WorldWideScience

Sample records for sp nrrl b-2354

  1. Safety of the Surrogate Microorganism Enterococcus faecium NRRL B-2354 for Use in Thermal Process Validation

    Science.gov (United States)

    Kopit, Lauren M.; Kim, Eun Bae; Siezen, Roland J.; Harris, Linda J.

    2014-01-01

    Enterococcus faecium NRRL B-2354 is a surrogate microorganism used in place of pathogens for validation of thermal processing technologies and systems. We evaluated the safety of strain NRRL B-2354 based on its genomic and functional characteristics. The genome of E. faecium NRRL B-2354 was sequenced and found to comprise a 2,635,572-bp chromosome and a 214,319-bp megaplasmid. A total of 2,639 coding sequences were identified, including 45 genes unique to this strain. Hierarchical clustering of the NRRL B-2354 genome with 126 other E. faecium genomes as well as pbp5 locus comparisons and multilocus sequence typing (MLST) showed that the genotype of this strain is most similar to commensal, or community-associated, strains of this species. E. faecium NRRL B-2354 lacks antibiotic resistance genes, and both NRRL B-2354 and its clonal relative ATCC 8459 are sensitive to clinically relevant antibiotics. This organism also lacks, or contains nonfunctional copies of, enterococcal virulence genes including acm, cyl, the ebp operon, esp, gelE, hyl, IS16, and associated phenotypes. It does contain scm, sagA, efaA, and pilA, although either these genes were not expressed or their roles in enterococcal virulence are not well understood. Compared with the clinical strains TX0082 and 1,231,502, E. faecium NRRL B-2354 was more resistant to acidic conditions (pH 2.4) and high temperatures (60°C) and was able to grow in 8% ethanol. These findings support the continued use of E. faecium NRRL B-2354 in thermal process validation of food products. PMID:24413604

  2. Evaluation of Enterococcus faecium NRRL B-2354 as a Surrogate for Salmonella During Extrusion of Low-Moisture Food.

    Science.gov (United States)

    Verma, Tushar; Wei, Xinyao; Lau, Soon Kiat; Bianchini, Andreia; Eskridge, Kent M; Subbiah, Jeyamkondan

    2018-04-01

    Salmonella in low-moisture foods is an emerging challenge due to numerous food product recalls and foodborne illness outbreaks. Identification of suitable surrogate is critical for process validation at industry level due to implementation of new Food Safety Modernization Act of 2011. The objective of this study was to evaluate Enterococcus faecium NRRL B-2354 as a surrogate for Salmonella during the extrusion of low-moisture food. Oat flour, a low-moisture food, was adjusted to different moisture (14% to 26% wet basis) and fat (5% to 15% w/w) contents and was inoculated with E. faecium NRRL B-2354. Inoculated material was then extruded in a lab-scale single-screw extruder running at different screw speeds (75 to 225 rpm) and different temperatures (75, 85, and 95 °C). A split-plot central composite 2nd order response surface design was used, with the central point replicated six times. The data from the selective media (m-Enterococcus agar) was used to build the response surface model for inactivation of E. faecium NRRL B-2354. Results indicated that E. faecium NRRL B-2354 always had higher heat resistance compared to Salmonella at all conditions evaluated in this study. However, the patterns of contour plots showing the effect of various product and process parameters on inactivation of E. faecium NRRL B-2354 was different from that of Salmonella. Although E. faecium NRRL B-2354 may be an acceptable surrogate for extrusion of low-moisture products due to higher resistance than Salmonella, another surrogate with similar inactivation behavior may be preferred and needs to be identified. Food Safety Modernization Act requires the food industry to validate processing interventions. This study validated extrusion processing and demonstrated that E. faecium NRRL B-2354 is an acceptable surrogate for extrusion of low-moisture products. The developed response surface model allows the industry to identify process conditions to achieve a desired lethality for their

  3. Inactivation of Salmonella, Listeria monocytogenes and Enterococcus faecium NRRL B-2354 in a selection of low moisture foods.

    Science.gov (United States)

    Rachon, Grzegorz; Peñaloza, Walter; Gibbs, Paul A

    2016-08-16

    The aims of this study were to obtain data on survival and heat resistance of cocktails of Salmonella, Listeria monocytogenes and the surrogate Enterococcus faecium (NRRL B-2354) in four low moisture foods (confectionery formulation, chicken meat powder, pet food and savoury seasoning) during storage before processing. Inoculated samples were stored at 16°C and cell viability examined at day 0, 3, 7 and 21. At each time point, the heat resistance at 80°C was determined. The purpose was to determine a suitable storage time of inoculated foods that can be applied in heat resistance studies or process validations with similar cell viability and heat resistance characteristics. The main inactivation study was carried out within 7days after inoculation, the heat resistance of each bacterial cocktail was evaluated in each low moisture food heated in thermal cells exposed to temperatures between 70 and 140°C. The Weibull model and the first order kinetics (D-value) were used to express inactivation data and calculate the heating time to achieve 5 log reduction at each temperature. Results showed that the pathogens Salmonella and L. monocytogenes and the surrogate E. faecium NRRL B-2354, can survive well (maximum reduction 0.05). The inactivation kinetics of the pathogens and surrogate at temperatures between 70 and 140°C, were different between each organism and product. E. faecium NRRL B-2354 was a suitable Salmonella surrogate for three of the low moisture foods studied, but not for the sugar-containing confectionery formulation. Heating low moisture food in moisture-tight environments (thermal cells) to 111.2, 105.3 or 111.8°C can inactivate 5 log of Salmonella, L. monocytogenes or E. faecium NRRL B-2354 respectively. Copyright © 2016 Elsevier B.V. All rights reserved.

  4. Evaluating Pediococcus acidilactici and Enterococcus faecium NRRL B-2354 as Thermal Surrogate Microorganisms for Salmonella for In-Plant Validation Studies of Low-Moisture Pet Food Products.

    Science.gov (United States)

    Ceylan, Erdogan; Bautista, Derrick A

    2015-05-01

    Pediococcus acidilactici ATCC 8042 and Enterococcus faecium NRRL B-2354 were investigated as potential surrogates for Salmonella serovars using thermal death time kinetics in products such as dry pet foods. The D-values of P. acidilactici ATCC 8042, E. faecium NRRL B-2354, and a cocktail of seven Salmonella serovars associated with low-moisture products were determined in a preservative-free dry pet food product at moisture levels of 9.1, 17.9, and 27.0% and heated between 76.7 and 87.8°C. The D-values were calculated by least squares linear regression. The D-values of P. acidilactici ATCC 8042 were higher than those for the Salmonella serovar cocktail but lower than those for E. faecium NRRL 2354. At 9.1% moisture, D-values of 6.54, 11.51, and 11.66 min at 76.7°C, 2.66, 3.22, and 4.08 min at 82.2°C, and 1.07, 1.29, and 1.69 min at 87.8°C were calculated for Salmonella serovars, P. acidilactici ATCC 8042, and E. faecium NRRL B-2354, respectively. The data suggest that the thermal inactivation characteristics of P. acidilactici ATCC 8042 can be utilized as a surrogate to predict the response of Salmonella in dry pet food products that are thermally processed at <90°C.

  5. Identification and characterization of a novel class of extracellular poly(3-hydroxybutyrate) depolymerase from Bacillus sp. strain NRRL B-14911.

    Science.gov (United States)

    Ma, Wan-Ting; Lin, Ju-Hui; Chen, Hui-Ju; Chen, Syuan-Yi; Shaw, Gwo-Chyuan

    2011-11-01

    The catalytic, linker, and denatured poly(3-hydroxybutyrate) (dPHB)-binding domains of bacterial extracellular PHB depolymerases (PhaZs) are classified into several different types. We now report a novel class of extracellular PHB depolymerase from Bacillus sp. strain NRRL B-14911. Its catalytic domain belongs to type 1, whereas its putative linker region neither possesses the sequence features of the three known types of linker domains nor exhibits significant amino acid sequence similarity to them. Instead, this putative linker region can be divided into two distinct linker domains of novel types: LD1 and LD2. LD1 shows significant amino acid sequence similarity to certain regions of a large group of PHB depolymerase-unrelated proteins. LD2 and its homologs are present in a small group of PhaZs. The remaining C-terminal portion of this PhaZ can be further divided into two distinct domains: SBD1 and SBD2. Each domain showed strong binding to dPHB, and there is no significant sequence similarity between them. Each domain neither possesses the sequence features of the two known types of dPHB-binding domains nor shows significant amino acid sequence similarity to them. These unique features indicate the presence of two novel and distinct types of dPHB-binding domains. Homologs of these novel domains also are present in the extracellular PhaZ of Bacillus megaterium and the putative extracellular PhaZs of Bacillus pseudofirmus and Bacillus sp. strain SG-1. The Bacillus sp. NRRL B-14911 PhaZ appears to be a representative of a novel class of extracellular PHB depolymerases.

  6. Identification and Characterization of a Novel Class of Extracellular Poly(3-Hydroxybutyrate) Depolymerase from Bacillus sp. Strain NRRL B-14911▿

    Science.gov (United States)

    Ma, Wan-Ting; Lin, Ju-Hui; Chen, Hui-Ju; Chen, Syuan-Yi; Shaw, Gwo-Chyuan

    2011-01-01

    The catalytic, linker, and denatured poly(3-hydroxybutyrate) (dPHB)-binding domains of bacterial extracellular PHB depolymerases (PhaZs) are classified into several different types. We now report a novel class of extracellular PHB depolymerase from Bacillus sp. strain NRRL B-14911. Its catalytic domain belongs to type 1, whereas its putative linker region neither possesses the sequence features of the three known types of linker domains nor exhibits significant amino acid sequence similarity to them. Instead, this putative linker region can be divided into two distinct linker domains of novel types: LD1 and LD2. LD1 shows significant amino acid sequence similarity to certain regions of a large group of PHB depolymerase-unrelated proteins. LD2 and its homologs are present in a small group of PhaZs. The remaining C-terminal portion of this PhaZ can be further divided into two distinct domains: SBD1 and SBD2. Each domain showed strong binding to dPHB, and there is no significant sequence similarity between them. Each domain neither possesses the sequence features of the two known types of dPHB-binding domains nor shows significant amino acid sequence similarity to them. These unique features indicate the presence of two novel and distinct types of dPHB-binding domains. Homologs of these novel domains also are present in the extracellular PhaZ of Bacillus megaterium and the putative extracellular PhaZs of Bacillus pseudofirmus and Bacillus sp. strain SG-1. The Bacillus sp. NRRL B-14911 PhaZ appears to be a representative of a novel class of extracellular PHB depolymerases. PMID:21948827

  7. Bacillus swezeyi sp. nov. and Bacillus haynesii sp. nov., isolated from desert soil.

    Science.gov (United States)

    Dunlap, Christopher A; Schisler, David A; Perry, Elizabeth B; Connor, Nora; Cohan, Frederick M; Rooney, Alejandro P

    2017-08-01

    Two isolates of Gram-reaction-positive, facultatively anaerobic, motile, rod-shaped, endospore-forming bacteria were identified during a survey of the diversity of strains belonging to the genus Bacillus deposited in the Agriculture Research Service Culture Collection. These strains were originally isolated from soil in Evolution Canyon III (Israel) in a survey of ecological diversification. Phylogenetic analysis of the 16S rRNA gene of strains NRRL B-41294T and NRRL B-41327T determined they were closely related to members of the Bacillus licheniformis clade. The genome of each strain was sequenced, and further analysis indicated that the strains represented unique species based on in silico DNA-DNA hybridization analyses. A phylogenomic analysis revealed that NRRL B-41294T and NRRL B-41327T were closely related to the group that includes B. licheniformis. In phenotypic characterization, both NRRL B-41294T and NRRL B-41327T were found to grow at temperatures of between 15 and 60 °C and tolerated up to 12 % NaCl (w/v). The predominant cellular fatty acids were anteiso-C15 : 0 and iso-C15 : 0, and peptidoglycan from cell walls contained meso-diaminopimelic acid. The DNA G+C content was 45.7 and 44.3 mol% for NRRL B-41327T and NRRL B-41294T, respectively. Furthermore, each strain had a unique carbon utilization pattern that distinguished it from its nearest phylogenetic neighbours. Based upon the consensus of phylogenetic and phenotypic analyses, we conclude that these strains represent two novel species within the genus Bacillus, for which the name Bacillus swezeyi sp. nov. is proposed, with type strain NRRL B-41294T (=CCUG 70177T), and the name Bacillus haynesii sp. nov. is proposed, with type strain NRRL B-41327T (=CCUG 70178T).

