-kb MT325 and the 321-kb FR483 viruses that infect Chlorella Pbi.
Fitzgerald, Lisa A; Graves, Michael V; Li, Xiao; Feldblyum, Tamara; Hartigan, James; Van Etten, James L
2007-02-20
Viruses MT325 and FR483, members of the family Phycodnaviridae, genus Chlorovirus, infect the fresh water, unicellular, eukaryotic, chlorella-like green alga, Chlorella Pbi. The 314,335-bp genome of MT325 and the 321,240-bp genome of FR483 are the first viruses that infect Chlorella Pbi to have their genomes sequenced and annotated. Furthermore, these genomes are the two smallest chlorella virus genomes sequenced to date, MT325 has 331 putative protein-encoding and 10 tRNA-encoding genes and FR483 has 335 putative protein-encoding and 9 tRNA-encoding genes. The protein-encoding genes are almost evenly distributed on both strands, and intergenic space is minimal. Approximately 40% of the viral gene products resemble entries in public databases, including some that are the first of their kind to be detected in a virus. For example, these unique gene products include an aquaglyceroporin in MT325, a potassium ion transporter protein and an alkyl sulfatase in FR483, and a dTDP-glucose pyrophosphorylase in both viruses. Comparison of MT325 and FR483 protein-encoding genes with the prototype chlorella virus PBCV-1 indicates that approximately 82% of the genes are present in all three viruses.
Public views evening engine test of a Space Shuttle Main Engine
2001-01-01
Over the past year, more than 20,000 people came to Stennis Space Center to witness the 'shake, rattle and roar' of one of the world's most sophisticated engines. Stennis Space Center in south Mississippi is NASA's lead center for rocket propulsion testing. StenniSphere, the visitor center for Stennis Space Center, hosted more than 250,000 visitors in its first year of operation. Of those visitors, 26.4 percent were from Louisiana.
Cacoub, P; Renou, C; Rosenthal, E; Cohen, P; Loury, I; Loustaud-Ratti, V; Yamamoto, A M; Camproux, A C; Hausfater, P; Musset, L; Veyssier, P; Raguin, G; Piette, J C
2000-01-01
From January 1996 to January 1997, 321 patients with an average age of 46 +/- 16 years and chronically infected with hepatitis C virus (HCV) were prospectively enrolled in a study designed to determine the prevalence of extrahepatic manifestations associated with HCV infection in a large cohort of HCV patients, to identify associations between clinical and biologic manifestations, and to compare the results obtained in human immunodeficiency virus (HIV)-positive versus HIV-negative subsets. In a cross-sectional study, clinical extrahepatic manifestations, viral coinfections with HIV and/or hepatitis B virus, connective tissue diseases, and a wide panel of autoantibodies were assessed. Thirty-eight percent (122/321) of patients presented at least 1 clinical extrahepatic manifestation including arthralgia (60/321, 19%), skin manifestations (55/321, 17%), xerostomia (40/321, 12%), xerophthalmia (32/321, 10%), and sensory neuropathy (28/321, 9%). Main biologic abnormalities were mixed cryoglobulins (110/196, 56%), thrombocytopenia (50/291, 17%), and the presence of the following autoantibodies: antinuclear (123/302, 41%), rheumatoid factor (107/280, 38%), anticardiolipin (79/298, 27%), antithyroglobulin (36/287, 13%) and antismooth muscle cell (27/288, 9%). At least 1 autoantibody was present in 210/302 (70%) of sera. By multivariate logistic regression analysis, 4 parameters were significantly associated with cryoglobulin positivity: systemic vasculitis (p = 0.01, odds ratio OR[ = 17.3), HIV positivity (p = 0.0006, OR = 10.2), rheumatoid factor positivity (p = 0.01, OR = 2.8), and sicca syndrome (p = 0.03, OR = 0.27). A definite connective tissue disease was noted in 44 patients (14%), mainly symptomatic mixed cryoglobulinemia and systemic vasculitis, HIV coinfection (23%) was associated with 3 parameters: anticardiolipin (p = 0.003, OR = 4.18), thrombocytopenia (p = 0.01, OR = 3.56), and arthralgia or myalgia (p = 0.017, OR = 0.23). HIV-positive patients presented
Using and Distributing Spaceflight Data: The Johnson Space Center Life Sciences Data Archive
Cardenas, J. A.; Buckey, J. C.; Turner, J. N.; White, T. S.; Havelka,J. A.
1995-01-01
Life sciences data collected before, during and after spaceflight are valuable and often irreplaceable. The Johnson Space Center Life is hard to find, and much of the data (e.g. Sciences Data Archive has been designed to provide researchers, engineers, managers and educators interactive access to information about and data from human spaceflight experiments. The archive system consists of a Data Acquisition System, Database Management System, CD-ROM Mastering System and Catalog Information System (CIS). The catalog information system is the heart of the archive. The CIS provides detailed experiment descriptions (both written and as QuickTime movies), hardware descriptions, hardware images, documents, and data. An initial evaluation of the archive at a scientific meeting showed that 88% of those who evaluated the catalog want to use the system when completed. The majority of the evaluators found the archive flexible, satisfying and easy to use. We conclude that the data archive effectively provides key life sciences data to interested users.
14 CFR 25.29 - Empty weight and corresponding center of gravity.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Empty weight and corresponding center of gravity. 25.29 Section 25.29 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... and corresponding center of gravity. (a) The empty weight and corresponding center of gravity must be...
14 CFR 29.29 - Empty weight and corresponding center of gravity.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Empty weight and corresponding center of gravity. 29.29 Section 29.29 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... weight and corresponding center of gravity. (a) The empty weight and corresponding center of gravity must...
14 CFR 27.29 - Empty weight and corresponding center of gravity.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Empty weight and corresponding center of gravity. 27.29 Section 27.29 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... and corresponding center of gravity. (a) The empty weight and corresponding center of gravity must be...
Space plasma observations - observations of solar-terrestrial environment. Space Weather Forecast
International Nuclear Information System (INIS)
Sagawa, Eiichi; Akioka, Maki
1996-01-01
The space environment becomes more important than ever before because of the expansion in the utilization of near-earth space and the increase in the vulnerability of large scale systems on the ground such as electrical power grids. The concept of the Space Weather Forecast program emerged from the accumulation of understanding on basic physical processes and from our activities as one of the regional warning centers of the international network of space environment services. (author)
Institute of Scientific and Technical Information of China (English)
无
2011-01-01
China launches a prototype space module as a precursor to a manned space station China’s first unmanned space module Tiangong-1,or Heavenly Palace-1,successfully lifted off from the Jiuquan Satellite Launch Center in northwest China’s Gansu Province on September 29. "The successful launch of the 8.5-ton
Workshop Report on Space Weather Risks and Society
Langhoff, Stephanie R.; Straume, Tore
2012-01-01
As technological innovations produce new capabilities, complexities, and interdependencies, our susceptibility to the societal impacts of space weather increase. There is real concern in the scientific community that our infrastructure would be at significant risk if a major geomagnetic storm should occur. To discuss the societal impacts of space weather, we brought together an interdisciplinary group of subject matter experts and societal stakeholders to participate in a workshop entitled Space Weather Risks and Society. The workshop was held at Ames Research Center (ARC) on 15-16 October 2011. The workshop was co-sponsored by NASA Ames Research Center (ARC), the Lockheed Martin Advanced Technology Center (LMATC), the Space Weather Prediction Center (SWPC, part of the National Oceanic and Atmospheric Administration NOAA), and the Rutherford Appleton Laboratory (RAL, part of the UK Science and Technology Facilities Council STFC). The workshop is part of a series of informal weekend workshops hosted by Center Director Pete Worden.
Directory of Open Access Journals (Sweden)
Volgemut, Mateja
2016-10-01
Full Text Available Urban areas of the central activities with mixed land use are crucial for the development of city center, even in small cities. In the last decades or two the attention is drawn on the retail and service activities that are usually located outside of cities near main roads. Municipalities had already detected this problem, but they are not implementing any of the measures (Rebernik, 2010. The purpose of this paper is to demonstrate that the central activities in small cities in Slovenia are located in freestanding buildings, which is most appropriate in terms of forming the open public space in the city center. In this research we compared ten central activities (Vrišer, 1988, 1990, Kokole, 1971 in 34 small cities. We selected only those small cities (Prosen et al, 2008 which have among other activities a county court. The results showed the differences and commonalities of the central activities in selected small cities according to the indicators. Litija, Domžale and Sevnica are small cities, where activities that could articulate open public space are located in the larger building complexes. The phenomenon is similar to a modern machine, where action in it and indirectly the insight into the functioning of the society is invisible to the observer (Kos, 2008. We found out that in these tree cities the central activities are not forming the open public spaces in front of the public buildings (Vertelj Nared, 2014. The result is problematic image of the city and changed forces of the city life.
Drug Information in Space Medicine
Bayuse, Tina M.
2009-01-01
Published drug information is widely available for terrestrial conditions. However, information on dosing, administration, drug interactions, stability, and side effects is scant as it relates to use in Space Medicine. Multinational crews on board the International Space Station present additional challenges for drug information because medication nomenclature, information available for the drug as well as the intended use for the drug is not standard across countries. This presentation will look at unique needs for drug information and how the information is managed in Space Medicine. A review was conducted of the drug information requests submitted to the Johnson Space Center Pharmacy by Space Medicine practitioners, astronaut crewmembers and researchers. The information requested was defined and cataloged. A list of references used was maintained. The wide range of information was identified. Due to the information needs for the medications in the on-board medical kits, the Drug Monograph Project was created. A standard method for answering specific drug information questions was generated and maintained by the Johnson Space Center Pharmacy. The Drug Monograph Project will be presented. Topic-centered requests, including multinational drug information, drug-induced adverse reactions, and medication events due to the environment will be highlighted. Information management of the drug information will be explained. Future considerations for drug information needs will be outlined.
DEFF Research Database (Denmark)
2005-01-01
Digital technologies and media are becoming increasingly embodied and entangled in the spaces and places at work and at home. However, our material environment is more than a geometric abstractions of space: it contains familiar places, social arenas for human action. For designers, the integration...... of digital technology with space poses new challenges that call for new approaches. Creative alternatives to traditional systems methodologies are called for when designers use digital media to create new possibilities for action in space. Design Spaces explores how design and media art can provide creative...... alternatives for integrating digital technology with space. Connecting practical design work with conceptual development and theorizing, art with technology, and usesr-centered methods with social sciences, Design Spaces provides a useful research paradigm for designing ubiquitous computing. This book...
Jordan, Eric A.
2004-01-01
Upgrade of data acquisition and controls systems software at Johnson Space Center's Space Environment Simulation Laboratory (SESL) involved the definition, evaluation and selection of a system communication architecture and software components. A brief discussion of the background of the SESL and its data acquisition and controls systems provides a context for discussion of the requirements for each selection. Further framework is provided as upgrades to these systems accomplished in the 1990s and in 2003 are compared to demonstrate the role that technological advances have had in their improvement. Both of the selections were similar in their three phases; 1) definition of requirements, 2) identification of candidate products and their evaluation and testing and 3) selection by comparison of requirement fulfillment. The candidates for the communication architecture selection embraced several different methodologies which are explained and contrasted. Requirements for this selection are presented and the selection process is described. Several candidates for the software component of the data acquisition and controls system are identified, requirements for evaluation and selection are presented, and the evaluation process is described.
Calle, Luz Marina
2014-01-01
Corrosion is the degradation of a material that results from its interaction with the environment. The marine environment at NASAs Kennedy Space Center (KSC) has been documented by ASM International (formerly American Society for Metals) as the most corrosive in the United States. With the introduction of the Space Shuttle in 1981, the already highly corrosive conditions at the launch pads were rendered even more severe by the 70 tons of highly corrosive hydrochloric acid that were generated by the solid rocket boosters. Numerous failures at the launch pads are caused by corrosion.The structural integrity of ground infrastructure and flight hardware is critical to the success, safety, cost, and sustainability of space missions. As a result of fifty years of experience with launch and ground operations in a natural marine environment that is highly corrosive, NASAs Corrosion Technology Laboratory at KSC is a major source of corrosion control expertise in the launch and other environments. Throughout its history, the Laboratory has evolved from what started as an atmospheric exposure facility near NASAs launch pads into a world-wide recognized capability that provides technical innovations and engineering services in all areas of corrosion for NASA and external customers.This presentation will provide a historical overview of the role of NASAs Corrosion Technology in anticipating, managing, and preventing corrosion. One important challenge in managing and preventing corrosion involves the detrimental impact on humans and the environment of what have been very effective corrosion control strategies. This challenge has motivated the development of new corrosion control technologies that are more effective and environmentally friendly. Strategies for improved corrosion protection and durability can have a huge impact on the economic sustainability of human spaceflight operations.
The Process of Science Communications at NASA/Marshall Space Flight Center
Horack, John M.; Treise, Deborah
1998-01-01
The communication of new scientific knowledge and understanding is an integral component of science research, essential for its continued survival. Like any learning- based activity, science cannot continue without communication between and among peers so that skeptical inquiry and learning can take place. This communication provides necessary organic support to maintain the development of new knowledge and technology. However, communication beyond the peer-community is becoming equally critical for science to survive as an enterprise into the 21st century. Therefore, scientists not only have a 'noble responsibility' to advance and communicate scientific knowledge and understanding to audiences within and beyond the peer-community, but their fulfillment of this responsibility is necessary to maintain the survival of the science enterprise. Despite the critical importance of communication to the viability of science, the skills required to perform effective science communications historically have not been taught as a part of the training of scientist, and the culture of science is often averse to significant communication beyond the peer community. Thus scientists can find themselves ill equipped and uncomfortable with the requirements of their job in the new millennium. At NASA/Marshall Space Flight Center, we have developed and implemented an integrated science communications process, providing an institutional capability to help scientist accurately convey the content and meaning of new scientific knowledge to a wide variety of audiences, adding intrinsic value to the research itself through communication, while still maintaining the integrity of the peer-review process. The process utilizes initial communication through the world-wide web at the site http://science.nasa.gov to strategically leverage other communications vehicles and to reach a wide-variety of audiences. Here we present and discuss the basic design of the science communications process, now in
Custom 3D Printers Revolutionize Space Supply Chain
2015-01-01
Under a series of SBIR contracts with Marshall Space Flight Center, start-up company Made In Space, located on the center's campus, developed a high-precision 3D printer capable of manufacturing items in microgravity. The company will soon have a printer installed on the International Space Station, altering the space supply chain. It will print supplies and tools for NASA, as well as nanosatellite shells and other items for public and private entities.
Effect of the purging gas on properties of Ti stabilized AISI 321 stainless steel TIG welds
Energy Technology Data Exchange (ETDEWEB)
Taban, Emel; Kaluc, Erdinc; Aykan, T. Serkan [Kocaeli Univ. (Turkey). Dept. of Mechanical Engineering
2014-07-01
Gas purging is necessary to provide a high quality of stainless steel pipe welding in order to prevent oxidation of the weld zone inside the pipe. AISI 321 stabilized austenitic stainless steel pipes commonly preferred in refinery applications have been welded by the TIG welding process both with and without the use of purging gas. As purging gases, Ar, N{sub 2}, Ar + N{sub 2} and N{sub 2} + 10% H{sub 2} were used, respectively. The aim of this investigation is to detect the effect of purging gas on the weld joint properties such as microstructure, corrosion, strength and impact toughness. Macro sections and microstructures of the welds were investigated. Chemical composition analysis to obtain the nitrogen, oxygen and hydrogen content of the weld root was done by Leco analysis. Ferrite content of the beads including root and cap passes were measured by a ferritscope. Vickers hardness (HV10) values were obtained. Intergranular and pitting corrosion tests were applied to determine the corrosion resistance of all welds. Type of the purging gas affected pitting corrosion properties as well as the ferrite content and nitrogen, oxygen and hydrogen contents at the roots of the welds. Any hot cracking problems are not predicted as the weld still solidifies with ferrite in the primary phase as confirmed by microstructural and ferrite content analysis. Mechanical testing showed no significant change according to the purge gas. AISI 321 steel and 347 consumable compositions would permit use of nitrogen rich gases for root shielding without a risk of hot cracking.
Dark Matter Annihilation in The Galactic Center As Seen by the Fermi Gamma Ray Space Telescope
Energy Technology Data Exchange (ETDEWEB)
Hooper, Dan; /Fermilab /Chicago U., Astron. Astrophys. Ctr.; Goodenough, Lisa; /New York U.
2010-10-01
We analyze the first two years of data from the Fermi Gamma Ray Space Telescope from the direction of the inner 10{sup o} around the Galactic Center with the intention of constraining, or finding evidence of, annihilating dark matter. We find that the morphology and spectrum of the emission between 1.25{sup o} and 10{sup o} from the Galactic Center is well described by a the processes of decaying pions produced in cosmic ray collisions with gas, and the inverse Compton scattering of cosmic ray electrons in both the disk and bulge of the Inner Galaxy, along with gamma rays from known points sources in the region. The observed spectrum and morphology of the emission within approximately 1.25{sup o} ({approx}175 parsecs) of the Galactic Center, in contrast, cannot be accounted for by these processes or known sources. We find that an additional component of gamma ray emission is clearly present which is highly concentrated around the Galactic Center, but is not point-like in nature. The observed morphology of this component is consistent with that predicted from annihilating dark matter with a cusped (and possibly adiabatically contracted) halo distribution ({rho} {proportional_to} r{sup -1.34{+-}0.04}). The observed spectrum of this component, which peaks at energies between 2-4 GeV (in E{sup 2} units), is well fit by that predicted for a 7.3-9.2 GeV dark matter particle annihilating primarily to tau leptons with a cross section in the range of <{sigma}{nu}> = 3.3 x 10{sup -27} to 1.5 x 10{sup -26} cm{sup 3}/s, depending on how the dark matter distribution is normalized. We discuss other possible sources for this component, but argue that they are unlikely to account for the observed emission.
Sigel, Richard A.
1999-01-01
Since 1992, there have been researchers have been studying the population ecology and conservation biology of the amphibians and reptiles of the Kennedy Space Center (KSC) This research is an outgrowth of my Master's work in the late 1970's under Lew Ehrhart at UCF. The primary emphasis of our studies are (1) examination of long-term changes in the abundance of amphibians and reptile populations, (2) occurrence and effects of Upper Respiratory Tract Disease (URTD) in gopher tortoises (Gopherus polyphemus), and (3) ecological studies of selected species.
Ivancic, William; Stewart, Dave; Shell, Dan; Wood, Lloyd; Paulsen, Phil; Jackson, Chris; Hodgson, Dave; Notham, James; Bean, Neville; Miller, Eric
2005-01-01
This report documents the design of network infrastructure to support operations demonstrating the concept of network-centric operations and command and control of space-based assets. These demonstrations showcase major elements of the Transformal Communication Architecture (TCA), using Internet Protocol (IP) technology. These demonstrations also rely on IP technology to perform the functions outlined in the Consultative Committee for Space Data Systems (CCSDS) Space Link Extension (SLE) document. A key element of these demonstrations was the ability to securely use networks and infrastructure owned and/or controlled by various parties. This is a sanitized technical report for public release. There is a companion report available to a limited audience. The companion report contains detailed networking addresses and other sensitive material and is available directly from William Ivancic at Glenn Research Center.
Kennedy Space Center: Creating a Spaceport Reality from the Dreams of Many
Gray, James A.; Colloredo, Scott
2012-01-01
On December 17, 1903, Orville Wright piloted the first powered airplane only 20 feet above the ground near Kitty Hawk, North Carolina. The flight lasted 12 seconds and covered 120 feet. Who would have guessed that the bizarre looking contraption developed by brothers in the bicycle business would lay the ground work eventually resulting in over a million passengers moved daily in a sky filled with the contrails of jets flying at over 30,000 feet in elevation and over 500 miles per hour. Similarly, who would have guessed that the destructive nature of V-2 rockets of Germany would spark the genesis of spaceflight to explore our solar system and beyond? Yet the interest in using the Kennedy Space Center (KSC) continues to grow. Potential customers have expressed interest in KSC as a location for testing new rocket engines, servicing the world's largest airborne launching platform for drop-launch rockets, developing multi-use launch platforms that permit diverse customers to use the same launch platform, developing new spacecraft, and implementing advanced modifications for lifting 150 metric ton payloads to low earth orbit. The multitude of customers has grown and with this growth comes a need to provide a command, control, communication, and range infrastructure that maximizes flexibility and reconfigurability to address a much more frequent launch rate of diverse vehicles and spacecraft. The Ground Systems Development and Operations (GSDO) Program Office at KSC is embarking upon these developments to realize the dream of a robust spaceport. Many unique technical trade studies have been completed or are underway to successfully transition KSC into a multi-user customer focused spaceport. Like the evolution of the airplane, GSDO is working to transform KSC infrastructures that will turn once unthinkable space opportunities into a reality for today.
2009-09-01
CONOPS concept of operations CONUS continental United States COTS commercial off-the-shelf CPB charged particle beam CRT cathode ray tube CSA...Naval Space Surveillance NAVSPOC Naval Space Operations Center NAVWAR navigation warfare NCA National Command Authorities 311 ACRONYMS AND
Center Planning and Development Student Engineer
Jenkins, Kenneth T.