  8. Transformation and electrophoretic karyotyping of Coniochaeta ligniaria NRRL30616.

    Science.gov (United States)

    Nichols, Nancy N; Szynkarek, Matthew P; Skory, Christopher D; Gorsich, Steven W; López, Maria J; Guisado, Gema M; Nichols, Wade A

    2011-06-01

    Coniochaeta ligniaria NRRL30616 is an ascomycete that grows with yeast-like appearance in liquid culture. The strain has potential utility for conversion of fibrous biomass to fuels or chemicals. Furans and other inhibitory compounds in lignocellulosic biomass are metabolized by NRRL30616, facilitating subsequent microbial fermentation of biomass sugars. This study undertook initial characterization of the genetic system of C. ligniaria NRRL30616. Transformation using hygromycin as a dominant selectable marker was achieved using protoplasts generated by incubating cells in 1% (v/v) β-mercaptoethanol, followed by cell wall-digesting enzymes. Thirteen chromosomes with an estimated total size of 30.1 Mb were detected in C. ligniaria. The GC content of chromosomal DNA and of coding regions from cDNA sequences were 49.2 and 51.9%, respectively. This study is the first report of genome size, electrophoretic karyotype, and transformation system for a member of the Coniochaetales.

  9. sp

    African Journals Online (AJOL)

    Vihar

    adopted as the first line drug. SP has few untoward effects if used carefully in therapeutic doses. Nausea, vomiting, generalized body weakness; diarrhea, skin rashes and hematological reactions are some of the associated side effects. The drug can cause severe skin reactions such as Steven Johnson's syndrome. This.

  10. Candida spencermartinsiae sp. nov., Candida taylorii sp. nov. and Pseudozyma abaconensis sp. nov., novel yeasts from mangrove and coral reef ecosystems.

    Science.gov (United States)

    Statzell-Tallman, Adele; Scorzetti, Gloria; Fell, Jack W

    2010-08-01

    Three species of yeasts are taxonomically described for strains isolated from marine environments. Candida spencermartinsiae sp. nov. (type strain CBS 10894T =NRRL Y-48663T) and Candida taylorii sp. nov. (type strain CBS 8508T =NRRL Y-27213T) are anamorphic ascomycetous yeasts in a phylogenetic cluster of marine yeasts in the Debaryomyces/Lodderomyces clade of the Saccharomycetales. The two species were isolated from multiple locations among coral reefs and mangrove habitats. Pseudozyma abaconensis sp. nov. (type strain CBS 8380T =NRRL Y-17380T) is an anamorphic basidiomycete that is related to the smut fungi of the genus Ustilago in the Ustilaginales. P. abaconensis was collected from waters adjacent to a coral reef.

  11. Production of chitooligosaccharides from Rhizopus oligosporus NRRL2710 cells by chitosanase digestion.

    Science.gov (United States)

    Mahata, Maria; Shinya, Shoko; Masaki, Eiko; Yamamoto, Takashi; Ohnuma, Takayuki; Brzezinski, Ryszard; Mazumder, Tapan K; Yamashita, Kazuhiko; Narihiro, Kazue; Fukamizo, Tamo

    2014-01-13

    The intact cells of Rhizopus oligosporus NRRL2710, whose cell walls are abundant source of N-acetylglucosamine (GlcNAc) and glucosamine (GlcN), were digested with three chitinolytic enzymes, a GH-46 chitosanase from Streptomyces sp. N174 (CsnN174), a chitinase from Pyrococcus furiosus, and a chitinase from Trichoderma viride, respectively. Solubilization of the intact cells by CsnN174 was found to be the most efficient from solid state CP/MAS (13)C NMR spectroscopy. Chitosanase products from Rhizopus cells were purified by cation exchange chromatography on CM-Sephadex C-25 and gel-filtration on Cellulofine Gcl-25m. NMR and MALDI-TOF-MS analyses of the purified products revealed that GlcN-GlcNAc, (GlcN)2-GlcNAc, and (GlcN)2 were produced by the enzymatic digestion of the intact cells. The chitosanase digestion of Rhizopus cells was found to be an excellent system for the conversion of fungal biomass without any environmental impact. Copyright © 2013 Elsevier Ltd. All rights reserved.

  12. Nocardia iowensis sp. nov., an organism rich in biocatalytically important enzymes and nitric oxide synthase

    Science.gov (United States)

    Lamm, Andrew S.; Khare, Arshdeep; Conville, Patricia; Lau, Peter C. K.; Bergeron, Hélène; Rosazza, John P. N.

    2009-01-01

    Nocardia strain NRRL 5646, isolated from a garden soil sample in Osceola, Iowa, USA, was initially of interest as an antibiotic producer. It contained biocatalytically important enzymes and represented the first described nitric oxide synthase enzyme system in bacteria. The present polyphasic taxonomic study was undertaken to differentiate strain NRRL 5646T from related species of the genus Nocardia. Chemotaxonomic analyses included determinations of the fatty acid methyl ester profile (C16 : 1ω6c/C16 : 1ω7c, C16 : 0, C18 : 1ω9c and C18 : 0 10-methyl as major components), quinone [cyclo MK-8(H4) as the major component], polar lipid (diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylinositol and phosphatidylinositol mannoside as major components) and mycolic acid. These results supported its placement within the genus Nocardia. Biochemical testing and 16S rRNA, 65-kDa heat-shock protein (hsp65) and preprotein translocase (secA1) gene sequence analyses differentiated strain NRRL 5646T from recognized Nocardia species. Previous studies have demonstrated that other genetic sequences (carboxylic acid reductase, Nocardia phosphopantetheinyl transferase and GTP cyclohydrolase I) from strain NRRL 5646T can also be used to substantiate its uniqueness. The level of 16S rRNA gene sequence similarity between strain NRRL 5646T and the type strains of Nocardia tenerifensis and Nocardia brasiliensis was 98.8 %. However, strain NRRL 5646T could be clearly distinguished from these Nocardia species based on DNA–DNA hybridization data. Consequently, strain NRRL 5646T is considered to represent a novel species of the genus Nocardia, for which the name Nocardia iowensis sp. nov. is proposed. The type strain is NRRL 5646T (=UI 122540T=NRRL B-24671T=DSM 45197T). PMID:19622667

  13. Three new asexual arthroconidial yeasts, Geotrichum carabidarum sp. nov., Geotrichum histeridarum sp. nov., and Geotrichum cucujoidarum sp. nov., isolated from the gut of insects.

    Science.gov (United States)

    Suh, Sung-Oui; Blackwell, Meredith

    2006-02-01

    Twenty arthroconidial yeasts were isolated from the digestive tract of basidiome-feeding beetles and lepidopteran larvae. All of the yeasts reproduced only asexually by arthroconidia and some by endo- or blastoconidia as well. Based on the comparisons of sequences in ribosomal RNA genes and other taxonomic characteristics, the yeasts were identified as three unknown Geotrichum species. The three new species are described as Geotrichum carabidarum (NRRL Y-27727T), G. histeridarum (NRRL Y-27729T), and G. cucujoidarum (NRRL Y-27731T). Phylogenetic analyses from ribosomal DNA sequences showed that members of the genus Geotrichum and related arthroconidial yeast taxa were divided into two major clades: (1) Dipodascus and Galactomyces with Geotrichum anamorphs including all the new species; and (2) Magnusiomyces with Saprochaete anamorphs. G. cucujoidarum formed a subclade with G. fermentans and Geotrichum sp. Y-5419, while the two closely related species, G. carabidarum and G. histeridarum, represent a new basal subclade in the clade of Geotrichum and its teleomorphs.

  14. Geotrichum silvicola sp. nov., a novel asexual arthroconidial yeast species related to the genus Galactomyces.

    Science.gov (United States)

    Pimenta, Raphael S; Alves, Priscila D D; Corrêa, Ary; Lachance, Marc-André; Prasad, G S; Rajaram; Sinha, B R R P; Rosa, Carlos A

    2005-01-01

    Four strains of an asexual arthroconidial yeast species were isolated from Drosophila flies in two Atlantic rain forest sites in Brazil and two strains from oak tasar silkworm larvae (Antheraea proylei) in India. Analysis of the sequences of the D1/D2 large subunit rRNA gene showed that this yeast represented a novel species of the genus Geotrichum, described as Geotrichum silvicola sp. nov. The novel species was related to the ascogenous genus Galactomyces. The closest relatives of Geotrichum silvicola were Galactomyces sp. strain NRRL Y-6418 and Galactomyces geotrichum. The type culture of Geotrichum silvicola is UFMG-354-2T (=CBS 9194T=NRRL Y-27641T).

  15. Characterization of two thermostable inulinases from Rhizopus oligosporus NRRL 2710

    Directory of Open Access Journals (Sweden)

    Saleh A. Mohamed

    2015-06-01

    Full Text Available Two inulinases (Inu2 and Inu3 were purified from Rhizopus oligosporus NRRL 2710 by chromatography on DEAE-Sepharose and Sephacryl S-200 columns. The molecular weight of Inu2 and Inu3 were determined to be 76 and 30 kDa, respectively. Inu2 and Inu3 had the same pH optimum at 5.0, temperature optimum at 50 and 60 °C, and thermal stability up to 60 and 70 °C for 1 h, respectively. Inu2 and Inu3 had low km values (0.93 and 0.70 mM, respectively indicating the high affinity toward inulin. Mg2+, Ca2+, Zn2+ and EDTA did not significantly influence the enzyme activity. Ni2+, Cu2+, Fe2+ and Co2+ showed a partial inhibitory effect, and Hg2+ had a strong inhibitory effect. p-Chloromercuribenzoate had a partial inhibitory effect on Inu2. From these findings, R. oligosporus inulinases can be beneficial enzymes for industrial enzymatic production of high fructose syrup.

  16. The yeast genus Tortispora gen. nov., description of Tortispora ganteri sp. nov., Tortispora mauiana f.a., sp. nov., Tortispora agaves f.a., sp. nov., Tortispora sangerardonensis f.a., sp. nov., Tortispora cuajiniquilana f.a., sp. nov., Tortispora starmeri f.a., sp. nov. and Tortispora phaffii f.a., sp. nov., reassignment of Candida caseinolytica to Tortispora caseinolytica f.a., comb. nov., emendation of Botryozyma, and assignment of Botryozyma, Tortispora gen. nov. and Trigonopsis to the family Trigonopsidaceae fam. nov.

    Science.gov (United States)

    Lachance, M-A; Kurtzman, C P

    2013-08-01

    We describe the yeast genus Tortispora gen. nov., an early-diverging lineage in the Saccharomycetales that displays the formation of helical ascospores. The genus is based on 16 strains resembling Candida caseinolytica that were isolated from necrotic plant tissue in warm regions of the New World. Based on sequences of the D1/D2 domains of the nuclear large subunit rRNA gene, as well as other data, the strains are assigned to eight distinct species. The species are nutritionally specialized and share the unusual ability to hydrolyse casein and to grow on 1-butanol as sole carbon source. One species of the proposed new genus produces a simple ascus with a helical ascospore, whereas other species of the clade have failed to form ascospores. All species in the clade, including C. caseinolytica, are assigned to Tortispora gen. nov. The new binomials are Tortispora ganteri sp. nov., type species of the genus (SUB 86-469.5(T) = CBS 12581(T) = NRRL Y-17035(T)), Tortispora caseinolytica f.a., comb. nov. (UCD-FST 83-438.3(T) = CBS 7781(T) = NRRL Y-17796(T)), Tortispora mauiana f.a., sp. nov. (UWOPS 87-2430.3(T) = CBS 12803(T) = NRRL Y-48832(T)), Tortispora agaves f.a., sp. nov. (UWOPS 94-257.6(T) = CBS 12794(T) = NRRL Y-63662(T)), Tortispora sangerardonensis f.a., sp. nov. (UWOPS 00-157.1(T) = CBS 12795(T) = NRRL Y-63663(T)), Tortispora cuajiniquilana f.a., sp. nov. (UWOPS 99-344.4(T) = CBS 12796(T) = NRRL Y-63664(T)), Tortispora starmeri f.a., sp. nov. (G 91-702.5(T) = CBS 12793(T) = NRRL Y-63665(T)) and Tortispora phaffii f.a., sp. nov. (UWOPS 91-445.1(T) = CBS 12804(T) = NRRL Y-48833(T)). In addition, species formerly assigned to the genus Ascobotryozyma are reassigned to the genus Botryozyma. The genera Trigonopsis, Botryozyma and Tortispora are assigned to the family Trigonopsidaceae fam. nov.