2013-01-01
This fall I was the Student Trainee (Engineering) Pathways Intern (co-op) at the Kennedy Space Center (KSC) in the Center Planning Development (CPD) Directorate. CPD works with commercial companies who are interested using KSCs unique capabilities in spaceflight, spacecraft processing, ground systems and Research Development (RD) projects that fall in line with NASAs mission and goals. CPD is divided into four (4) groups: (1) AD-A, which works on the Master Planning for center, (2) AD-B (where I am), which works on project management and integration, (3) AD-C, which works on partnership development, and (4) AD-T, which works on the RD aspects of partnerships. CPDs main goal is to one day make KSC the worlds largest spaceport and maintain the center as a leader in space exploration. CPD is a very diverse group with employees having a wide knowledge of not only the Space Shuttle, but also that of the Apollo era. Our director of CPD, Scott Colloredo, is on the advisory board for Commercial Space Operations (CSO) and has a degree at ERAU. I worked on a number of different tasks for AD-B, as well as CPD, that includes, but not limited to: reviewing and reissuing engineering drawings from the Apollo and Shuttle eras, to supporting NASA rocket launches (MAVEN), and working on actual agreementsproposals that will be used in the partnership process with multiple partners. Most of the work I have done is sensitive information and cannot be disclosed.
Overview of Additive Manufacturing Initiatives at NASA Marshall Space Flight Center
Clinton, R. G., Jr.
2018-01-01
NASA's In Space Manufacturing Initiative (ISM) includes: The case for ISM - why; ISM path to exploration - results from the 3D Printing In Zero-G Technology Demonstration - ISM challenges; In space Robotic Manufacturing and Assembly (IRMA); Additive construction. Additively Manufacturing (AM) development for liquid rocket engine space flight hardware. MSFC standard and specification for additively manufactured space flight hardware. Summary.
14 CFR 29.27 - Center of gravity limits.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Center of gravity limits. 29.27 Section 29... AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY ROTORCRAFT Flight General § 29.27 Center of gravity limits. The extreme forward and aft centers of gravity and, where critical, the extreme lateral centers of gravity...
Computed tomography-guided core-needle biopsy of lung lesions: an oncology center experience
Energy Technology Data Exchange (ETDEWEB)
Guimaraes, Marcos Duarte; Fonte, Alexandre Calabria da; Chojniak, Rubens, E-mail: marcosduarte@yahoo.com.b [Hospital A.C. Camargo, Sao Paulo, SP (Brazil). Dept. of Radiology and Imaging Diagnosis; Andrade, Marcony Queiroz de [Hospital Alianca, Salvador, BA (Brazil); Gross, Jefferson Luiz [Hospital A.C. Camargo, Sao Paulo, SP (Brazil). Dept. of Chest Surgery
2011-03-15
Objective: The present study is aimed at describing the experience of an oncology center with computed tomography guided core-needle biopsy of pulmonary lesions. Materials and Methods: Retrospective analysis of 97 computed tomography-guided core-needle biopsy of pulmonary lesions performed in the period between 1996 and 2004 in a Brazilian reference oncology center (Hospital do Cancer - A.C. Camargo). Information regarding material appropriateness and the specific diagnoses were collected and analyzed. Results: Among 97 lung biopsies, 94 (96.9%) supplied appropriate specimens for histological analyses, with 71 (73.2%) cases being diagnosed as malignant lesions and 23 (23.7%) diagnosed as benign lesions. Specimens were inappropriate for analysis in three cases. The frequency of specific diagnosis was 83 (85.6%) cases, with high rates for both malignant lesions with 63 (88.7%) cases and benign lesions with 20 (86.7%). As regards complications, a total of 12 cases were observed as follows: 7 (7.2%) cases of hematoma, 3 (3.1%) cases of pneumothorax and 2 (2.1%) cases of hemoptysis. Conclusion: Computed tomography-guided core needle biopsy of lung lesions demonstrated high rates of material appropriateness and diagnostic specificity, and low rates of complications in the present study. (author)
Space Product Development: Bringing the Benefits of Space Down to Earth
Allen, Rosalie W.; Tygielski, Andrew; Gabris, Edward A.
1997-01-01
The newly developed microgravity Research Program Office was created to consolidate and integrate NASA's microgravity research efforts, comprised of the microgravity Science and Applications Program and Space Product Development Program. This resulted in an integrated agency program serving the science and industrial research communities, providing leadership, management, direction and overview of all agency microgravity research activities. This paper provides an overview of NASA's microgravity Research Program, with particular emphasis on the Space Product Development Program activities, the potential economic impact and quality of life improvements resulting from this research, and future plans for commercial microgravity research in space. The goal of the Space Product Development Program is to facilitate the use of space for commercial products and services. The unique attributes of space are exploited to conduct industry driven research in the areas of crystallography, bio-systems, agriculture, electronic and non-electronic materials. Industry uses the knowledge gained from focused space research to create new products and processes, to gain economic competitive advantages, to create new jobs and improve the quality of life on earth. The objectives of the program are implemented through NASA's Commercial Space Centers, non-profit consortia of industry, academia and government, that provide the mechanism for communication and technical expert exchange between NASA and industry. Over 200 commercial research activities have been conducted by the Commercial Space Centers and their industrial affiliates over the last four and one-half years during Space Shuttle mission, as well as sounding rocket flights. The results of this research will have a significant impact on competitive products, jobs and quality of life improvements.
Institute of Scientific and Technical Information of China (English)
Yin Pumin
2011-01-01
CHINA'S first unmanned space module Tiangong-1,or Heavenly Palace-1,successfully lifted off from the Jiuquan Satellite Launch Center in northwest China's Gansu Province on September 29."The successfullaunch of the 8.5-ton prototype space laboratory has opened the gates for China's deep space exploration program," said Qi Faren,former chief designer of China's Shenzhou spacecraft."It is a decisive leap forward for the Chinese space industry and will bring about the rapid development of space science and related technologies."
Center for the Utilization of Biological Engineering in Space (CUBES)
National Aeronautics and Space Administration — As NASA shifts its focus from low-Earth orbit to deep space missions, the agency is investing in the development of technologies that will allow long-duration...
Space Operations Learning Center (SOLC) iPhone/iPad Application
Binebrink, Daniel; Kuok, Heng; Hammond, Malinda; Hull, Scott
2013-01-01
This iPhone application, Space Junk Sammy, is intended to be an educational application designed for Apple iPhones and iPads. This new concept educates kids in an innovative way about how orbital debris affects space missions. Orbital debris is becoming a very significant concern for NASA and all Earthorbiting space missions. Spacecraft in low-Earth orbit are in constant danger of being potentially damaged or destroyed by debris. High-profile spacecraft such as the International Space Station (ISS) and Hubble Space Telescope are dealing with orbital debris on a regular basis. Other basic educational concepts that are portrayed are low-Earth orbits, satellites, ISS, attitude control, and other facts that can be presented in betweenlevel popup screens. The Orbital Debris Cleanup game is relatively simple from the user s technical standpoint. It is a 2D game where the user s avatar is a satellite buddy, named Sammy, in orbit around Earth. Sammy is controlled by the user with the device s gyroscope as well as touchscreen controls. It has equipment used for taking care of the space debris objects on the screen. Sammy also has a claw, a laser deflector, and hydrazine rockets to grab or push the debris objects into a higher orbit or into a lower orbit to burn up in the Earth s atmosphere. The user interface shows Sammy and space debris objects constantly moving from left to right, where Sammy is trying to catch the debris objects before they move off the right side of the screen. Everything will be in constant motion to increase fun and add to the realism of orbiting the Earth. The satellite buddy is used to clean up the space debris and protect other satellites. Later levels will include a laser deflector and hydrazine rockets instead of a robotic claw to push the orbital debris into a higher orbit and out of the path of other satellites
Oceanic Storm Characteristics off the Kennedy Space Center Coast
Wilson, J. G.; Simpson, A. A.; Cummins, K. L.; Kiriazes, J. J.; Brown, R. G.; Mata, C. T.
2014-01-01
Natural cloud-to-ground lightning may behave differently depending on the characteristics of the attachment mediums, including the peak current (inferred from radiation fields) and the number of ground strike locations per flash. Existing literature has raised questions over the years on these characteristics of lightning over oceans, and the behaviors are not yet well understood. To investigate this we will obtain identical electric field observations over adjacent land and ocean regions during both clear air and thunderstorm periods. Oceanic observations will be obtained using a 3-meter NOAA buoy that has been instrumented with a Campbell Scientific electric field mill and New Mexico Techs slow antenna, to measure the electric fields aloft. We are currently obtaining measurements from this system on-shore at the Florida coast, to calibrate and better understand the behavior of the system in elevated-field environments. Sometime during winter 2013, this system will be moored 20NM off the coast of the Kennedy Space Center. Measurements from this system will be compared to the existing on-shore electric field mill suite of 31 sensors and a coastal slow antenna. Supporting observations will be provided by New Mexico Techs Lightning Mapping Array, the Eastern Range Cloud to Ground Lightning Surveillance System, and the National Lightning Detection Network. An existing network of high-speed cameras will be used to capture cloud-to-ground lightning strikes over the terrain regions to identify a valid data set for analysis. This on-going project will demonstrate the value of off-shore electric field measurements for safety-related decision making at KSC, and may improve our understanding of relative lightning risk to objects on the ground vs. ocean. This presentation will provide an overview of this new instrumentation, and a summary of our progress to date.
14 CFR 27.27 - Center of gravity limits.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Center of gravity limits. 27.27 Section 27... AIRWORTHINESS STANDARDS: NORMAL CATEGORY ROTORCRAFT Flight General § 27.27 Center of gravity limits. The extreme forward and aft centers of gravity and, where critical, the extreme lateral centers of gravity must be...
A Process for Comparing Dynamics of Distributed Space Systems Simulations
Cures, Edwin Z.; Jackson, Albert A.; Morris, Jeffery C.
2009-01-01
The paper describes a process that was developed for comparing the primary orbital dynamics behavior between space systems distributed simulations. This process is used to characterize and understand the fundamental fidelities and compatibilities of the modeling of orbital dynamics between spacecraft simulations. This is required for high-latency distributed simulations such as NASA s Integrated Mission Simulation and must be understood when reporting results from simulation executions. This paper presents 10 principal comparison tests along with their rationale and examples of the results. The Integrated Mission Simulation (IMSim) (formerly know as the Distributed Space Exploration Simulation (DSES)) is a NASA research and development project focusing on the technologies and processes that are related to the collaborative simulation of complex space systems involved in the exploration of our solar system. Currently, the NASA centers that are actively participating in the IMSim project are the Ames Research Center, the Jet Propulsion Laboratory (JPL), the Johnson Space Center (JSC), the Kennedy Space Center, the Langley Research Center and the Marshall Space Flight Center. In concept, each center participating in IMSim has its own set of simulation models and environment(s). These simulation tools are used to build the various simulation products that are used for scientific investigation, engineering analysis, system design, training, planning, operations and more. Working individually, these production simulations provide important data to various NASA projects.
Flying on Sun Shine: Sailing in Space
International Nuclear Information System (INIS)
Alhorn, Dean
2012-01-01
On January 20th, 2011, NanoSail-D successfully deployed its sail in space. It was the first solar sail vehicle to orbit the earth and the second sail ever unfurled in space. The 10m2 sail, deployment mechanism and electronics were packed into a 3U CubeSat with a volume of about 3500cc. The NanoSail-D mission had two objectives: eject a nanosatellite from a minisatellite; deploy its sail from a highly compacted volume to validate large structure deployment and potential de-orbit technologies. NanoSail-D was jointly developed by NASA's Marshall Space Flight Center and Ames Research Center. The ManTech/NeXolve Corporation provided key sail design support. NanoSail-D is managed by Marshall and jointly sponsored by the Army Space and Missile Defense Command, the Space Test Program, the Von Braun Center for Science and Innovation and Dynetics Inc. The presentation will provide insights into sailcraft advances and potential missions enabled by this emerging in-space propulsion technology.
Performing a Large-Scale Modal Test on the B2 Stand Crane at NASA's Stennis Space Center
Stasiunas, Eric C.; Parks, Russel A.; Sontag, Brendan D.
2018-01-01
A modal test of NASA's Space Launch System (SLS) Core Stage is scheduled to occur at the Stennis Space Center B2 test stand. A derrick crane with a 150-ft long boom, located at the top of the stand, will be used to suspend the Core Stage in order to achieve defined boundary conditions. During this suspended modal test, it is expected that dynamic coupling will occur between the crane and the Core Stage. Therefore, a separate modal test was performed on the B2 crane itself, in order to evaluate the varying dynamic characteristics and correlate math models of the crane. Performing a modal test on such a massive structure was challenging and required creative test setup and procedures, including implementing both AC and DC accelerometers, and performing both classical hammer and operational modal analysis. This paper describes the logistics required to perform this large-scale test, as well as details of the test setup, the modal test methods used, and an overview and application of the results.
Babiak-Vazquez, Adriana; Ruffaner, Lanie M.; Wear, Mary L.; Crucian, Brian; Sams, Clarence; Lee, Lesley R.; Van Baalen, Mary
2016-01-01
In 2010, NASA implemented Lifetime Surveillance of Astronaut Health, a formal occupational surveillance program for the U.S. astronaut corps. Because of the nature of the space environment, space medicine presents unique challenges and opportunities for epidemiologists. One such example is the use of telemedicine while crewmembers are in flight, where the primary source of information about crew health is verbal communication between physicians and their crewmembers. Due to restricted medical capabilities, the available health information is primarily crewmember report of signs and symptoms, rather than diagnoses. As epidemiologists at NASA, Johnson Space Center, we have shifted our paradigm from tracking diagnoses based on traditional terrestrial clinical practice to one in which we also incorporate reported symptomology as potential antecedents of disease. In this presentation we describe how characterization of reported signs and symptoms can be used to establish incidence rates for inflight immunologic events. We describe interdisciplinary data sources of information that are used in combination with medical information to analyze the data. We also delineate criteria for symptom classification inclusion. Finally, we present incidence tables and graphs to illustrate the final outcomes. Using signs and symptoms reported via telemedicine, the epidemiologists provide summary evidence regarding incidence of potential inflight medical conditions. These results inform our NASA physicians and scientists, and support evaluation of the occupational health risks associated with spaceflight.
Logistics Operations Management Center: Maintenance Support Baseline (LOMC-MSB)
Kurrus, R.; Stump, F.
1995-01-01
The Logistics Operations Management Center Maintenance Support Baseline is defined. A historical record of systems, applied to and deleted from, designs in support of future management and/or technical analysis is provided. All Flight elements, Ground Support Equipment, Facility Systems and Equipment and Test Support Equipment for which LOMC has responsibilities at Kennedy Space Center and other locations are listed. International Space Station Alpha Program documentation is supplemented. The responsibility of the Space Station Launch Site Support Office is established.
Trends in space activities in 2014: The significance of the space activities of governments
Paikowsky, Deganit; Baram, Gil; Ben-Israel, Isaac
2016-01-01
This article addresses the principal events of 2014 in the field of space activities, and extrapolates from them the primary trends that can be identified in governmental space activities. In 2014, global space activities centered on two vectors. The first was geopolitical, and the second relates to the matrix between increasing commercial space activities and traditional governmental space activities. In light of these two vectors, the article outlines and analyzes trends of space exploration, human spaceflights, industry and technology, cooperation versus self-reliance, and space security and sustainability. It also reviews the space activities of the leading space-faring nations.
Institute of Scientific and Technical Information of China (English)
YIN PUMIN
2011-01-01
China's first unmanNed space module Tiangong-Ⅰ,or Heavenly Palace-Ⅰ,successfully lifted off from the Jiuquan Satellite Launch Center in northwest China's Gansu Province on September 29."The successful launch of the 8.5-ton prototype space laboratory has opened the gates for China's deep space exploration program," said Qi Faren,former chief designer of China's Shenzhou spacecraft.“It is a decisive leap forward for the Chinese space industry and will bring about the rapid development of space science and related techologies."
Space Life Sciences Research and Education Program
Coats, Alfred C.
2001-01-01
Since 1969, the Universities Space Research Association (USRA), a private, nonprofit corporation, has worked closely with the National Aeronautics and Space Administration (NASA) to advance space science and technology and to promote education in those areas. USRA's Division of Space Life Sciences (DSLS) has been NASA's life sciences research partner for the past 18 years. For the last six years, our Cooperative Agreement NCC9-41 for the 'Space Life Sciences Research and Education Program' has stimulated and assisted life sciences research and education at NASA's Johnson Space Center (JSC) - both at the Center and in collaboration with outside academic institutions. To accomplish our objectives, the DSLS has facilitated extramural research, developed and managed educational programs, recruited and employed visiting and staff scientists, and managed scientific meetings.
First-ever evening public engine test of a Space Shuttle Main Engine
2001-01-01
Thousands of people watch the first-ever evening public engine test of a Space Shuttle Main Engine at NASA's John C. Stennis Space Center. The spectacular test marked Stennis Space Center's 20th anniversary celebration of the first Space Shuttle mission.
Infrasound and Seismic Recordings of Rocket Launches from Kennedy Space Center, 2016-2017
McNutt, S. R.; Thompson, G.; Brown, R. G.; Braunmiller, J.; Farrell, A. K.; Mehta, C.
2017-12-01
We installed a temporary 3-station seismic-infrasound network at Kennedy Space Center (KSC) in February 2016 to test sensor calibrations and train students in field deployment and data acquisitions techniques. Each station featured a single broadband 3-component seismometer and a 3-element infrasound array. In May 2016 the network was scaled back to a single station due to other projects competing for equipment. To date 8 rocket launches have been recorded by the infrasound array, as well as 2 static tests, 1 aborted launch and 1 rocket explosion (see next abstract). Of the rocket launches recorded 4 were SpaceX Falcon-9, 2 were ULA Atlas-5 and 2 were ULA Delta-IV. A question we attempt to answer is whether the rocket engine type and launch trajectory can be estimated with appropriate travel-time, amplitude-ratio and spectral techniques. For example, there is a clear Doppler shift in seismic and infrasound spectrograms from all launches, with lower frequencies occurring later in the recorded signal as the rocket accelerates away from the array. Another question of interest is whether there are relationships between jet noise frequency, thrust and/or nozzle velocity. Infrasound data may help answer these questions. We are now in the process of deploying a permanent seismic and infrasound array at the Astronaut Beach House. 10 more rocket launches are schedule before AGU. NASA is also conducting a series of 33 sonic booms over KSC beginning on Aug 21st. Launches and other events at KSC have provided rich sources of signals that are useful to characterize and gain insight into physical processes and wave generation from man-made sources.
Space-to-Ground Quantum Key Distribution Using a Small-Sized Payload on Tiangong-2 Space Lab
Liao, Sheng-Kai; Lin, Jin; Ren, Ji-Gang; Liu, Wei-Yue; Qiang, Jia; Yin, Juan; Li, Yang; Shen, Qi; Zhang, Liang; Liang, Xue-Feng; Yong, Hai-Lin; Li, Feng-Zhi; Yin, Ya-Yun; Cao, Yuan; Cai, Wen-Qi; Zhang, Wen-Zhuo; Jia, Jian-Jun; Wu, Jin-Cai; Chen, Xiao-Wen; Zhang, Shan-Cong; Jiang, Xiao-Jun; Wang, Jian-Feng; Huang, Yong-Mei; Wang, Qiang; Ma, Lu; Li, Li; Pan, Ge-Sheng; Zhang, Qiang; Chen, Yu-Ao; Lu, Chao-Yang; Liu, Nai-Le; Ma, Xiongfeng; Shu, Rong; Peng, Cheng-Zhi; Wang, Jian-Yu; Pan, Jian-Wei
2017-08-01
Not Available Supported by China Manned Space Program, Technology and Engineering Center for Space Utilization Chinese Academy of Sciences, Chinese Academy of Sciences, and the National Natural Science Foundation of China.
NASA LANGLEY RESEARCH CENTER AND THE TIDEWATER INTERAGENCY POLLUTION PREVENTION PROGRAM
National Aeronautics and Space Administration (NASA)'s Langley Research Center (LaRC) is an 807-acre research center devoted to aeronautics and space research. aRC has initiated a broad-based pollution prevention program guided by a Pollution Prevention Program Plan and implement...
Dryden, Rachel L.
2011-01-01
The National Aeronautics and Space Administration s (NASA) Kennedy Space Center (KSC) has installed a five-instrument 915-Megahertz (MHz) Doppler Radar Wind Profiler (DRWP) system that records atmospheric wind profile properties. The purpose of these profilers is to fill data gaps between the top of the KSC wind tower network and the lowest measurement altitude of the KSC 50-MHz DRWP. The 915-MHz DRWP system has the capability to generate three-dimensional wind data outputs from approximately 150 meters (m) to 6,000 m at roughly 15-minute (min) intervals. NASA s long-term objective is to combine the 915-MHz and 50-MHz DRWP systems to create complete vertical wind profiles up to 18,300 m to be used in trajectory and loads analyses of space vehicles and by forecasters on day-of-launch (DOL). This analysis utilizes automated and manual quality control (QC) processes to remove erroneous and unrealistic wind data returned by the 915-MHz DRWP system. The percentage of data affected by each individual QC check in the period of record (POR) (i.e., January to April 2006) was computed, demonstrating the variability in the amount of data affected by the QC processes. The number of complete wind profiles available at given altitude thresholds for each profiler in the POR was calculated and outputted graphically, followed by an assessment of the number of complete wind profiles available for any profiler in the POR. A case study is also provided to demonstrate the QC process on a day of a known weather event.
Khan, Samee Ullah
2015-01-01
This handbook offers a comprehensive review of the state-of-the-art research achievements in the field of data centers. Contributions from international, leading researchers and scholars offer topics in cloud computing, virtualization in data centers, energy efficient data centers, and next generation data center architecture. It also comprises current research trends in emerging areas, such as data security, data protection management, and network resource management in data centers. Specific attention is devoted to industry needs associated with the challenges faced by data centers, such as various power, cooling, floor space, and associated environmental health and safety issues, while still working to support growth without disrupting quality of service. The contributions cut across various IT data technology domains as a single source to discuss the interdependencies that need to be supported to enable a virtualized, next-generation, energy efficient, economical, and environmentally friendly data cente...