  17. Extracellular lipase of Aspergillus niger NRRL3; production, partial purification and properties

    OpenAIRE

    Adham, Nehad Z.; Ahmed, E. M.

    2009-01-01

    Four strains of Aspergillus niger were screened for lipase production. Each was cultivated on four different media differing in their contents of mineral components and sources of carbon and nitrogen. Aspergillus niger NRRL3 produced maximal activity (325U/ml) when grown in 3% peptone, 0.05% MgSO4.7H2O, 0.05% KCl, 0.2% K2HPO4 and 1% olive oil:glucose (0.5:0.5). A. niger NRRL3 lipase was partially purified by ammonium sulphate precipitation. The majority of lipase activity (48%) was located in...

  18. The potential use of probiotic strains Lactobacillus acidophilus NRRL B 4495, Bifidobacterium bifidum NRRL B41410 in “Lor Whey Cheese” and the effects on sensory properties.

    Science.gov (United States)

    Irkin, Reyhan; Yalcin, Onur

    2017-01-01

    In recent years, probiotic bacteria have increasingly been incorporated into various foods as dietary adjuncts. The viability of the probiotic bacteria Lactobacillus acidophilus NRRL B 4495 and Bifido- bacterium bifidum NRRL B41410 in salted (1% w/w) and unsalted lor whey cheese during storage (21 days) at a refrigerated temperature (4°C) was evaluated. As well as the survival of the probiotic bacteria, total mesophilic bacteria, total lactic acid bacteria, Pseudomonas spp., yeast-mould counts and sensory characteristics were examined in the lor samples. The Bf. bifidum remained in large numbers, at 7.30 and 7.11 log cfu/g, and Lb. acidophilus also survived well, with counts of 7.60 and 7.47 log cfu/g, for unsalted and salted cheeses respectively. Salted lor cheeses with added Lb. acidophilus have the highest sensory scores in the groups. “Lor” whey cheese showed good probiotic properties.

  19. Proteomic Analyses of Ethanol Tolerance in Lactobacillus buchneri NRRL B-30929

    Science.gov (United States)

    The Lactobacillus buchneri NRRL B-30929 strain, isolated from a fuel ethanol production facility, exhibits high tolerance to environmental ethanol concentrations. In this study, the ethanol tolerance trait was elucidated at the molecular level by using proteomics comparison and analyses. Cellular p...

  20. Metschnikowia chrysoperlae sp. nov., Candida picachoensis sp. nov. and Candida pimensis sp. nov., isolated from the green lacewings Chrysoperla comanche and Chrysoperla carnea (Neuroptera: Chrysopidae).

    Science.gov (United States)

    Suh, Sung-Oui; Gibson, Cara M; Blackwell, Meredith

    2004-09-01

    Fourteen yeast isolates comprising three taxa were cultured from digestive tracts of adult Chrysoperla species (Neuroptera: Chrysopidae) and their eggs. The yeast taxa were distinguished based on an estimated molecular phylogeny, DNA sequences and traditional taxonomic criteria. The new yeasts are closely related to Metschnikowia pulcherrima but are sufficiently distinguished by sequence comparison of rRNA gene sequences to consider them as novel species. Here, three novel species are described and their relationships with other taxa in the Saccharomycetes are discussed. Metschnikowia chrysoperlae sp. nov. (type strain, NRRL Y-27615T = CBS 9803T) produced needle-shaped ascospores and was the only teleomorph found. Large numbers of chlamydospores similar to those observed in M. pulcherrima were also produced. The other two novel species are asexual yeasts, Candida picachoensis sp. nov. (type strain, NRRL Y-27607T = CBS 9804T) and Candida pimensis sp. nov. (type strain, NRRL Y-27619T = CBS 9805T), sister taxa of M. chrysoperlae and M. pulcherrima. A specialized relationship between yeasts and lacewing hosts may exist, because the yeasts were isolated consistently from lacewings only. Although M. chrysoperlae was isolated from eggs and adult lacewings, suggesting the possibility of vertical transmission, no yeast was isolated from larvae.

  1. Physiological and Chemical Studies on the Bioconversion of Glycyrrhizin by Aspergillus niger NRRL595

    Directory of Open Access Journals (Sweden)

    El-Refai, A. M. H.

    2012-06-01

    Full Text Available Glycyrrhizin (GL, the well-known sweet saponin of licorice, has been used as a food-additive and as a medicine. Its aglycone, glycyrrhetic acid (GA showed antiinflamatory, antiulcer and antiviral properties. GA is now produced form GL by acid hydrolysis. However, it is difficult to obtain GA in a good yield by using this method, because many by-productsare also produced. Screening of different microorganisms (13 bacteria, 2 yeasts and 23 fungi for production of GA from GL revealed that Aspergillus niger NRRL 595 produced the highest yield of GA. The bioconversion of GL by A. niger NRRL 595 for 96 h, followed by isolation and purification of the transformation products led to the separation of two conversion products, namely: GA and 3-oxo-GA. Confirmation of the identity of these products was established by determination of their Rf values, m.p., and IR, UV, MS and NMR spectra. The conditions for cultivation of this fungus with the maximum hydrolytic activity for the maximum yield of GA were investigated. Based on the results, A. niger NRRL 595 was cultivated with a medium composed of 1.75 % GL, 0.5 % glucose, 0.8 % corn steep liquor at pH 6.5 at 32 °C for 96 h. The cultivation of fungal cells under the latter conditions afforded GA and 3-oxo-GA in a yield of 65 % and 22 %, respectively.

  2. Comparative study of two purified inulinases from thermophile Thielavia Terrestris NRRL 8126 and mesophile Aspergillus Foetidus NRRL 337 grown on Cichorium Intybus l

    Directory of Open Access Journals (Sweden)

    Eman Mohamed Fawzi

    2011-06-01

    Full Text Available Thirty fungal species grown on Cichorium intybus L. root extract as a sole carbon source, were screened for the production of exo-inulinase activities. The thermophile Thielavia terrestris NRRL 8126 and mesophile Aspergillus foetidus NRRL 337 gave the highest production levels of inulinases I & II at 50 and 24 ºC respectively. Yeast extract and peptone were the best nitrogen sources for highest production of inulinases I & II at five and seven days of incubation respectively. The two inulinases I & II were purified to homogeneity by gel-filtration and ion-exchange chromatography with 66.0 and 42.0 fold of purification respectively. The optimum temperatures of purified inulinases I & II were 75 and 50 ºC respectively. Inulinase I was more thermostable than the other one. The optimum pH for activity was found to be 4.5 and 5.5 for inulinases I & II respectively. A comparatively lower Michaelis-Menten constant (2.15 mg/ml and higher maximum initial velocity (115 µmol/min/mg of protein for inulinase I on inulin demonstrated the exoinulinase's greater affinity for inulin substrate. These findings are significant for its potential industrial application. The molecular mass of the inulinases I & II were estimated to be 72 & 78 kDa respectively by sodium dodecyl sulfate-polyacrylamide gel electrophoresis.

  3. SYNERGISTIC ACTIVITY OF ENZYMES PRODUCED BY EUPENICILLIUM JAVANICUM AND ASPERGILLUS NIGER NRRL 337 ON PALM OIL FACTORY WASTES

    Directory of Open Access Journals (Sweden)

    TRESNAWATI PURWADARIA

    2003-01-01

    Full Text Available The use of palm kernel cake (PKC and palm oil mill effluent (POME, substances from palm oil factory wastes, for monogastric is limited by their high cellulose and mannan contents. Hydrolytic enzymes have been supplemented to increase the nutrient digestibility. The maximal digestibility was obtained in the synergistic action of all enzyme components including B-D-endoglucanase (CMCase, B-D-glucosidase, B-D-mannanase, p-D-mannosidase, and oc-D-galactosidase. Two kinds of enzymes produced by Eupenicillium javanicum and Aspergillus niger NRRL 337 on the submerged culture containing 3% coconut meal were selected to hydrolyze PKC or dry POME. Enzyme from E. javanicum contained higher CMCase, B-D-mannanase, and a-D- galactosidase activities, while that from A. niger NRRL 337 contained more p-D-glucosidase and p-D-mannosidase activities. Saccharification (hydrolytic activities of enzyme mixtures on PKC and POME were determined at pH 5.0, the optimal pH for p-D-mannanase from E. javanicum, and at 5.4 the optimal pH for a-D-galactosidase from E. javanicum and P-D-glucosidase from A. niger NRRL 337. The enzyme proportions of E. javanicum and A. niger NRRL 337 were 100 : 0, 80 : 20, 60 : 40, 40 : 60, and 0 : 100%. The highest Saccharification activity on both substrates was observed on the mixture of 80% A. niger NRRL 337. The pH levels did not significantly affect Saccharification activity. Fiber components in PKC were more digestable than in POME. Further analysis on the reducing sugar components using thin layer chromatography showed that more monomers were produced in the 60 or 80% of A. niger NRRL 337. The glycosidases of A. niger NRRL 337 played more important role in the Saccharification activity.

  4. Comparative chemistry of Aspergillus oryzae (RIB40) and A. flavus (NRRL 3357)

    DEFF Research Database (Denmark)

    Rank, Christian; Klejnstrup, Marie Louise; Petersen, Lene Maj

    2012-01-01

    in the secondary metabolite production. In this study we report on the first comparison of secondary metabolite production between the full genome sequenced strains of A. oryzae (RIB40) and A. flavus (NRRL 3357). Surprisingly, the overall chemical profiles of the two strains were mostly very different across 15...... growth conditions. Contrary to previous studies we found the aflatrem precursor 13-desoxypaxilline to be a major metabolite from A. oryzae under certain growth conditions. For the first time, we additionally report A. oryzae to produce parasiticolide A and two new analogues hereof, along with four new...

  5. Microbial transformation of hydroxy metabolites of 1-oxohexyl derivatives of theobromine by Cunninghamella echinulata NRRL 1384.

    Science.gov (United States)

    Pekala, E; Kochan, M; Carnell, A J

    2009-01-01

    The biotransformation of pentoxifylline (PTX), propentofylline (PPT) and their racemic hydroxy metabolites ((+/-)-OHPTX and (+/-)-OHPPT) by using the fungus Cunninghamella echinulata NRRL 1384. A fungus Cunninghamella echinulata NRRL 1384 was used to catalyse the (S)-selective oxidation of the racemic hydroxy metabolites: (+/-)-OHPTX and (+/-)-OHPPT and for reduction of PTX and PPT. The first oxidation step appears to be selective and relatively fast while the second reduction step is slower and more selective with PTX. Modifications involving supplementing the bioconversion with glucose give yields and enantiomeric excess (ee) values similar to those obtained without glucose. The bioconversion of (+/-)-OHPTX gave an (R)-enantiomer (LSF-lisofylline) with a higher enantiopurity (maximum approximately 93% ee) compared to the bioconversion of (+/-)-OHPPT, when the maximum ee value for (R)-OHPPT was recorded at 83%. The conversion of (+/-)-OHPTX and (+/-)-OHPPT using Cunninghamella echinulata can be recognized as a process, which may be recommended as an alternative to the methods used to obtain (R)-OHPTX and (R)-OHPPT.