Spherical Torus Center Stack Design
International Nuclear Information System (INIS)
C. Neumeyer; P. Heitzenroeder; C. Kessel; M. Ono; M. Peng; J. Schmidt; R. Woolley; I. Zatz
2002-01-01
The low aspect ratio spherical torus (ST) configuration requires that the center stack design be optimized within a limited available space, using materials within their established allowables. This paper presents center stack design methods developed by the National Spherical Torus Experiment (NSTX) Project Team during the initial design of NSTX, and more recently for studies of a possible next-step ST (NSST) device
7 CFR 246.8 - Nondiscrimination.
2010-01-01
... CHILD NUTRITION PROGRAMS SPECIAL SUPPLEMENTAL NUTRITION PROGRAM FOR WOMEN, INFANTS AND CHILDREN... Amendments of 1972, section 504 of the Rehabilitation Act of 1973, the Age Discrimination Act of 1975... discrimination under the Program. Compliance with title VI of the Civil Rights Act of 1964, title IX of the...
2000-01-01
The Space Odyssey Gift Shop located in StenniSphere at the John C. Stennis Space Center in Hancock County, Miss., offers every visitor the opportunity to go home with 'the right stuff' from his or her StenniSphere visit. The gift shop is located just inside the front doors to StenniSphere and offers a wide range of space-related apparel, memorabilia, toys, books, mission patches and more.
14 CFR 25.27 - Center of gravity limits.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Center of gravity limits. 25.27 Section 25... AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Flight General § 25.27 Center of gravity limits. The extreme forward and the extreme aft center of gravity limitations must be established for each practicably...
Redesigning Space for Interdisciplinary Connections: The Puget Sound Science Center
DeMarais, Alyce; Narum, Jeanne L.; Wolfson, Adele J.
2013-01-01
Mindful design of learning spaces can provide an avenue for supporting student engagement in STEM subjects. Thoughtful planning and wide participation in the design process were key in shaping new and renovated spaces for the STEM community at the University of Puget Sound. The finished project incorporated Puget Sound's mission and goals as well…
Research and technology, 1991. Langley Research Center
1992-01-01
The mission of the NASA Langley Research Center is to increase the knowledge and capability of the United States in a full range of aeronautics disciplines and in selected space disciplines. This mission will be accomplished by performing innovative research relevant to national needs and Agency goals, transferring technology to users in a timely manner, and providing development support to other United States Government agencies, industry, and other NASA centers. Highlights are given of the major accomplishments and applications that have been made during the past year. The highlights illustrate both the broad range of the research and technology (R&T) activities at NASA Langley Research Center and the contributions of this work toward maintaining United States leadership in aeronautics and space research.
Degradation of superheater tubes made of austenitic T321H steel after long term service
Energy Technology Data Exchange (ETDEWEB)
Hernas, Adam [Silesian Technical Univ., Katowice (Poland). Faculty of Material Science; Augustyniak, Boleslaw; Chmielewski, Marek [Gdansk Univ. of Technology (Poland). Mechanical Dept.; Sablik, M.J. [Applied Magnetic and Physical Modeling, LLC, San Antonio, TX (United States)
2010-07-01
There are presented results of complementary tests performed for the evaluation of creep damage in austenitic steel grade T321H exploited over 200,000 hours in the secondary superheater part of a power plant boiler. The following techniques have been applied: SEM microscopy, X-ray diffraction, tensile tests, hardness measurements and novel eddy current inspection. The novel eddy current inspection is proposed as a non-destructive method of estimating the creep damage stage of austenite steel boiler tubes after long-term service in power plants. We compare the results provided by the different techniques and discuss the correlations and also point out the problems which need to be addressed in order to elaborate the remaining life assessment of austenitic boiler tubes. (orig.)
Emergency Operations Center ribbon cutting
2009-01-01
Center Director Gene Goldman and special guests celebrate the opening of the site's new Emergency Operations Center on June 2. Participants included (l t r): Steven Cooper, deputy director of the National Weather Service Southern Region; Tom Luedtke, NASA associate administrator for institutions and management; Charles Scales, NASA associate deputy administrator; Mississippi Gov. Haley Barbour; Gene Goldman, director of Stennis Space Center; Jack Forsythe, NASA assistant administrator for the Office of Security and Program Protection; Dr. Richard Williams, NASA chief health and medical officer; and Weldon Starks, president of Starks Contracting Company Inc. of Biloxi.
NASA Space Environments Technical Discipline Team Space Weather Activities
Minow, J. I.; Nicholas, A. C.; Parker, L. N.; Xapsos, M.; Walker, P. W.; Stauffer, C.
2017-12-01
The Space Environment Technical Discipline Team (TDT) is a technical organization led by NASA's Technical Fellow for Space Environments that supports NASA's Office of the Chief Engineer through the NASA Engineering and Safety Center. The Space Environments TDT conducts independent technical assessments related to the space environment and space weather impacts on spacecraft for NASA programs and provides technical expertise to NASA management and programs where required. This presentation will highlight the status of applied space weather activities within the Space Environment TDT that support development of operational space weather applications and a better understanding of the impacts of space weather on space systems. We will first discuss a tool that has been developed for evaluating space weather launch constraints that are used to protect launch vehicles from hazardous space weather. We then describe an effort to better characterize three-dimensional radiation transport for CubeSat spacecraft and processing of micro-dosimeter data from the International Space Station which the team plans to make available to the space science community. Finally, we will conclude with a quick description of an effort to maintain access to the real-time solar wind data provided by the Advanced Composition Explorer satellite at the Sun-Earth L1 point.
Space Station Habitability Research
Clearwater, Yvonne A.
1988-01-01
The purpose and scope of the Habitability Research Group within the Space Human Factors Office at the NASA/Ames Research Center is described. Both near-term and long-term research objectives in the space human factors program pertaining to the U.S. manned Space Station are introduced. The concept of habitability and its relevancy to the U.S. space program is defined within a historical context. The relationship of habitability research to the optimization of environmental and operational determinants of productivity is discussed. Ongoing habitability research efforts pertaining to living and working on the Space Station are described.
International Space Station exhibit
2000-01-01
The International Space Station (ISS) exhibit in StenniSphere at John C. Stennis Space Center in Hancock County, Miss., gives visitors an up-close look at the largest international peacetime project in history. Step inside a module of the ISS and glimpse how astronauts will live and work in space. Currently, 16 countries contribute resources and hardware to the ISS. When complete, the orbiting research facility will be larger than a football field.
Socio-Economic Impacts of Space Weather and User Needs for Space Weather Information
Worman, S. L.; Taylor, S. M.; Onsager, T. G.; Adkins, J. E.; Baker, D. N.; Forbes, K. F.
2017-12-01
The 2015 National Space Weather Strategy and Space Weather Action Plan (SWAP) details the activities, outcomes, and timelines to build a "Space Weather Ready Nation." NOAA's Space Weather Prediction Center and Abt Associates are working together on two SWAP initiatives: (1) identifying, describing, and quantifying the socio-economic impacts of moderate and severe space weather; and (2) outreach to engineers and operators to better understand user requirements for space weather products and services. Both studies cover four technological sectors (electric power, commercial aviation, satellites, and GNSS users) and rely heavily on industry input. Findings from both studies are essential for decreasing vulnerabilities and enhancing preparedness.
Thomas, Rainer; Rericha, Adolf; Pohl, Walter L.; Davidson, Paul
2018-03-01
SE Kenya is the world's largest producer of green vanadium grossular gemstones (tsavorite). Samples from one of the mines near Mwatate, and of occurrences in Tanzania yielded remarkable new insights into the genesis of tsavorite. Graphite is intimately associated with V-grossular and is one of the keys to understanding its origin. In the course of this study we found five different types of graphite. Surprisingly, in one graphite type the "Raman-forbidden" and IR-active 867 cm- 1 band was observed. In this communication, we attempt to find an explanation for this unusual phenomenon. Additionally, our observations also address some of the issues pertaining to the origin of the green grossular-dominated rocks (grossularites), as well as the gem quality tsavorite crystals, since we propose that the anomalous spectroscopic behavior of the graphite is related to the unusual conditions during crystallization of both the grossular and graphite from a near-supercritical volatile- and sulfur-rich silicate melt. The massive green vanadium grossular contains abundant unequivocal crystallized melt inclusions, while the transparent gem quality grossular (tsavorite) displays only fluid inclusions. On the basis of inclusion studies we suggest that anatectic melts originated in the peculiar evaporitic host lithology of the tsavorite deposits. Near peak metamorphic temperatures ( 700 °C) these liquids occurred as a supercritical volatile-rich "fluid/melt phase" characterized by complete miscibility between H2O and silicate liquid. Relatively dry liquid batches precipitated non-transparent green grossular, whereas wet batches segregated fluids that formed transparent tsavorite.
Data Management Coordinators Monitor STS-78 Mission at the Huntsville Operations Support Center
1996-01-01
Launched on June 20, 1996, the STS-78 mission's primary payload was the Life and Microgravity Spacelab (LMS), which was managed by the Marshall Space Flight Center (MSFC). During the 17 day space flight, the crew conducted a diverse slate of experiments divided into a mix of life science and microgravity investigations. In a manner very similar to future International Space Station operations, LMS researchers from the United States and their European counterparts shared resources such as crew time and equipment. Five space agencies (NASA/USA, European Space Agency/Europe (ESA), French Space Agency/France, Canadian Space Agency /Canada, and Italian Space Agency/Italy) along with research scientists from 10 countries worked together on the design, development and construction of the LMS. This photo represents Data Management Coordinators monitoring the progress of the mission at the Huntsville Operations Support Center (HOSC) Spacelab Payload Operations Control Center (SL POCC) at MSFC. Pictured are assistant mission scientist Dr. Dalle Kornfeld, Rick McConnel, and Ann Bathew.
Center of Excellence in Space Data and Information Sciences
Yesha, Yelena
1999-01-01
This report summarizes the range of computer science-related activities undertaken by CESDIS for NASA in the twelve months from July 1, 1998 through June 30, 1999. These activities address issues related to accessing, processing, and analyzing data from space observing systems through collaborative efforts with university, industry, and NASA space and Earth scientists. The sections of this report which follow, detail the activities undertaken by the members of each of the CESDIS branches. This includes contributions from university faculty members and graduate students as well as CESDIS employees. Phone numbers and e-mail addresses appear in Appendix F (CESDIS Personnel and Associates) to facilitate interactions and new collaborations.