  6. Extracellular lipase of Aspergillus niger NRRL3; production, partial purification and properties.

    Science.gov (United States)

    Adham, Nehad Z; Ahmed, E M

    2009-03-01

    Four strains of Aspergillus niger were screened for lipase production. Each was cultivated on four different media differing in their contents of mineral components and sources of carbon and nitrogen. Aspergillus niger NRRL3 produced maximal activity (325U/ml) when grown in 3% peptone, 0.05% MgSO(4).7H(2)O, 0.05% KCl, 0.2% K(2)HPO(4) and 1% olive oil:glucose (0.5:0.5). A. niger NRRL3 lipase was partially purified by ammonium sulphate precipitation. The majority of lipase activity (48%) was located in fraction IV precipitated at 50-60% of saturation with a 18-fold enzyme purification. The optimal pH of the partial purified lipase preparation for the hydrolysis of emulsified olive oil was 7.2 and the optimum temperature was 60°C. At 70°C, the enzyme retained more than 90% of its activity. Enzyme activity was inhibited by Hg(2+) and K(+), whereas Ca(2+) and Mn(2+) greatly stimulated its activity. Additionally, the formed lipase was stored for one month without any loss in the activity.

  7. Optimization and characterization of biosurfactant from Streptomyces griseoplanus NRRL-ISP5009 (MS1).

    Science.gov (United States)

    Elkhawaga, M A

    2018-03-01

    This work aimed to study, isolate, characterize and stabilize the biosurfactant isolated from actinomycetes found in petroleum contaminated soil. Optimized production of the biosurfactant from Streptomyces griseoplanus NRRL-ISP5009, SM1 was obtained on day 6 at 30°C, pH 7, 150 rev min -1 , in glycerol yeast extract broth medium supplemented with cellulose, yeast extract and 1% NaCl. The stability of the biosurfactant produced was studied at different temperatures, pH and different concentrations of NaCl. The produced biosurfactant was extracted and purified. Streptomyces griseoplanus NRRL-ISP5009, SM1 isolated from oil contaminated soil produced a biosurfactant exhibiting emulsification activity. The produced biosurfactant is a mixture of carbohydrate, lipid and protein. It has promising characteristics, including a higher stability at alkaline pH than at acidic pH, a salinity of 1-3% and stable in the temperature range from 0 and 100°C. Also, the potential antimicrobial activity of the purified biosurfactant was recorded. The research was focused on the isolation of a novel source of biosurfactants that have great importance in the manufacture of food, detergent, pharmaceutical and cosmetics. © 2017 The Society for Applied Microbiology.

  8. Antifungal and antiaflatoxigenic activities of coumarinyl thiosemicarbazides against Aspergillus flavus NRRL 3251.

    Science.gov (United States)

    Kovač, Tihomir; Kovač, Marija; Strelec, Ivica; Nevistić, Ante; Molnar, Maja

    2017-03-01

    The antifungal and antiaflatoxigenic effects of two series of coumarinyl thiosemicarbazides on Aspergillus flavus NRRL 3251 were studied. Fungi were grown in YES medium for 72 h at 29 °C in the presence of 0, 0.1, 1, and 10 μg mL-1 of coumarinyl thiosemicarbazides: one series with substitution in position 7 and another with substitution in position 4 of the coumarin core. Dry mycelia weight determination was used for antifungal activity estimation, while the aflatoxin B1 content in YES media, determined by the dilute and shoot LC-MS/MS technique, was used for the antiaflatoxigenic effect estimation. Standard biochemical assays were used for oxidative status marker (TBARS, SOD, CAT, and GPX) determination in A. flavus NRRL 3251 mycelia. Results show that 7-substituted-coumarinyl thiosemicarbazides possess a better antifungal and antiaflatoxigenic activity than 4-substituted ones. The most prominent substituted compound was the compound 3, N-(4-chlorophenyl)-2-(2-((4-methyl-2-oxo-2H-chromen-7-yl)oxy)acetyl)hydrazine-1-carbothioamide, which completely inhibited aflatoxin production at the concentration of 10 μg mL-1. Oxidative stress response of A. flavus exposed to the selected compounds points to the modulation of oxidative stress as a possible reason of aflatoxin production inhibition.

  9. Alloascoidea hylecoeti gen. nov., comb. nov., Alloascoidea africana comb. nov., Ascoidea tarda sp. nov., and Nadsonia starkeyi-henricii comb. nov., new members of the Saccharomycotina (Ascomycota).

    Science.gov (United States)

    Kurtzman, Cletus P; Robnett, Christie J

    2013-08-01

    Phylogenetic analysis of concatenated nuclear gene sequences for large and small subunit rRNAs, translation elongation factor 1-α, and the two large subunits of RNA polymerase II (RPB1, RPB2) demonstrated that species assigned to the yeast genus Ascoidea represent two separate and distantly related clades, that is, Ascoidea (A. asiatica, NRRL Y-17632, CBS 377.68; A. rubescens, NRRL Y-17699, CBS 116.35, type species; A. tarda sp. nov., NRRL Y-2393, CBS 12609, type strain), which is near the genus Saccharomycopsis, and Alloascoidea gen. nov. (Al. africana comb. nov., NRRL Y-6762-3, CBS 12606, Al. hylecoeti comb. nov., NRRL Y-17634, CBS 355.80, type species), which is near Nadsonia and related genera. From these analyses and from comparison of herbarium specimens, it appears that type strains of A. asiatica and Al. africana had been reversed. Sequence analysis further showed that Schizoblastosporion starkeyi-henricii is a sister species of Nadsonia fulvescens and it is proposed for transfer to Nadsonia. © 2013 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  10. Genome Sequence of Aspergillus flavus NRRL 3357, a Strain That Causes Aflatoxin Contamination of Food and Feed

    OpenAIRE

    Nierman, William C.; Yu, Jiujiang; Fedorova-Abrams, Natalie D.; Losada, Liliana; Cleveland, Thomas E.; Bhatnagar, Deepak; Bennett, Joan W.; Dean, Ralph; Payne, Gary A.

    2015-01-01

    Aflatoxin contamination of food and livestock feed results in significant annual crop losses internationally. Aspergillus flavus is the major fungus responsible for this loss. Additionally, A.?flavus is the second leading cause of aspergillosis in immunocompromised human patients. Here, we report the genome sequence of strain NRRL 3357.

  11. Draft genome sequence of Coniochaeta ligniaria NRRL 30616, a lignocellulolytic fungus for bioabatement of inhibitors in plant biomass hydrolysates

    Science.gov (United States)

    Here, we report the first draft genome sequence (42.38 Mb that contains 13,657 genes) of Coniochaeta ligniaria NRRL30616, an ascomycete with high biotechnological relevance in the bioenergy field given its high potential for bioabatement of toxic furanic compounds in plant biomass hydrolysates and i...

  12. Novel feruloyl esterase from Lactobacillus fermentum NRRL B-1932 and analysis of the recombinant enzyme produced in Escherichia coli.

    Science.gov (United States)

    Using agar plates containing ethyl ferulate as the sole carbon source, 33 Lactobacillus strains were screened for feruloyl esterase (FE) activity. Among a dozen species showing a clearing zone on the opaque plate containing ethyl ferulate, Lactobacillus fermentum NRRL B-1932 demonstrated the stronge...

  13. Description of Kuraishia piskuri f.a., sp. nov., a new methanol assimilating yeast and transfer of phylogenetically related Candida species to the genera Kuraishia and Nakazawaea as new combinations

    Science.gov (United States)

    The new anamorphic yeast Kuraishia piskuri, f.a., sp. nov. is described for three strains that were isolated from insect frass from trees growing in Florida, USA (type strain, NRRL YB-2544, CBS 13714). Species placement was based on phylogenetic analysis of nuclear gene sequences for the D1/D2 domai...

  14. Evaluation of biobutanol production by Clostridium beijerinckii NRRL B-592 using sweet sorghum as carbon source

    Directory of Open Access Journals (Sweden)

    Luiz Jardel Visioli

    2015-09-01

    Full Text Available In this research it was evaluated the production of biobutanol by Clostridium beijerinckiiNRRL B-592 using sweet sorghum juice as carbon source. Operational variables, like pH and initial inoculum size, as well as supplementation of industrial media with yeast extract and tryptone, were evaluated. The maximum butanol obtained was 2.12g kg-1 using 12.5% of inoculum size, 0.05g 100mL-1 of tryptone and 0.1g 100mL-1 of yeast extract and initial pH of 5.5. The main contribution of this research was to show a systematic procedure for development of a low cost industrial media for biobutanol production from sweet sorghum.

  15. New product identification in the sterol metabolism by an industrial strain Mycobacterium neoaurum NRRL B-3805.

    Science.gov (United States)

    Li, Xuemei; Chen, Xi; Wang, Yu; Yao, Peiyuan; Zhang, Rui; Feng, Jinhui; Wu, Qiaqing; Zhu, Dunming; Ma, Yanhe

    2018-04-01

    Mycobacterium neoaurum NRRL B-3805 metabolizes sterols to produce androst-4-en-3,17-dione (AD) as the main product, and androsta-1,4-dien-3,17-dione, 9α-hydroxy androst-4-en-3,17-dione and 22-hydroxy-23,24-bisnorchol-4-en-3-one have been identified as by-products. In this study, a new by-product was isolated from the metabolites of sterols and identified as methyl 3-oxo-23,24-bisnorchol-4-en-22-oate (BNC methyl ester), which was proposed to be produced via the esterification of BNC catalyzed by an O-methyltransferase using S-adenosyl-l-methionine as the methyl group donor. These results might open a new dimension for improvement of the efficiency of microbial AD production by eliminating this by-product via genetic manipulation of the strain. Copyright © 2018 Elsevier Inc. All rights reserved.

  16. Biotransformation of soy flour isoflavones by Aspergillus niger NRRL 3122 β-glucosidase enzyme.

    Science.gov (United States)

    Abdella, Asmaa; El-Baz, Ashraf F; Ibrahim, Ibrahim A; Mahrous, Emad Eldin; Yang, Shang-Tian

    2017-12-11

    β-glucosidase enzyme produced from Aspergillus niger NRRL 3122 has been partially purified and characterised. Its molecular weight was 180 KDa. The optimal pH and temperature were 3.98 and 55 °C, respectively. It promoted the hydrolysis of soy flour isoflavone glycosides to their aglycone. Two-level Plackett-Burman design was applied and effective variables for genistein production were determined. Reaction time had a significant positive effect, and pH had a significant negative effect. They were further evaluated using Box-Behnken model. Accordingly, the optimal combination of the major reaction affecting factors was reaction time, 5 h and pH, 4. The concentration of genistein increased by 11.73 folds using this optimal combination. The antioxidant activity of the non-biotransformed and biotransformed soy flour extracts was determined by DPPH method. It was found that biotransformation increased the antioxidant activity by four folds.

  17. Geotrichum bryndzae sp. nov., a novel asexual arthroconidial yeast species related to the genus Galactomyces.

    Science.gov (United States)

    Sulo, Pavol; Laurencík, Michal; Poláková, Silvia; Minárik, Gabriel; Sláviková, Elena

    2009-09-01

    Ten strains of an asexual arthroconidial yeast species were isolated from Bryndza, a traditional Slovak artisanal sheep cheese, which was manufactured from raw milk during a 4-month summer production period at two Slovakian sites (the northern RuZomberok and the central-southern Tisovec areas). Sequence comparison of the D1/D2 domains of the large-subunit rRNA gene revealed that this yeast represents a novel species of the genus Geotrichum, which contains anamorphs of the ascogenous genus Galactomyces, for which the name Geotrichum bryndzae sp. nov. is proposed (type culture CCY 16-2-1T=NRRL Y-48450T=CBS 11176T). The novel species is most closely related to Geotrichum silvicola NRRL Y-27641T, although yeasts with identical or very similar sequences have been found throughout the world.

  18. New structural insights into the oligosaccharide phosphate fraction of Pichia (Hansenula) holstii NRRL Y2448 phosphomannan.