Bauman, William H., III
2010-01-01
The 12-km resolution North American Mesoscale (NAM) model (MesoNAM) is used by the 45th Weather Squadron (45 WS) Launch Weather Officers at Kennedy Space Center (KSC) and Cape Canaveral Air Force Station (CCAFS) to support space launch weather operations. The 45 WS tasked the Applied Meteorology Unit to conduct an objective statistics-based analysis of MesoNAM output compared to wind tower mesonet observations and then develop a an operational tool to display the results. The National Centers for Environmental Prediction began running the current version of the MesoNAM in mid-August 2006. The period of record for the dataset was 1 September 2006 - 31 January 2010. The AMU evaluated MesoNAM hourly forecasts from 0 to 84 hours based on model initialization times of 00, 06, 12 and 18 UTC. The MesoNAM forecast winds, temperature and dew point were compared to the observed values of these parameters from the sensors in the KSC/CCAFS wind tower network. The data sets were stratified by model initialization time, month and onshore/offshore flow for each wind tower. Statistics computed included bias (mean difference), standard deviation of the bias, root mean square error (RMSE) and a hypothesis test for bias = O. Twelve wind towers located in close proximity to key launch complexes were used for the statistical analysis with the sensors on the towers positioned at varying heights to include 6 ft, 30 ft, 54 ft, 60 ft, 90 ft, 162 ft, 204 ft and 230 ft depending on the launch vehicle and associated weather launch commit criteria being evaluated. These twelve wind towers support activities for the Space Shuttle (launch and landing), Delta IV, Atlas V and Falcon 9 launch vehicles. For all twelve towers, the results indicate a diurnal signal in the bias of temperature (T) and weaker but discernable diurnal signal in the bias of dewpoint temperature (T(sub d)) in the MesoNAM forecasts. Also, the standard deviation of the bias and RMSE of T, T(sub d), wind speed and wind
Center Planning and Development: Multi-User Spaceport Initiatives
Kennedy, Christopher John
2015-01-01
The Vehicle Assembly building at NASAs Kennedy Space Center has been used since 1966 to vertically assemble every launch vehicle, since the Apollo Program, launched from Launch Complex 39 (LC-39). After the cancellation of the Constellation Program in 2010 and the retirement of the Space Shuttle Program in 2011, the VAB faced an uncertain future. As the Space Launch System (SLS) gained a foothold as the future of American spaceflight to deep space, NASA was only using a portion of the VABs initial potential. With three high bays connected to the Crawler Way transportation system, the potential exists for up to three rockets to be simultaneously processed for launch. The Kennedy Space Center (KSC) Master plan, supported by the Center Planning and Development (CPD) Directorate, is guiding Kennedy toward a 21st century multi-user spaceport. This concept will maintain Kennedy as the United States premier gateway to space and provide multi-user operations through partnerships with the commercial aerospace industry. Commercial aerospace companies, now tasked with transporting cargo and, in the future, astronauts to the International Space Station (ISS) via the Commercial Resupply Service (CRS) and Commercial Crew Program (CCP), are a rapidly growing industry with increasing capabilities to make launch operations more economical for both private companies and the government. Commercial operations to Low Earth Orbit allow the government to focus on travel to farther destinations through the SLS Program. With LC-39B designated as a multi-use launch pad, companies seeking to use it will require an integration facility to assemble, integrate, and test their launch vehicle. An Announcement for Proposals (AFP) was released in June, beginning the process of finding a non-NASA user for High Bay 2 (HB2) and the Mobile Launcher Platforms (MLPs). An Industry Day, a business meeting and tour for interested companies and organizations, was also arranged to identify and answer any
Space Elevators: Building a Permanent Bridge for Space Exploration and Economic Development
Smitherman, David V., Jr.; Howell, Joe T. (Technical Monitor)
2000-01-01
A space elevator is a physical connection from the surface of the Earth to a geo-stationary orbit above the Earth approximately 35,786 km in altitude. Its center of mass is at the geo-stationary point such that it has a 24-hour orbit, and stays over the same point above the equator as the Earth rotates on its axis. The structure is utilized as a transportation and utility system for moving payloads, power, and gases between the surface of the Earth and space. It makes the physical connection from Earth to space in the same way a bridge connects two cities across a body of' water. The space elevator may be an important concept for the future development of space in the latter part of the 21th century. It has the potential to provide mass-transportation to space in the same way highways, railroads, power lines, and pipelines provide mass-transportation across the Earth's surface. The low energy requirements for moving payloads up and down the elevator make it one of only a few concepts that has the potential of lowering the cost to orbit to less than $10 per kilogram. This paper will summarize the findings from a 1999 NASA workshop on Space Elevators held at the NASA Marshall Space Flight Center (MSFC). The workshop was sponsored by the Advanced Projects Office in the Flight Projects Directorate at MSFC, and was organized in cooperation with the Advanced Space Transportation Program at MSFC and the Advanced Concepts Office in the Office of Space Flight at NASA Headquarters. New concepts will be examined for space elevator construction and a number of issues will be discussed that has helped to bring the space elevator concept out of the realm of science fiction and into the realm of possibility. In conclusion, it appears that the space elevator concept may well he possible in the latter part of the 21st century if proper planning and technology development is emphasized to resolve key issues in the development of this advanced space infrastructure concept.
Research & Technology Report Goddard Space Flight Center
Soffen, Gerald A. (Editor); Truszkowski, Walter (Editor); Ottenstein, Howard (Editor); Frost, Kenneth (Editor); Maran, Stephen (Editor); Walter, Lou (Editor); Brown, Mitch (Editor)
1995-01-01
The main theme of this edition of the annual Research and Technology Report is Mission Operations and Data Systems. Shifting from centralized to distributed mission operations, and from human interactive operations to highly automated operations is reported. The following aspects are addressed: Mission planning and operations; TDRSS, Positioning Systems, and orbit determination; hardware and software associated with Ground System and Networks; data processing and analysis; and World Wide Web. Flight projects are described along with the achievements in space sciences and earth sciences. Spacecraft subsystems, cryogenic developments, and new tools and capabilities are also discussed.
Directory of Open Access Journals (Sweden)
Farkhondeh Jamshidi
2017-07-01
Full Text Available Aim: In the last decade, the prevalence of injecting drugs has been increasing rapidly. Injecting drug use puts one at the risk of risky behaviors that affect the health of individual and society. The present study aims at evaluating and comparing risky behaviors of injecting and non-injecting drug users. Methods: In this cross-sectional descriptive study, 4400 addicts referred to public, private and drop-in-centers (DICs in 2014 were enrolled. The addicts were divided into injecting and non-injecting drug users. A researcher-made questionnaire was used to collect demographic data and the pattern of drug use and risky behavior. Data were analyzed by SPSSV21, chi-square test and ANOVA. A significance level of less than 0.05 was considered. Results: Among the addicts, 4% were injecting drug users (IDUs and 96% non-injecting drug addicts (non-IDUs. The age of the first injection was 24.68 ± 6.45 years old. The age of onset of drug use in IDUs was significantly lower than in non-IDUs (P<0.001. Risky behaviors including the use of shared needles, risky sexual relations, a history of sexually transmitted infections and a history of imprisonment and suicide were significantly higher in IDUs. Addiction relapse and slip during treatment were higher in IDUs (P<0.001. Conclusion: Injecting drug addiction significantly increases the risk of relapse and risky behaviors. Priority should be given to risky behavior prevention programs.
Space Shuttle Main Engine Public Test Firing
2000-01-01
A new NASA Space Shuttle Main Engine (SSME) roars to the approval of more than 2,000 people who came to John C. Stennis Space Center in Hancock County, Miss., on July 25 for a flight-certification test of the SSME Block II configuration. The engine, a new and significantly upgraded shuttle engine, was delivered to NASA's Kennedy Space Center in Florida for use on future shuttle missions. Spectators were able to experience the 'shake, rattle and roar' of the engine, which ran for 520 seconds - the length of time it takes a shuttle to reach orbit.
Research and Technology 1996: Innovation in Time and Space
1996-01-01
As the NASA Center responsible for assembly, checkout, servicing, launch, recovery, and operational support of Space Transportation System elements and payloads, the John F. Kennedy Space Center is placing increasing emphasis on its advanced technology development program. This program encompasses the efforts of the Engineering Development Directorate laboratories, most of the KSC operations contractors, academia, and selected commercial industries - all working in a team effort within their own areas of expertise. This edition of the Kennedy Space Center Research and Technology 1996 Annual Report covers efforts of all these contributors to the KSC advanced technology development program, as well as our technology transfer activities.
(Congressional Interest) Network Information and Space Security Center
2011-09-30
Zagreb , Croatia (City of Zagreb funding). Conducted three days of meetings with City/University of Zagreb , Croatia officials to structure terms for a...partnership with UCCS. In the short-term, UCCS will develop and deliver several courses in homeland security and assist the University of Zagreb in... Zagreb in maturing the Center of Excellence and designing, developing and delivering masters and doctoral degrees in homeland security. Hosted a group of
VanNorsdall, Erin Leigh
2015-08-01
This poster will clearly illustrate my understanding of how the fabric of space behaves. The poster will be on a large trampoline with a heavy bowling ball in the center. The observer will be able to clearly understand the much more complicated property of how an object in space, such as a star, literally bends the fabric of the space around as a result of its density. This will also help to explain, in very simple terms, how space-time is bendable, and therefore, travel in space can be as well.
Inspiring the Next Generation in Space Life Sciences
Hayes, Judith
2010-01-01
Competitive summer internships in space life sciences at NASA are awarded to college students every summer. Each student is aligned with a NASA mentor and project that match his or her skills and interests, working on individual projects in ongoing research activities. The interns consist of undergraduate, graduate, and medical students in various majors and disciplines from across the United States. To augment their internship experience, students participate in the Space Life Sciences Summer Institute (SLSSI). The purpose of the Institute is to offer a unique learning environment that focuses on the current biomedical issues associated with human spaceflight; providing an introduction of the paradigms, problems, and technologies of modern spaceflight cast within the framework of life sciences. The Institute faculty includes NASA scientists, physicians, flight controllers, engineers, managers, and astronauts; and fosters a multi-disciplinary science approach to learning with a particular emphasis on stimulating experimental creativity and innovation within an operational environment. This program brings together scientists and students to discuss cutting-edge solutions to problems in space physiology, environmental health, and medicine; and provides a familiarization of the various aspects of space physiology and environments. In addition to the lecture series, behind-the-scenes tours are offered that include the Neutral Buoyancy Laboratory, Mission Control Center, space vehicle training mockups, and a hands-on demonstration of the Space Shuttle Advanced Crew Escape Suit. While the SLSSI is managed and operated at the Johnson Space Center in Texas, student interns from the other NASA centers (Glenn and Ames Research Centers, in Ohio and California) also participate through webcast distance learning capabilities.
Using the World Wide Web for GIDEP Problem Data Processing at Marshall Space Flight Center
McPherson, John W.; Haraway, Sandra W.; Whirley, J. Don
1999-01-01
Since April 1997, Marshall Space Flight Center has been using electronic transfer and the web to support our processing of the Government-Industry Data Exchange Program (GIDEP) and NASA ALERT information. Specific aspects include: (1) Extraction of ASCII text information from GIDEP for loading into Word documents for e-mail to ALERT actionees; (2) Downloading of GIDEP form image formats in Adobe Acrobat (.pdf) for internal storage display on the MSFC ALERT web page; (3) Linkage of stored GRDEP problem forms with summary information for access from the MSFC ALERT Distribution Summary Chart or from an html table of released MSFC ALERTs (4) Archival of historic ALERTs for reference by GIDEP ID, MSFC ID, or MSFC release date; (5) On-line tracking of ALERT response status using a Microsoft Access database and the web (6) On-line response to ALERTs from MSFC actionees through interactive web forms. The technique, benefits, effort, coordination, and lessons learned for each aspect are covered herein.
DEFF Research Database (Denmark)
Fode, Mette Marie; Høyer, Morten
2015-01-01
BACKGROUND AND PURPOSE: To establish a model to predict survival after SBRT for oligo-metastases in patients considered ineligible for surgical resection (SR) and radiofrequency ablation (RFA). MATERIAL AND METHODS: Overall survival (OS) rates were estimated in 321 patients treated for 587...... metastases with SBRT over 13years. Patients were treated for a variety of metastasis types with colorectal cancer (CRC) being the most frequent (n=201). RESULTS: With a median follow-up time of 5.0years, the median OS was 2.4years (95% CI 2.3-2.7) and the survival rates were 80%, 39%, 23% and 12% at 1, 3, 5...... and 7.5years after SBRT, respectively. WHO performance status (PS) (0-1) (HR 0.49; pSBRT chemotherapy (HR 0.59; p
Calaway, Michael J.; Allen, Carlton C.; Allton, Judith H.
2014-01-01
Future robotic and human spaceflight missions to the Moon, Mars, asteroids, and comets will require curating astromaterial samples with minimal inorganic and organic contamination to preserve the scientific integrity of each sample. 21st century sample return missions will focus on strict protocols for reducing organic contamination that have not been seen since the Apollo manned lunar landing program. To properly curate these materials, the Astromaterials Acquisition and Curation Office under the Astromaterial Research and Exploration Science Directorate at NASA Johnson Space Center houses and protects all extraterrestrial materials brought back to Earth that are controlled by the United States government. During fiscal year 2012, we conducted a year-long project to compile historical documentation and laboratory tests involving organic investigations at these facilities. In addition, we developed a plan to determine the current state of organic cleanliness in curation laboratories housing astromaterials. This was accomplished by focusing on current procedures and protocols for cleaning, sample handling, and storage. While the intention of this report is to give a comprehensive overview of the current state of organic cleanliness in JSC curation laboratories, it also provides a baseline for determining whether our cleaning procedures and sample handling protocols need to be adapted and/or augmented to meet the new requirements for future human spaceflight and robotic sample return missions.
Some Problems of Rocket-Space Vehicles' Characteristics co- ordination
Sergienko, Alexander A.
2002-01-01
of the XX century suffered a reverse. The designers of the United States' firms and enterprises of aviation and rocket-space industry (Boeing, Rocketdyne, Lockheed Martin, McDonnell Douglas, Rockwell, etc.) and NASA (Marshall Space Flight Center, Johnson Space Center, Langley Research Center and Lewis Research Center and others) could not correctly co-ordinate the characteristics of a propulsion system and a space vehicle for elaboration of the "Single-Stage-To-Orbit" reusable vehicle (SSTO) as an integral whole system, which is would able to inject a payload into an orbit and to return back on the Earth. jet nozzle design as well as the choice of propulsion system characteristics, ensuring the high ballistic efficiency, are considered in the present report. The efficiency criterions for the engine and launch system parameters optimization are discussed. The new methods of the nozzle block optimal parameters' choice for the satisfaction of the object task of flight are suggested. The family of SSTO with a payload mass from 5 to 20 ton and initial weight under 800 ton is considered.
Targeting Absolute Salinity for Earth and Space
National Aeronautics and Space Administration — As part of a grant through a NASA Johnson Space Center (JSC) 2011 Innovation Charge Account (ICA), a novel optical sensor was developed and early feasibility...
75 FR 17437 - NASA Advisory Council; Commercial Space Committee; Meeting
2010-04-06
... NATIONAL AERONAUTICS AND SPACE ADMINISTRATION [Notice: (10-039)] NASA Advisory Council; Commercial... Committee of the NASA Advisory Council. DATES: Monday, April 26, 2010, 1:30 p.m.-6 p.m. CDT. ADDRESSES: NASA Johnson Space Center, Gilruth Conference Center, 2101 NASA Parkway, Houston, TX 77058. FOR FURTHER...
77 FR 52067 - NASA Advisory Council; Commercial Space Committee; Meeting
2012-08-28
... NATIONAL AERONAUTICS AND SPACE ADMINISTRATION [12-069] NASA Advisory Council; Commercial Space.... DATES: Tuesday, September 18, 2012, 11:45 a.m.-5:30 p.m.; Local Time. ADDRESSES: NASA Ames Research Center (ARC), The Showroom, Building M-3, NASA Ames Conference Center, 500 Severyns Road, NASA Research...
WFIRST: User and mission support at ISOC - IPAC Science Operations Center
Akeson, Rachel; Armus, Lee; Bennett, Lee; Colbert, James; Helou, George; Kirkpatrick, J. Davy; Laine, Seppo; Meshkat, Tiffany; Paladini, Roberta; Ramirez, Solange; Wang, Yun; Xie, Joan; Yan, Lin
2018-01-01
The science center for WFIRST is distributed between the Goddard Space Flight Center, the Infrared Processing and Analysis Center (IPAC) and the Space Telescope Science Institute (STScI). The main functions of the IPAC Science Operations Center (ISOC) are:* Conduct the GO, archival and theory proposal submission and evaluation process* Support the coronagraph instrument, including observation planning, calibration and data processing pipeline, generation of data products, and user support* Microlensing survey data processing pipeline, generation of data products, and user support* Community engagement including conferences, workshops and general support of the WFIRST exoplanet communityWe will describe the components planned to support these functions and the community of WFIRST users.
Directory of Open Access Journals (Sweden)
Mario Losasso
2014-05-01
Full Text Available “Historic Centre of Naples, World Heritage Site Enhancement” project has as its goal the rehabilitation of the oldest part of the historic center of Naples, one of the largest and most representative of Europe. The research reference field is placed on the level of strategic approach to the project and process management downstream of EU funding in large cities, with particular multidisciplinary relevance and urban issues of a complex nature. The scientific products of study, training and research were collected in Guidelines for the rehabilitation of public spaces and for sustainable performance of interventions on roads, walkways, squares and urban facilities.
Unsettled Conflicts in the Post-Soviet Space in the Analysis of the Western Research Centers
Directory of Open Access Journals (Sweden)
Konstantine Petrovich Kurylev
2016-12-01
Full Text Available The article considers the ideas of some leading western expert analytical centers about the problems of the conflicts development on the CIS space. The subject of research is the positions of the “think tanks” of the USA, Great Britain, Germany and France. Among a large number of the regional conflicts in the CIS the authors focused attention on the conflicts in the East of Ukraine, in Transnistria and in the Nagorno-Karabakh. Such selection is explained by the acute character and impact of these conflicts on the interests of Russia and the other leading states and the international organizations. The theoretical and methodological background of the article consists of the approaches and methods, which are used by the modern political science for the comprehensive analysis of the architecture and structure of the international relations, the mechanism of formation and functioning of the certain states’ foreign policy. The research has the cross-disciplinary character and is made at the intersection of such disciplines as history, political science, conflictology and the international relations. The authors reveal positions of the western “think tanks” on the genesis, evolution and the potential settlement of the armed conflicts in the CIS region. The article highlights the estimates of the western “think tanks” of the reasons of the “frozen” conflicts on the post-USSR space, of the Russian Federation’s role and the participation of external actors (the EU and the USA in their settlement. Giving the research of the approaches of the western expert analytical centers, the authors reach a conclusion about a set course of the western political scientists’ estimates. It reflects in assignment of a unilateral responsibility for a conflict inhaling or its unleashing on Russia, or on the party of a conflict, closed to the official Moscow. It is particularly obvious in the Ukrainian crisis: the Western countries consider our state
Perry, Charleen M.; Vansteenberg, Michael E.
1992-01-01
The National Space Science Data Center (NSSDC) has developed an automated data retrieval request service utilizing our Data Archive and Distribution Service (NDADS) computer system. NDADS currently has selected project data written to optical disk platters with the disks residing in a robotic 'jukebox' near-line environment. This allows for rapid and automated access to the data with no staff intervention required. There are also automated help information and user services available that can be accessed. The request system permits an average-size data request to be completed within minutes of the request being sent to NSSDC. A mail message, in the format described in this document, retrieves the data and can send it to a remote site. Also listed in this document are the data currently available.
Pearson, J. B.; Sims, Herb; Martin, James; Chakrabarti, Suman; Lewis, Raymond; Fant, Wallace
2003-01-01
The significant energy density of matter-antimatter annihilation is attractive to the designers of future space propulsion systems, with the potential to offer a highly compact source of power. Many propulsion concepts exist that could take advantage of matter-antimatter reactions, and current antiproton production rates are sufficient to support basic proof-of-principle evaluation of technology associated with antimatter- derived propulsion. One enabling technology for such experiments is portable storage of low energy antiprotons, allowing antiprotons to be trapped, stored, and transported for use at an experimental facility. To address this need, the Marshall Space Flight Center's Propulsion Research Center is developing a storage system referred to as the High Performance Antiproton Trap (HiPAT) with a design goal of containing 10(exp 12) particles for up to 18 days. The HiPAT makes use of an electromagnetic system (Penning- Malmberg design) consisting of a 4 Telsa superconductor, high voltage electrode structure, radio frequency (RF) network, and ultra high vacuum system. To evaluate the system normal matter sources (both electron guns and ion sources) are used to generate charged particles. The electron beams ionize gas within the trapping region producing ions in situ, whereas the ion sources produce the particles external to the trapping region and required dynamic capture. A wide range of experiments has been performed examining factors such as ion storage lifetimes, effect of RF energy on storage lifetime, and ability to routinely perform dynamic ion capture. Current efforts have been focused on improving the FW rotating wall system to permit longer storage times and non-destructive diagnostics of stored ions. Typical particle detection is performed by extracting trapped ions from HiPAT and destructively colliding them with a micro-channel plate detector (providing number and energy information). This improved RF system has been used to detect various
Cloud Computing Applications in Support of Earth Science Activities at Marshall Space Flight Center
Molthan, Andrew L.; Limaye, Ashutosh S.; Srikishen, Jayanthi
2011-01-01
Currently, the NASA Nebula Cloud Computing Platform is available to Agency personnel in a pre-release status as the system undergoes a formal operational readiness review. Over the past year, two projects within the Earth Science Office at NASA Marshall Space Flight Center have been investigating the performance and value of Nebula s "Infrastructure as a Service", or "IaaS" concept and applying cloud computing concepts to advance their respective mission goals. The Short-term Prediction Research and Transition (SPoRT) Center focuses on the transition of unique NASA satellite observations and weather forecasting capabilities for use within the operational forecasting community through partnerships with NOAA s National Weather Service (NWS). SPoRT has evaluated the performance of the Weather Research and Forecasting (WRF) model on virtual machines deployed within Nebula and used Nebula instances to simulate local forecasts in support of regional forecast studies of interest to select NWS forecast offices. In addition to weather forecasting applications, rapidly deployable Nebula virtual machines have supported the processing of high resolution NASA satellite imagery to support disaster assessment following the historic severe weather and tornado outbreak of April 27, 2011. Other modeling and satellite analysis activities are underway in support of NASA s SERVIR program, which integrates satellite observations, ground-based data and forecast models to monitor environmental change and improve disaster response in Central America, the Caribbean, Africa, and the Himalayas. Leveraging SPoRT s experience, SERVIR is working to establish a real-time weather forecasting model for Central America. Other modeling efforts include hydrologic forecasts for Kenya, driven by NASA satellite observations and reanalysis data sets provided by the broader meteorological community. Forecast modeling efforts are supplemented by short-term forecasts of convective initiation, determined by
Italy INAF Analysis Center Report
Negusini, M.; Sarti, P.