    Science.gov (United States)

    Handley, Paul N; Carroll, Anthony; Ferro, Vito

    2017-06-29

    The oligosaccharide phosphate fraction (OPF) obtained from mild acid hydrolysis of P. holstii NRRL Y-2448 phosphomannan is the starting material for the preparation of the Phase III anticancer drug candidate PI-88. The OPF was for the first time successfully separated by preparative ion exchange chromatography and the major oligosaccharides isolated and characterized by NMR spectroscopy. The components were also acetylated and subjected to LC-MS analysis. These studies revealed that the OPF also contained all-α(1 → 3)-linked oligosaccharides in addition to the known α(1 → 3)/(1 → 2)-linked species, most likely formed by hydrolysis of the latter. Contrary to previous assumptions, the only phosphorylated disaccharide present is α(1 → 3)-linked. In addition, it was determined that a glycosylamine derivative previously isolated is, in fact, a manufacturing byproduct formed from exposure to aqueous ammonium bicarbonate during chromatographic purification. Based on these findings a new generic structure for PI-88 is proposed which more accurately reflects its composition. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Castor oil as secondary carbon source for production of sophorolipids using Starmerella bombicola NRRL Y-17069.

    Science.gov (United States)

    Bajaj, Vinit Kamalkishor; Annapure, Uday S

    2015-01-01

    Sophorolipids (SLs), a prominent member of the biosurfactants family are produced in acidic and/or lactonic form by yeast Starmerella bombicola NRRL Y-17069 when grown on hydrophilic or hydrophobic or both carbon sources. In current study, ricinoleic acid rich castor oil (10%) was used as hydrophobic and glycerol (10%) was used as hydrophilic carbon source. The yields of 24.5 ± 0.25 g/l sophorolipids were analyzed by anthrone and HPLC method which further increased upto 40.24 ± 0.76 g/l sophorolipids using fed batch process at 5L fermenter level. The structures of sophorolipids synthesized on castor oil were elucidated by liquid chromatography-mass spectrometer (LC-MS), (13)C and (1)H NMR. The results indicated that the ricinoleic acid (RA) gets hydroxylated at ω-1 position but incorporated into sophorolipids through already available hydroxyl group at 12(th) position. It resulted in the production of a novel sophorolipids with hydroxyl fatty acid as side chain and has applications as surfactant for novel drug delivery, anti microbial agent, cosmetic ingredient and emulsifier.

  20. Microencapsulation of alginate-immobilized bagasse with Lactobacillus rhamnosus NRRL 442: enhancement of survivability and thermotolerance.

    Science.gov (United States)

    Shaharuddin, Shahrulzaman; Muhamad, Ida Idayu

    2015-03-30

    The aim of this research was to enhance the survivability of Lactobacillus rhamnosus NRRL 442 against heat exposure via a combination of immobilization and microencapsulation processes using sugarcane bagasse (SB) and sodium alginate (NaA), respectively. The microcapsules were synthesized using different alginate concentration of 1, 2 and 3% and NaA:SB ratio of 1:0, 1:1 and 1:1.5. This beneficial step of probiotic immobilization before microencapsulation significantly enhanced microencapsulation efficiency and cell survivability after heat exposure of 90°C for 30s. Interestingly, the microcapsule of SB-immobilized probiotic could obtain protection from heat using microencapsulation of NaA concentration as low as 1%. SEM images illustrated the incorporation of immobilized L. rhamnosus within alginate matrices and its changes after heat exposure. FTIR spectra confirmed the change in functional bonding in the presence of sugarcane bagasse, probiotic and alginate. The results demonstrated a great potential in the synthesis of heat resistant microcapsules for probiotic. Copyright © 2014 Elsevier Ltd. All rights reserved.

  1. Adsorption of amyloglucosidase from Aspergillus niger NRRL 3122 using ion exchange resin

    Directory of Open Access Journals (Sweden)

    Ana Paula Manera

    2008-10-01

    Full Text Available Amyloglucosidase enzyme was produced by Aspergillus niger NRRL 3122 from solid-state fermentation, using deffated rice bran as substrate. The effects of process parameters (pH, temperature in the equilibrium partition coefficient for the system amyloglucosidase - resin DEAE-cellulose were investigated, aiming at obtaining the optimum conditions for a subsequent purification process. The highest partition coefficients were obtained using 0.025M Tris-HCl buffer, pH 8.0 and 25ºC. The conditions that supplied the highest partition coefficient were specified, the isotherm that better described the amyloglucosidase process of adsorption obtained. It was observed that the adsorption could be well described by Langmuir equation and the values of Qm and Kd estimated at 133.0 U mL-1 and 15.4 U mL-1, respectively. From the adjustment of the kinetic curves using the fourth-order Runge-Kutta algorithm, the adsorption (k1 and desorption (k2 constants were obtained through optimization by the least square procedure, and the values calculated were 2.4x10-3 mL U-1 min-1 for k1 and 0.037 min-1 for k2 .A enzima amiloglicosidase foi produzida por Aspergillus niger NRRL 3122 através de fermentação em estado sólido, tendo como substrato farelo de arroz desengordurado. Os efeitos dos parâmetros de processo (pH e temperatura no coeficiente de partição no equilíbrio, para o sistema amiloglicosidase - resina DEAE-celulose foram investigados, com o objetivo de se obter as melhores condições para um posterior processo de purificação. Os maiores coeficientes de partição foram obtidos usando tampão Tris-HCl 0,025M pH 8,0 e 25°C. Determinadas as condições que forneceram o maior coeficiente de partição obteve-se a isoterma que melhor descrevia o processo de adsorção de amiloglicosidase. Foi verificado que adsorção pode ser bem descrita pela equação de Langmuir e os valores de Qm e Kd foram estimados em 133,0 U mL-1 e 15,4 U mL-1 respectivamente. A

  2. Culture nutrition and physiology impact the inhibitor tolerance of the yeast Pichia stipitis NRRL Y-7124.

    Science.gov (United States)

    Slininger, Patricia J; Gorsich, Steven W; Liu, Zonglin L

    2009-02-15

    Pichia stipitis NRRL Y-7124 is one of the natural yeasts best able to utilize biomass because it is able to ferment hexoses and the pentose, xylose, to economically recoverable concentrations of ethanol. To test the impact of culture conditions on inhibitor tolerance, inhibitors were spiked to growing or stationary-phase P. stipitis supplied either glucose or xylose and varying nitrogen and mineral compositions; then the ensuing specific death rate response was measured. Resistance of glucose- or xylose-grown cells to inhibitors was generally greater in stationary-phase cells than log-phase cells, despite a greater exposure of stationary cells to ethanol. Consistent with this, the specific productivity of detoxification products, furan methanol or furan-2,5-dimethanol, from respective spikes of furfural or HMF increased as cultures progressed into stationary phase. However, when xylose was the substrate, ethanol resistance behaved uniquely and was greater for log- than stationary-phase cells. Amino acid enrichment of the growth medium significantly enhanced ethanol tolerance if xylose was the carbon source, but had no impact if glucose supplied carbon. Regardless of the carbon source, amino acid enrichment of the culture medium enhanced the ability of cells to resist furfural and HMF exposure. Mineral compositions tested had little impact on inhibitor resistance except stationary-phase xylose-grown cells were more susceptible to inhibitor exposure when magnesium sulfate was excessive. Observed tolerance optimization based on specific death rate as a function of culture physiological state, carbon source, nitrogen source and mineral composition provides new knowledge supporting process designs to convert biomass to ethanol using P. stipitis.

  3. Factors affecting the production of lactulose by Lactobacillus acidophilus NRRL 4495 β-galactosidase and its biological activity

    Directory of Open Access Journals (Sweden)

    Abou-Romia, R.

    2013-01-01

    Full Text Available Aim: Production of lactulose and other oligosaccharides by Lactobacillus acidophilus NRRL 4495 â-galactosidase andtheir biological activity. Methodology and Results: The transgalactosylation activity of Lactobacillus acidophilus NRRL 4495 B-galactosidase was investigated under different conditions for synthesis of lactulose and oligosaccharides. The synthesis was optimized with respect to pH; time; enzyme concentration and substrates ratio (lactose: fructose. Maximum production forlactulose was found to be 25 g/L at pH 6.6 with 40: 20% (w/v lactose to fructose, respectively and enzyme concentration 4 IU/mL after 7 h. With respect to the other oligosaccharides the maximum yield (19 .68 g/L was obtained under the same conditions but with enzyme concentration 2 IU/mL and after 10 h. As a new pharmaceutical application the produced lactulose and oligosaccharide and their sulfated derivative were found to have fibrinolytic activity, but theyfailed to act as anticoagulant. Conclusion significance and impact of study: the research leads to increase the production of lactulose and other oligosaccharides with a significant yield and discovered a new pharmaceutical application for all the products.

  4. Ogataea falcaomoraisii sp. nov., a sporogenous methylotrophic yeast from tree exudates.

    Science.gov (United States)

    Morais, Paula B; Teixeira, Lia C R S; Bowles, Jane M; Lachance, Marc-André; Rosa, Carlos A

    2004-10-01

    Thirteen strains of a new ascospore-forming, methanol-assimilating yeast species were isolated from sap exudates of Sclerolobium sp. (carvoeiro) in two forest fragments in the state of Toncantins, Brazil, and from Hymenaea courbaril (guapinol, jatobá) in Guanacaste Province, Costa Rica. Analysis of the sequences of the D1/D2 large-subunit ribosomal DNA showed that the species belongs to the genus Ogataea (syn. Pichia), and it was described as Ogataea falcaomoraisii. The closest relatives are Candida ortonii and C. nemodendra. The type culture is UFMG-T264-1T (= CBS 9814T = NRRL Y-27756).

  5. Novel Feruloyl Esterase from Lactobacillus fermentum NRRL B-1932 and Analysis of the Recombinant Enzyme Produced in Escherichia coli.

    Science.gov (United States)

    Liu, Siqing; Bischoff, Kenneth M; Anderson, Amber M; Rich, Joseph O

    2016-09-01

    A total of 33 Lactobacillus strains were screened for feruloyl esterase (FE) activity using agar plates containing ethyl ferulate as the sole carbon source, and Lactobacillus fermentum NRRL B-1932 demonstrated the strongest FE activity among a dozen species showing a clearing zone on the opaque plate containing ethyl ferulate. FE activities were monitored using high-performance liquid chromatography with an acetonitrile-trifluoroacetic acid gradient. To produce sufficient purified FE from L. fermentum strain NRRL B-1932 (LfFE), the cDNA encoding LfFE (Lffae) was amplified and cloned by using available closely related genome sequences and overexpressed in Escherichia coli A 29.6-kDa LfFE protein was detected from the protein extract of E. coli BL21(pLysS) carrying pET28bLffae upon IPTG (isopropyl-β-d-thiogalactopyranoside) induction. The recombinant LfFE containing a polyhistidine tag was purified by nickel-nitrilotriacetic acid affinity resin. The purified LfFE showed strong activities against several artificial substrates, including p-nitrophenyl acetate and 4-methylumbelliferyl p-trimethylammoniocinnamate chloride. The optimum pH and temperature of the recombinant LfFE were around 6.5 and 37°C, respectively, as determined using either crude or purified recombinant LfFE. This study will be essential for the production of the LfFE in E. coli on a larger scale that could not be readily achieved by L. fermentum fermentation. The production of feruloyl esterase (FE) from Lactobacillus fermentum NRRL B-1932 reported in this study will have immense potential commercial applications not only in biofuel production but also in pharmaceutical, polymer, oleo chemical, cosmetic additive, and detergent industries, as well as human health-related applications, including food flavoring, functional foods, probiotic agents, preventive medicine, and animal feed. Given the essential role FE plays in the production of hydroxycinnamic acids and ferulic acid, plus the generally

  6. Enzyme-resistant isomalto-oligosaccharides produced from Leuconostoc mesenteroides NRRL B-1426 dextran hydrolysis for functional food application.

    Science.gov (United States)

    Kothari, Damini; Goyal, Arun

    2016-07-01

    The extracellular dextransucrase from Leuconostoc mesenteroides NRRL B-1426 was produced and purified using polyethylene glycol fractionation. In our earlier study, it was reported that L. mesenteroides dextransucrase synthesizes a high-molecular mass dextran (>2 × 10(6)  Da) with ∼85.5% α-(1→6) linear and ∼14.5% α-(1→3) branched linkages. Isomalto-oligosaccharides (IMOs) were synthesized through depolymerization of dextran by the action of dextranase. The degree of polymerization of IMOs was 2-10 as confirmed by mass spectrometry. The nuclear magnetic resonance spectroscopic analysis revealed the presence of α-(1→3) linkages in the synthesized IMOs. The IMOs were resistant to dextranase, α-glucosidase, and α-amylase, and therefore can have potential application as food additives in the functional foods. © 2015 International Union of Biochemistry and Molecular Biology, Inc.