2013-01-01
This report summarizes the activity of the Italian INAF VLBI Analysis Center. Our Analysis Center is located in Bologna, Italy and belongs to the Institute of Radioastronomy, which is part of the National Institute of Astrophysics. IRA runs the observatories of Medicina and Noto, where two 32-m VLBI AZ-EL telescopes are situated. This report contains the AC's VLBI data analysis activities and shortly outlines the investigations into the co-locations of space geodetic instruments.
The Space of Aerospace Power: Why and How
2000-05-01
SSTO - MSP/SOV/SMV - TAV - Micro-SATs - Cryogenic Fuels - HYFLEX Control Missile Detection and Space Defense - MIDAS - Satellite Inspector...Missile System Center SMV Space Maneuvering Vehicle SOA State of the Art SOV Space Operations Vehicle SRD System Requirements Document SSTO
Bishop, Peter C.; Erickson, Lloyd
1990-01-01
The Management Information and Decision Support Environment (MIDSE) is a research activity to build and test a prototype of a generic human interface on the Johnson Space Center (JSC) Information Network (CIN). The existing interfaces were developed specifically to support operations rather than the type of data which management could use. The diversity of the many interfaces and their relative difficulty discouraged occasional users from attempting to use them for their purposes. The MIDSE activity approached this problem by designing and building an interface to one JSC data base - the personnel statistics tables of the NASA Personnel and Payroll System (NPPS). The interface was designed against the following requirements: generic (use with any relational NOMAD data base); easy to learn (intuitive operations for new users); easy to use (efficient operations for experienced users); self-documenting (help facility which informs users about the data base structure as well as the operation of the interface); and low maintenance (easy configuration to new applications). A prototype interface entitled the JSC Management Information Systems (JSCMIS) was produced. It resides on CIN/PROFS and is available to JSC management who request it. The interface has passed management review and is ready for early use. Three kinds of data are now available: personnel statistics, personnel register, and plan/actual cost.
Eichenberg, Dennis J.
2009-01-01
The NASA Glenn Research Center (GRC) has developed, installed, and tested a 12 kW DC grid-tied photovoltaic (PV) power system at the GRC Visitor s Center. This system utilizes a unique ballast type roof mount for installing the photovoltaic panels on the roof of the Visitor s Center with no alterations or penetrations to the roof. The PV system has generated in excess of 15000 kWh since operation commenced in August 2008. The PV system is providing power to the GRC grid for use by all. Operation of the GRC Visitor s Center PV system has been completely trouble free. A grid-tied PV power system is connected directly to the utility distribution grid. Facility power can be obtained from the utility system as normal. The PV system is synchronized with the utility system to provide power for the facility, and excess power is provided to the utility. The project transfers space technology to terrestrial use via nontraditional partners. GRC personnel glean valuable experience with PV power systems that are directly applicable to various space power systems, and provides valuable space program test data. PV power systems help to reduce harmful emissions and reduce the Nation s dependence on fossil fuels. Power generated by the PV system reduces the GRC utility demand, and the surplus power aids the community. Present global energy concerns reinforce the need for the development of alternative energy systems. Modern PV panels are readily available, reliable, efficient, and economical with a life expectancy of at least 25 years. Modern electronics has been the enabling technology behind grid-tied power systems, making them safe, reliable, efficient, and economical with a life expectancy of at least 25 years. Based upon the success of the GRC Visitor s Center PV system, additional PV power system expansion at GRC is under consideration. The GRC Visitor s Center grid-tied PV power system was successfully designed and developed which served to validate the basic principles
GSFC contamination monitors for Space Station
Carosso, P. A.; Tveekrem, J. L.; Coopersmith, J. D.
1988-01-01
This paper describes the Work Package 3 activities in the area of neutral contamination monitoring for the Space Station. Goddard Space Flight Center's responsibilities include the development of the Attached Payload Accommodations Equipment (APAE), the Polar Orbiting Platform (POP), and the Flight Telerobotic Servicer (FTS). GSFC will also develop the Customer Servicing Facility (CSF) in Phase 2 of the Space Station.
Denny, Harry
2010-01-01
Composition classrooms and writing centers are spaces where negotiation of academic, social, cultural, and political identities are ubiquitous, yet research has not produced adequate theory and practice to help tutors and writers navigate identity production and its politics. This article seeks to begin conversations that might lead to better…
Formation of microstructural features in hot-dip aluminized AISI 321 stainless steel
Huilgol, Prashant; Rajendra Udupa, K.; Udaya Bhat, K.
2018-02-01
Hot-dip aluminizing (HDA) is a proven surface coating technique for improving the oxidation and corrosion resistance of ferrous substrates. Although extensive studies on the HDA of plain carbon steels have been reported, studies on the HDA of stainless steels are limited. Because of the technological importance of stainless steels in high-temperature applications, studies of their microstructural development during HDA are needed. In the present investigation, the HDA of AISI 321 stainless steel was carried out in a pure Al bath. The microstructural features of the coating were studied using scanning electron microscopy and transmission electron microscopy. These studies revealed that the coating consists of two regions: an Al top coat and an aluminide layer at the interface between the steel and Al. The Al top coat was found to consist of intermetallic phases such as Al7Cr and Al3Fe dispersed in an Al matrix. Twinning was observed in both the Al7Cr and the Al3Fe phases. Furthermore, the aluminide layer comprised a mixture of nanocrystalline Fe2Al5, Al7Cr, and Al. Details of the microstructural features are presented, and their formation mechanisms are discussed.
Refurbishment and Automation of the Thermal/Vacuum Facilities at the Goddard Space Flight Center
Donohue, John T.; Johnson, Chris; Ogden, Rick; Sushon, Janet
1998-01-01
The thermal/vacuum facilities located at the Goddard Space Flight Center (GSFC) have supported both manned and unmanned space flight since the 1960s. Of the 11 facilities, currently 10 of the systems are scheduled for refurbishment and/or replacement as part of a 5-year implementation. Expected return on investment includes the reduction in test schedules, improvements in the safety of facility operations, reduction in the complexity of a test and the reduction in personnel support required for a test. Additionally, GSFC will become a global resource renowned for expertise in thermal engineering, mechanical engineering and for the automation of thermal/vacuum facilities and thermal/vacuum tests. Automation of the thermal/vacuum facilities includes the utilization of Programmable Logic Controllers (PLCs) and the use of Supervisory Control and Data Acquisition (SCADA) systems. These components allow the computer control and automation of mechanical components such as valves and pumps. In some cases, the chamber and chamber shroud require complete replacement while others require only mechanical component retrofit or replacement. The project of refurbishment and automation began in 1996 and has resulted in the computer control of one Facility (Facility #225) and the integration of electronically controlled devices and PLCs within several other facilities. Facility 225 has been successfully controlled by PLC and SCADA for over one year. Insignificant anomalies have occurred and were resolved with minimal impact to testing and operations. The amount of work remaining to be performed will occur over the next four to five years. Fiscal year 1998 includes the complete refurbishment of one facility, computer control of the thermal systems in two facilities, implementation of SCADA and PLC systems to support multiple facilities and the implementation of a Database server to allow efficient test management and data analysis.
Stennis Holds Last Planned Space Shuttle Engine Test
2009-01-01
With 520 seconds of shake, rattle and roar on July 29, 2009 NASA's John C. Stennis Space Center marked the end of an era for testing the space shuttle main engines that have powered the nation's Space Shuttle Program for nearly three decades.
Energy Technology Data Exchange (ETDEWEB)
Franke, J.-H.; Kosov, D. S. [Department of Physics, Campus Plaine - CP 231, Universite Libre de Bruxelles, 1050 Brussels (Belgium)
2015-01-28
We study the adsorption and ring-opening of lactide on the naturally chiral metal surface Pt(321){sup S}. Lactide is a precursor for polylactic acid ring-opening polymerization, and Pt is a well known catalyst surface. We study, here, the energetics of the ring-opening of lactide on a surface that has a high density of kink atoms. These sites are expected to be present on a realistic Pt surface and show enhanced catalytic activity. The use of a naturally chiral surface also enables us to study potential chiral selectivity effects of the reaction at the same time. Using density functional theory with a functional that includes the van der Waals forces in a first-principles manner, we find modest adsorption energies of around 1.4 eV for the pristine molecule and different ring-opened states. The energy barrier to be overcome in the ring-opening reaction is found to be very small at 0.32 eV and 0.30 eV for LL- and its chiral partner DD-lactide, respectively. These energies are much smaller than the activation energy for a dehydrogenation reaction of 0.78 eV. Our results thus indicate that (a) ring-opening reactions of lactide on Pt(321) can be expected already at very low temperatures, and Pt might be a very effective catalyst for this reaction; (b) the ring-opening reaction rate shows noticeable enantioselectivity.
Center Director Bridges visits Disability Awareness and Action working Group Technology Fair
1999-01-01
Center Director Roy Bridges (standing, center) poses with members of the Disability Awareness and Action Working Group (DAAWG), which is holding the 1999 Technology Fair Oct. 20-21 at Kennedy Space Center. The Fair is highlighting vendors demonstrating mobility, hearing, vision and silent disability assistive technology. The purpose is to create an awareness of the types of technology currently available to assist people with various disabilities in the workplace. The theme is that of this year's National Disability Employment Awareness Month, 'Opening Doors to Ability.' Some of the vendors participating are Canine Companions for Independence, Goodwill Industries, Accessible Structures, Division of Blind Services, Space Coast Center for Independent Living, KSC Fitness Center and Delaware North Parks Services.