  7. Geotrichum vulgare sp. nov., a novel asexual arthroconidial yeast.

    Science.gov (United States)

    Wuczkowski, Michael; Bond, Chris; Prillinger, Hansjörg

    2006-01-01

    Two strains of a novel yeast species were isolated from different habitats, from soil in an alluvial zone national park in Austria and from a drain in a Turkish soft drinks factory. Analysis of the nucleotide sequences of the D1/D2 region of their large-subunit rDNAs and PCR fingerprints show that the strains are members of the same species, described as Geotrichum vulgare sp. nov. Analysis of nucleotide sequences showed that this species is related to the ascogenous genus Galactomyces. The closest phylogenetic relative is Geotrichum silvicola, a recently described species. The type strain of Geotrichum vulgare is HA1379T (= CBS 10073T = NRRL Y-27915T).

  8. Study on the Requirement of Nitrogen Sources by Scheffersomyces Stipitis NRRL Y-7124 to Produce Ethanol from Xylose Based-media

    DEFF Research Database (Denmark)

    Mussatto, Solange I.; Carneiro, L. M.; Roberto, I. C.

    This study aimed at evaluating the requirement of nitrogen sources by the yeast Scheffersomyces stipitis NRRL Y-7124 to produce ethanol from xylose based-media. Different nitrogen sources were evaluated, which were used to supplement a defined xylose-based medium and also the hemicellulosic hydro......, suggesting that this hydrolysate contains enough nitrogen source to provide an efficient xylose conversion to ethanol.......This study aimed at evaluating the requirement of nitrogen sources by the yeast Scheffersomyces stipitis NRRL Y-7124 to produce ethanol from xylose based-media. Different nitrogen sources were evaluated, which were used to supplement a defined xylose-based medium and also the hemicellulosic...... hydrolysate produced from rice straw. Interesting results were achieved, which revealed that it is important to add nitrogen sources to the medium to achieve efficient ethanol production by this yeast strain. However, from rice straw hydrolysate medium, the nitrogen supplementation was not necessary...

  9. Mathematical modeling of the effect of temperature on the activity and thermal stability of the inulinase of Kluyveromyces marxianus NRRL Y-7571

    OpenAIRE

    Diestra, Jesús; Margarito, Lucas; Vega, Roberto; Castillo, Augusto

    2015-01-01

    A mathematical model was used in this study to describe the effect of temperature on the activity and thermal stability (non-reactive conditions) of the inulinase of Kluyveromyces marxianus NRRL Y-7571. The model was taken from the literature, which was developed using the Arrhenius equation and experimental data. A first-order kinetic equation was takenfor enzyme inactivation. The model parameters were determined by linear and nonlinear regression, reporting confidence intervals. The experim...

  10. Heterologous gene expression and functional analysis of a type III polyketide synthase from Aspergillus niger NRRL 328

    Energy Technology Data Exchange (ETDEWEB)

    Kirimura, Kohtaro, E-mail: kkohtaro@waseda.jp; Watanabe, Shotaro; Kobayashi, Keiichi

    2016-05-13

    Type III polyketide synthases (PKSs) catalyze the formation of pyrone- and resorcinol-types aromatic polyketides. The genomic analysis of the filamentous fungus Aspergillus niger NRRL 328 revealed that this strain has a putative gene (chr-8-2: 2978617–2979847) encoding a type III PKS, although its functions are unknown. In this study, for functional analysis of this putative type III PKS designated as An-CsyA, cloning and heterologous expression of the An-CsyA gene (An-csyA) in Escherichia coli were performed. Recombinant His-tagged An-CsyA was successfully expressed in E. coli BL21 (DE3), purified by Ni{sup 2+}-affinity chromatography, and used for in vitro assay. Tests on the substrate specificity of the His-tagged An-CsyA with myriad acyl-CoAs as starter substrates and malonyl-CoA as extender substrate showed that His-tagged An-CsyA accepted fatty acyl-CoAs (C2-C14) and produced triketide pyrones (C2-C14), tetraketide pyrones (C2-C10), and pentaketide resorcinols (C10-C14). Furthermore, acetoacetyl-CoA, malonyl-CoA, isobutyryl-CoA, and benzoyl-CoA were also accepted as starter substrates, and both of triketide pyrones and tetraketide pyrones were produced. It is noteworthy that the His-tagged An-CsyA produced polyketides from malonyl-CoA as starter and extender substrates and produced tetraketide pyrones from short-chain fatty acyl-CoAs as starter substrates. Therefore, this is the first report showing the functional properties of An-CsyA different from those of other fungal type III PKSs. -- Highlights: •Type III PKS from Aspergillus niger NRRL 328, An-CsyA, was cloned and characterized. •An-CsyA produced triketide pyrones, tetraketide pyrones and pentaketide resorcinols. •Functional properties of An-CsyA differs from those of other fungal type III PKSs.

  11. Change in colony morphology and kinetics of tylosin production after UV and gamma irradiation mutagenesis of Streptomyces fradiae NRRL-2702.

    Science.gov (United States)

    Khaliq, Shazia; Akhtar, Kalsoom; Afzal Ghauri, Muhammad; Iqbal, Ruqia; Mukhtar Khalid, Ahmad; Muddassar, Muhammad

    2009-01-01

    Tylosin is a macrolide antibiotic used as veterinary drug and growth promoter. Attempts were made for hyper production of tylosin by a strain of Streptomyces fradiae NRRL-2702 through irradiation mutagenesis. Ultraviolet (UV) irradiation of wild-type strain caused development of six morphologically altered colony types on agar plates. After screening using Bacillus subtilis bioassay only morphological mutants indicated the production of tylosin. An increase of 2.7+/-0.22-fold in tylosin production (1500mg/l) in case of mutant UV-2 in complex medium was achieved as compared to wild-type strain (550mg/l). Gamma irradiation of mutant UV-2 using (60)Co gave one morphologically altered colony type gamma-1, which gave 2500mg/l tylosin yield in complex medium. Chemically defined media promoted tylosin production upto 3800mg/l. Maximum value of q(p) (3.34mg/gh) was observed by mutant gamma-1 as compared to wild strain (0.81mg/gh). Moreover, UV irradiation associated changes were unstable with loss of tylosin activity whereas mutant gamma-1 displayed high stability on subsequent culturing.

  12. Improved viability of Lactobacillus acidophilus NRRL-B 4495 during freeze-drying in whey protein-pullulan microcapsules.

    Science.gov (United States)

    Çabuk, Burcu; Harsa, Şebnem Tellioglu

    2015-01-01

    In this research, pullulan was incorporated in protein-based encapsulation matrix in order to assess its cryoprotective effect on the viability of freeze-dried (FD) probiotic Lactobacillus acidophilus NRRL-B 4495. This study demonstrated that pullulan in encapsulation matrix resulted in a 90.4% survival rate as compared to 88.1% for whey protein (WPI) encapsulated cells. The protective effects of pullulan on the survival of FD-encapsulated cells in gastrointestinal conditions were compared. FD WPI-pullulan capsules retained higher survived cell numbers (7.10 log CFU/g) than those of FD WPI capsules (6.03 log CFU/g) after simulated gastric juice exposure. Additionally, use of pullulan resulted in an increased viability after bile exposure. FD-free bacteria exhibited 2.18 log CFU/g reduction, while FD WPI and FD WPI-pullulan encapsulated bacteria showed 0.95 and 0.49 log CFU/g reduction after 24 h exposure to bile solution, respectively. Morphology of the FD microcapsules was visualized by scanning electron microscopy.

  13. Optimisation of media and cultivation conditions for L(+)(S)-lactic acid production by Lactobacillus casei NRRL B-441.

    Science.gov (United States)

    Hujanen, M; Linko, S; Linko, Y Y; Leisola, M

    2001-07-01

    Process variables and concentration of carbon in media were optimised for lactic acid production by Lactobacillus casei NRRL B-441. Lactic acid yield was inversely proportional to initial glucose concentration within the experimental area (80-160 g l(-1)). The highest lactic acid concentration in batch fermentation, 118.6 g l(-1), was obtained with 160 g 1(-1) glucose. The maximum volumetric productivity, 4.4 g 1(-1) h(-1) at 15 h, was achieved at an initial glucose concentration of 100 g l(-1). Similar lactic acid concentrations were reached with a fedbatch approach using growing cells, in which case the fermentation time was much shorter. Statistical experimental design and response surface methodology were used for optimising the process variables. The temperature and pH optima for lactic acid production were 35 degrees C, pH 6.3. Malt sprout extract supplemented with yeast extract (4 g l(-1)) appeared to be an economical alternative to yeast extract alone (22 g l(-1)) although the fermentation time was a little longer. The results demonstrated both the separation of the growth and lactic acid production phases and lactic acid production by non-growing cells without any nutrient supplements. Resting L. casei cells converted 120 g l(-1) glucose to lactic acid with 100% yield and a maximum volumetric productivity of 3.5 g l(-1) h(-1).

  14. Effects of temperature, pH, water activity and CO2 concentration on growth of Rhizopus oligosporus NRRL 2710.

    Science.gov (United States)

    Sparringa, R A; Kendall, M; Westby, A; Owens, J D

    2002-01-01

    To investigate the effects of temperature, pH, water activity (aw) and CO2 concentration on the growth of Rhizopus oligosporus NRRL 2710. Hyphal extension rates from mycelial and spore inocula were measured on media with different aw (approximately 1.0, 0.98 and 0.96) and pH (3.5, 5.5 and 7.5) incubated at 30, 37 or 42 degrees C in atmospheres containing 0.03, 12.5 or 25% (v/v) CO2. The effects of environmental conditions on hyphal extension rate were modelled using surface response methodology. The rate of hyphal extension was very sensitive to pH, exhibiting a pronounced optimum at pH 5.5-5.8. The hyphal extension rate was less sensitive to temperature, aw or CO2, exhibiting maximum rates at 42 degrees C, a(w) approximately 1.0 and 0.03% (v/v) CO2. The fastest hyphal extension rate (1.7 mm h(-1)) was predicted to occur at 42 degrees C, pH 5.85, a(w) approximately 1.0 and 0.03% CO2. The present work is the first to model the simultaneous effects of temperature, pH, aw and CO2 concentration on mould growth. The information relates to tempe fermentation and to possible control of the microflora in Tanzanian cassava heap fermentations.

  15. Amycolatopsis nigrescens sp. nov., an actinomycete isolated from a Roman catacomb.

    Science.gov (United States)

    Groth, Ingrid; Tan, Geok Yuan Annie; González, Juan M; Laiz, Leonila; Carlsohn, Marc René; Schütze, Barbara; Wink, Joachim; Goodfellow, Michael

    2007-03-01

    The taxonomic status of two actinomycetes isolated from the wall of a hypogean Roman catacomb was established based on a polyphasic investigation. The organisms were found to have chemical and morphological markers typical of members of the genus Amycolatopsis. They also shared a range of chemical, molecular and phenotypic markers which served to separate them from representatives of recognized Amycolatopsis species. The new isolates formed a branch in the Amycolatopsis 16S rRNA gene sequence tree with Amycolatopsis minnesotensis NRRL B-24435(T), but this association was not supported by a particularly high bootstrap value or by the product of the maximum-parsimony tree-making algorithm. The organisms were distinguished readily from closely related Amycolatopsis species based on a combination of phenotypic properties and from all Amycolatopsis strains by their characteristic menaquinone profiles, in which tetra-hydrogenated menaquinones with 11 isoprene units predominated. The combined genotypic and phenotypic data indicate that the isolates merit recognition as representing a novel species of the genus Amycolatopsis. The name proposed for this novel species is Amycolatopsis nigrescens sp. nov., with type strain CSC17Ta-90(T) (=HKI 0330(T)=DSM 44992(T)=NRRL B-24473(T)).

  16. Spencermartinsiella europaea gen. nov., sp. nov., a new member of the family Trichomonascaceae.

    Science.gov (United States)

    Péter, Gábor; Dlauchy, Dénes; Tornai-Lehoczki, Judit; Suzuki, Motofumi; Kurtzman, Cletus P

    2011-04-01

    Ten strains of a novel heterothallic yeast species were isolated from rotten wood collected at different locations in Hungary. Analysis of gene sequences for the D1/D2 domain of the large subunit rRNA, as well as analysis of concatenated gene sequences for the nearly complete nuclear large subunit rRNA, nuclear small subunit rRNA and translation elongation factor 1-α, placed the novel species in the family Trichomonascaceae, but showed that it was distinct from all currently recognized genera. The name Spencermartinsiella europaea gen. nov., sp. nov. is proposed to accommodate the new genus and novel species. The novel species could be distinguished from recognized species of neighbouring genera on the basis of standard phenotypic characteristics. The type and isotype strains of Spencermartinsiella europaea are NCAIM Y.01817(T) ( = NRRL Y-48265(T) =  CBS 11730(T)) and NCAIM Y.01819(I) ( = NRRL Y-48266(I) = CBS 11731(I)), respectively.

  17. Diddensiella caesifluorescens gen. nov., sp. nov., a riboflavin-producing yeast species of the family Trichomonascaceae.

    Science.gov (United States)

    Péter, Gábor; Dlauchy, Dénes; Price, Neil P J; Kurtzman, Cletus P

    2012-12-01

    Four strains of a novel heterothallic yeast species were isolated from rotten wood collected in or near the Pilis Mountains in Hungary. The strains produced riboflavin in liquid culture. Analysis of gene sequences for the D1/D2 domains of the LSU nuclear rRNA, as well as analysis of concatenated gene sequences for the D1/D2 nuclear LSU rRNA, mitochondrial SSU rRNA and cytochrome oxidase II placed the novel species in a small clade including only two recognized species, Candida santjacobensis and Candida transvaalensis, in the family Trichomonascaceae. DNA sequence analyses demonstrated that the novel species was distinct from all currently recognized teleomorphic yeast genera. The name Diddensiella caesifluorescens gen nov., sp. nov. is proposed to accommodate the novel genus and species. The new genus proposed here can be recognized only from gene sequence analysis, because the characters of its asexual reproduction and ascospore formation are shared by several members of the genera Trichomonascus, Sugiyamaella and Spencermartinsiella. The type and isotype strains of D. caesifluorescens are NCAIM Y.01949(T) ( = NRRL Y-48781(T) = CBS 12613(T)) and NCAIM Y.01956(I) ( = NRRL Y-48782(I) = CBS 12614(I)), respectively. In view of their close relatedness to D. caesifluorescens, C. santjacobensis and C. transvaalensis are transferred to the genus Diddensiella as new combinations in accordance with changes in the International Code of Nomenclature for algae, fungi and plants.

  18. Screening of agro-industrial wastes for citric acid bioproduction by Aspergillus niger NRRL 2001 through solid state fermentation.

    Science.gov (United States)

    Dhillon, Gurpreet S; Brar, Satinder K; Kaur, Surinder; Verma, Mausam

    2013-05-01

    The citric acid (CA) industry is currently struggling to develop a sustainable and economical process owing to high substrate and energy costs. Increasing interest in the replacement of costly synthetic substrates by renewable waste biomass has fostered research on agro-industrial wastes and screening of raw materials for economical CA production. The food-processing industry generates substantial quantities of waste biomass that could be used as a valuable low-cost fermentation substrate. The present study evaluated the potential of different agro-industrial wastes, namely apple pomace (AP), brewer's spent grain, citrus waste and sphagnum peat moss, as substrates for solid state CA production using Aspergillus niger NRRL 2001. Among the four substrates, AP resulted in highest CA production of 61.06 ± 1.9 g kg(-1) dry substrate (DS) after a 72 h incubation period. Based on the screening studies, AP was selected for optimisation studies through response surface methodology (RSM). Maximum CA production of 312.32 g kg(-1) DS was achieved at 75% (v/w) moisture and 3% (v/w) methanol after a 144 h incubation period. The validation of RSM-optimised parameters in plastic trays resulted in maximum CA production of 364.4 ± 4.50 g kg(-1) DS after a 120 h incubation period. The study demonstrated the potential of AP as a cheap substrate for higher CA production. This study contributes to knowledge about the future application of carbon rich agro-industrial wastes for their value addition to CA. It also offers economic and environmental benefits over traditional ways used to dispose off agro-industrial wastes. © 2012 Society of Chemical Industry.

  19. Efficient Biotransformation of Phytosterols to Dehydroepiandrosterone by Mycobacterium sp.

    Science.gov (United States)

    Zhou, Pei; Fang, Ya-Kun; Yao, Hao-Ke; Li, Hua; Wang, Gang; Liu, Yu-Peng

    2018-04-14

    In this study, a method for the efficient production of dehydroepiandrosterone (DHEA) from phytosterols in a vegetable oil/aqueous two-phase system by Mycobacterium sp. was developed. After the 3-hydroxyl group of phytosterols was protected, they could be converted into DHEA with high yield and productivity by Mycobacterium sp. NRRL B-3683. In a shake flask biotransformation, 15.05 g l -1 of DHEA and a DHEA yield of 85.39% (mol mol -1 ) were attained after 7 days with an initial substrate concentration of 25 g l -1 . When biotransformation was carried out in a 30-l stirred bioreactor with 25 g l -1 substrate, the DHEA concentration and yield was 16.33 g l -1 and 92.65% (mol mol -1 ) after 7 days, respectively. The results of this study suggest that inexpensive phytosterols could be utilized for the efficient production of DHEA.

  20. Gene : CBRC-OGAR-01-1183 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available illus sp. NRRL B-14911] 0.005 24% MSVVGIVPVSVLLENRPQTLWLMSVVGIVPVSVLLENRPQTLWLMSVVVIVPVSVLLENRPQTLWLMSVVVIAPVSVLLENR...PQTLWLMSVVGIVPVSVLLENRPQTLWLMSVVGIVPVSVLLENRPQTLWLMSVVGIVPVSVLLENRPQTLWLMSVVGIVPESVLLENRPQTMLVVSCNRKQLLLLESSPSDQPHFSRCLLKTIFLWAVFIQNRTS ...

  1. Determination of some significant batch culture conditions affecting acetyl-xylan esterase production by Penicillium notatum NRRL-1249

    Directory of Open Access Journals (Sweden)

    Akhtar MN

    2011-05-01

    Full Text Available Abstract Background Acetyl-xylan esterase (AXE, EC 3.1.1.72 hydrolyses acetate group from the linear chain of xylopyranose residues bound by β-1,4-linkage. The enzyme finds commercial applications in bio-bleaching of wood pulp, treating animal feed to increase digestibility, processing food to increase clarification and converting lignocellulosics to feedstock and fuel. In the present study, we report on the production of an extracellular AXE from Penicillium notatum NRRL-1249 by solid state fermentation (SSF. Results Wheat bran at a level of 10 g (with 4 cm bed height was optimized as the basal substrate for AXE production. An increase in enzyme activity was observed when 7.5 ml of mineral salt solution (MSS containing 0.1% KH2PO4, 0.05% KCl, 0.05% MgSO4.7H2O, 0.3% NaNO3, 0.001% FeSO4.2H2O and 0.1% (v/w Tween-80 as an initial moisture content was used. Various nitrogen sources including ammonium sulphate, urea, peptone and yeast extract were compared for enzyme production. Maximal enzyme activity of 760 U/g was accomplished which was found to be highly significant (p ≤ 0.05. A noticeable enhancement in enzyme activity was observed when the process parameters including incubation period (48 h, initial pH (5, 0.2% (w/w urea as nitrogen source and 0.5% (v/w Tween-80 as a stimulator were further optimized using a 2-factorial Plackett-Burman design. Conclusion From the results it is clear that an overall improvement of more than 35% in terms of net enzyme activity was achieved compared to previously reported studies. This is perhaps the first report dealing with the use of P. notatum for AXE production under batch culture SSF. The Plackett-Burman model terms were found highly significant (HS, suggesting the potential commercial utility of the culture used (df = 3, LSD = 0.126.

  2. SP. Pescado

    Directory of Open Access Journals (Sweden)

    Renato Gendre

    2003-12-01

    Full Text Available Nell'occhiello di un articolo dal titolo Il Peru dei de[Jini rosa e de/la grande pioggia si legge: "da una partenza  in aereo al «pescado»  che ti  sfamera."1 Questa parola spagnola, giustamente chiusa tra caporali, a noi pare molto interes­ sante, perche, nonostante l'apparenza, non ha nulla da spartire sotto i1 profilo se­ mantico con l'it. pescato. lnfatti, tutti i piu importanti dizionari della lingua italiana, di ieri e di oggi, etimologici e non 2, registrano  accanto a pescata,  ii lemma pescato, 3 ma lo spiegano come "quantita di pesce catturato nel corso di una battuta o di una stagione di pesca",4 mentre lo sp. pescado  indica i1 "pesce (solo nel senso di: pesGe pescato da mangiare [...]".s

  3. Dam and Dcm methylations prevent gene transfer into Clostridium pasteurianum NRRL B-598: development of methods for electrotransformation, conjugation, and sonoporation.

    Science.gov (United States)

    Kolek, Jan; Sedlar, Karel; Provaznik, Ivo; Patakova, Petra

    2016-01-01

    Butanol is currently one of the most discussed biofuels. Its use provides many benefits in comparison to bio-ethanol, but the price of its fermentative production is still high. Genetic improvements could help solve many problems associated with butanol production during ABE fermentation, such as its toxicity, low concentration achievable in the cultivation medium, the need for a relatively expensive substrate, and many more. Clostridium pasteurianum NRRL B-598 is non-type strain producing butanol, acetone, and a negligible amount of ethanol. Its main benefits are high oxygen tolerance, utilization of a wide range of carbon and nitrogen sources, and the availability of its whole genome sequence. However, there is no established method for the transfer of foreign DNA into this strain; this is the next step necessary for progress in its use for butanol production. We have described functional protocols for conjugation and transformation of the bio-butanol producer C. pasteurianum NRRL B-598 by foreign plasmid DNA. We show that the use of unmethylated plasmid DNA is necessary for efficient transformation or successful conjugation. Genes encoding DNA methylation and those for restriction-modification systems and antibiotic resistance were searched for in the whole genome sequence and their homologies with other clostridial bacteria were determined. Furthermore, activity of described novel type I restriction system was proved experimentally. The described electrotransformation protocol achieved an efficiency 1.2 × 10(2) cfu/μg DNA after step-by-step optimization and an efficiency of 1.6 × 10(2) cfu/μg DNA was achieved by the sonoporation technique using a standard laboratory ultrasound bath. The highest transformation efficiency was achieved using a combination of these approaches; sono/electroporation led to an increase in transformation efficiency, to 5.3 × 10(2) cfu/μg DNA. Both Dam and Dcm methylations are detrimental for transformation of C

  4. Draft genome sequences of six neonatal meningitis-causing escherichia coli isolates (SP-4, SP-5, SP-13, SP-16, SP-46, and SP-65)

    Science.gov (United States)

    Neonatal meningitis Escherichia coli isolates (SP-4, SP-5, SP-13, SP-16, SP-46, and SP-65) were recovered from infants in the Netherlands from 1989 to 1997. Here, we report the draft genome sequences for these six E. coli isolates, which are currently being used to validate food safety processing te...

  5. Streptomyces ziwulingensis sp. nov., isolated from grassland soil.

    Science.gov (United States)

    Lin, Yan Bing; Wang, Xin Ye; Wang, Ting Ting; An, Shao Shan; Shi, Peng; Wei, Ge Hong

    2013-04-01

    A novel actinobacterium, designated strain F22(T), was isolated from grassland soil collected from the Ziwuling area on the Loess Plateau, China. The novel strain was found to have morphological and chemotaxonomic characteristics typical of members of the genus Streptomyces. Phylogenetic analysis based on 16S rRNA gene sequences indicated that strain F22(T) belonged to the genus Streptomyces, being most closely related to Streptomyces resistomycificus NBRC 12814(T) (98.28 % sequence similarity), Streptomyces ciscaucasicus NBRC 12872(T) (98.14 %), Streptomyces chartreusis NBRC 12753(T) (98.14 %) and Streptomyces canus NRRL B-1989(T) (98.14 %). In DNA-DNA hybridizations and comparisons of morphological and phenotypic data, strain F22(T) could be distinguished from all of its closest phylogenetic relatives. Strain F22(T) exhibited antibacterial and antifungal activity, especially against Staphylococcus aureus, Bacillus subtilis and Cylindrocarpon destructans. Based on the DNA-DNA hybridization data and morphological, phenotypic and phylogenetic evidence, strain F22(T) represents a novel species of the genus Streptomyces, for which the name Streptomyces ziwulingensis sp. nov. is proposed. The type strain is F22(T) ( = CCNWFX 0001(T) = JCM 18081(T) = ACCC41875(T)).

  6. Streptomyces halophytocola sp. nov., an endophytic actinomycete isolated from the surface-sterilized stems of a coastal halophyte Tamarix chinensis Lour.

    Science.gov (United States)

    Qin, Sheng; Bian, Guang-Kai; Tamura, Tomohiko; Zhang, Yue-Ji; Zhang, Wen-Di; Cao, Cheng-Liang; Jiang, Ji-Hong

    2013-08-01

    A novel actinomycete, designated KLBMP 1284(T), was isolated from the surface-sterilized stems of a coastal halophyte Tamarix chinensis Lour. collected from the city of Nantong, Jiangsu Province, east China. The strain was found to have morphological and chemotaxonomic characteristics typical of members of the genus Streptomyces. Analysis of the 16S rRNA gene sequence of strain KLBMP 1284(T) revealed that the strain formed a distinct clade within the phylogenetic tree based on 16S rRNA gene sequences and the highest sequence similarity (99.43 %) was to Streptomyces sulphureus NRRL B-1627(T). 16S rRNA gene sequence similarity to other species of the genus Streptomyces was lower than 97 %. Based on DNA-DNA hybridization values and comparison of morphological and phenotypic data, KLBMP 1284(T) could be distinguished from the closest phylogenetically related species, Streptomyces sulphureus NRRL B-1627(T). Thus, based on these data, it is evident that strain KLBMP 1284(T) represents a novel species of the genus Streptomyces, for which the name Streptomyces halophytocola sp. nov. is proposed. The type strain is KLBMP 1284(T) (= KCTC 19890(T) = NBRC 108770(T)).

  7. Characterization of mutations in regulatory genes of Tyl cluster leading to overexpression of tylosin in mutant γ-1 of Streptomyces fradiae NRRL-2702.

    Science.gov (United States)

    Khaliq, Shazia; Ghauri, Muhammad A; Akhtar, Kalsoom

    2014-01-01

    Tylosin is a veterinary antibiotic and is commercially produced using Streptomyces fradiae. Previously, we developed a mutant γ-1 of S. fradiae NRRL-2702 with a 6.87-fold increase in tylosin yield as compared with the wild-type strain through irradiation mutagenesis. The present studies were conducted to explore mutational changes in regulatory genes (TylQ, TylP, TylS, TylR, and TylT) of Tyl cluster that may lead to an enhanced expression of tylosin. Expression analysis by RT-PCR revealed that TylQ was switched off earlier in mutant γ-1 while no change in expression pattern of TylP was observed between the wild-type and mutant γ-1 strains. However, a point mutation with a substitution of T to A was recorded at position 214 in the 420-bp product of TylP from mutant γ-1 that resulted in a change of one amino acid (serine to threonine) at position 72. Moreover, no mutation in the nucleotide sequence of TylS, TylR, and TylT genes was detected.

  8. Production of tylosin in solid-state fermentation by Streptomyces fradiae NRRL-2702 and its gamma-irradiated mutant (gamma-1).

    Science.gov (United States)

    Khaliq, Shazia; Rashid, Nosheen; Akhtar, Kalsoom; Ghauri, Muhammad Afzal

    2009-11-01

    To develop solid-state fermentation system (SSF) for hyper production of tylosin from a mutant gamma-1 of Streptomyces fradiae NRRL-2702 and its parent strain. Various agro-industrial wastes were screened to study their effect on tylosin production in SSF. Wheat bran as solid substrate gave the highest production of 2500 microg of tylosin g(-1) substrate by mutant gamma-1 against parent strain (300 microg tylosin g(-1) substrate). The tylosin yield was further improved to 4500 microg g(-1) substrate [70% moisture, 10% inoculum (v/w), pH 9.2, 30 degrees C, supplemental lactose and sodium glutamate on day 9]. Wild-type strain displayed less production of tylosin (655 microg of tylosin g(-1) substrate) in SSF even after optimization of process parameters. The study has shown that solid-state fermentation system significantly enhanced the tylosin yield by mutant gamma-1. This study proved to be very useful and resulted in 6.87 +/- 0.30-fold increase in tylosin yield by this mutant when compared to that of wild-type strain.

  9. A Novel TetR Family Transcriptional Regulator, CalR3, Negatively Controls Calcimycin Biosynthesis in Streptomyces chartreusis NRRL 3882

    Directory of Open Access Journals (Sweden)

    Lixia Gou

    2017-11-01

    Full Text Available Calcimycin is a unique ionophoric antibiotic that is widely used in biochemical and pharmaceutical applications, but the genetic basis underlying the regulatory mechanisms of calcimycin biosynthesis are unclear. Here, we identified the calR3 gene, which encodes a novel TetR family transcriptional regulator and exerts a negative effect on calcimycin biosynthesis. Disruption of calR3 in Streptomyces chartreusis NRRL 3882 led to significantly increased calcimycin and its intermediate cezomycin. Gene expression analysis showed that the transcription of calR3 and its adjacent calT gene were dramatically enhanced (30- and 171-fold, respectively in GLX26 (ΔcalR3 mutants compared with the wild-type strains. Two CalR3-binding sites within the bidirectional calR3-calT promoter region were identified using a DNase I footprinting assay, indicating that CalR3 directly repressed the transcription of its own gene and the calT gene. In vitro electrophoretic mobility shift assays suggested that both calcimycin and cezomycin can act as CalR3 ligands to induce CalR3 to dissociate from its binding sites. These findings indicate negative feedback for the regulation of CalR3 in calcimycin biosynthesis and suggest that calcimycin production can be improved by manipulating its biosynthetic machinery.

  10. Effect of various surfactants (cationic, anionic and non-ionic) on the growth of Aspergillus parasiticus (NRRL 2999) in relation to aflatoxin production.

    Science.gov (United States)

    Tanuja, Kosuri; Hemalatha, K; Karuna, Rupula; Sashidhar Rao, B

    2010-08-01

    The effect of surfactants (two cationic, one anionic and three non-ionic) at 0.001, 0.01, 0.1 and 1.0 % concentrations on aflatoxin production, ergosterol content and sugar consumption by Aspergillus parasiticus (NRRL 2999) in YES liquid culture medium is reported. At 0.01% concentration, the cationic surfactants, cetyl dimethyl ammonium bromide (CDAB) and dodecyl trimethyl ammonium bromide (DTAB), and the anionic surfactant, sodium dodecyl sulfate (SDS), completely inhibited spore germination, while DTAB also inhibited the production of ergosterol and toxin (p lauryl ether (Brij-35) and ethoxylated p-tert-octylphenol (Triton X-100) delayed the spore germination up to day 5 at all concentrations and inhibited toxin and ergosterol production at 0.001% concentration. The affect was found to be dose-dependent from 0.001% to 1%, for Triton X-100 only. Positive correlation between ergosterol content and toxin production in the presence of different surfactants at various time periods (3, 5, 7, 9 and 12 days) was found. Tween-20 was most effective in inhibiting toxin production on day 7, when aflatoxin production was found to be maximal in control group. Sugar consumption was directly proportional to the ergosterol content, showing a significant correlation with aflatoxin production.

  11. A Novel TetR Family Transcriptional Regulator, CalR3, Negatively Controls Calcimycin Biosynthesis inStreptomyces chartreusisNRRL 3882.

    Science.gov (United States)

    Gou, Lixia; Han, Tiesheng; Wang, Xiaoxia; Ge, Jingxuan; Liu, Wenxiu; Hu, Fen; Wang, Zhijun

    2017-01-01

    Calcimycin is a unique ionophoric antibiotic that is widely used in biochemical and pharmaceutical applications, but the genetic basis underlying the regulatory mechanisms of calcimycin biosynthesis are unclear. Here, we identified the calR3 gene, which encodes a novel TetR family transcriptional regulator and exerts a negative effect on calcimycin biosynthesis. Disruption of calR3 in Streptomyces chartreusis NRRL 3882 led to significantly increased calcimycin and its intermediate cezomycin. Gene expression analysis showed that the transcription of calR3 and its adjacent calT gene were dramatically enhanced (30- and 171-fold, respectively) in GLX26 (Δ calR3 ) mutants compared with the wild-type strains. Two CalR3-binding sites within the bidirectional calR3-calT promoter region were identified using a DNase I footprinting assay, indicating that CalR3 directly repressed the transcription of its own gene and the calT gene. In vitro electrophoretic mobility shift assays suggested that both calcimycin and cezomycin can act as CalR3 ligands to induce CalR3 to dissociate from its binding sites. These findings indicate negative feedback for the regulation of CalR3 in calcimycin biosynthesis and suggest that calcimycin production can be improved by manipulating its biosynthetic machinery.

  12. Assessment of fructooligosaccharides production from sucrose in aqueous and aqueous-organic systems using immobilized inulinase from Kluyveromyces marxianus NRRL Y-7571

    Directory of Open Access Journals (Sweden)

    Fernanda Vaz Alves Risso

    2012-06-01

    Full Text Available This work investigated the fructooligosaccharides (FOS synthesis by immobilized inulinase obtained from Kluyveromyces marxianus NRRL Y-7571 in aqueous and aqueous-organic systems using sucrose as substrate. The sequential strategy of experimental design was used to optimize the FOS conversion in both systems. For the aqueous-organic system, a 2(6-2 fractional design was carried out to evaluate the effects of temperature, sucrose concentration, pH, aqueous/organic ratio, enzyme activity, and polyethylene glycol concentration. For the aqueous system, a central composite design for the enzyme activity and the sucrose concentration was carried out. The highest fructooligosaccharides yield (Y FOS for the aqueous-organic system was 18.2 ± S0.9 wt%, at 40 ºC, pH 5.0, sucrose concentration of 60% (w/w, enzyme activity of 4 U.mL-1, and aqueous/organic ratio of 25/75 wt%. The highest Y FOS for the aqueous system was 14.6 ± 0.9 wt% at 40 ºC, pH 5.0, sucrose concentration of 60 wt%, and enzyme activity of 4.0 U.mL-1.

  13. Producción de ácido cítrico con Aspergillus niger NRRL 2270 a partir de suero de leche

    Directory of Open Access Journals (Sweden)

    CARLOS ANDRÉS LÓPEZ RÍOS

    2006-01-01

    Full Text Available Con el fin de aprovechar el subproducto de la fabricación de queso blanco, se evaluó el suero de leche como sustrato para la producción de ácido cítrico utilizando Aspergillus niger NRRL 2270. Para este sustrato se comparó la hidrólisis ácida y enzimática de la lactosa con el fin de proporcionar al microorganismo una fuente de carbono más asimilable. En el suero entero (SE y desproteinizado e hidrolizado (SDH, se estudió el efecto del pH y la adición de nitrógeno, además en el suero hidrolizado (SH la complementación con sacarosa; posteriormente se estudió la adición de nitrógeno y fósforo en el SE y SDH; se determinó la producción de ácido cítrico al agregar magnesio, carboximetil celulosa (CMC, gelatina y metanol al SE. El proceso fermentativo se realizó en cultivo sumergido discontinuo agitado y a las mejores condiciones nutricionales se hizo un seguimiento de las variables del proceso en el tiempo.

  14. Continuous production of 1,3-propanediol using raw glycerol with immobilized Clostridium beijerinckii NRRL B-593 in comparison to suspended culture.

    Science.gov (United States)

    Gungormusler, Mine; Gonen, Cagdas; Azbar, Nuri

    2011-08-01

    The continuous production of 1,3-propanediol (1,3-PDO) was investigated with Clostridium beijerinckii NRRL B-593 using raw glycerol without purification obtained from a biodiesel production process. Ceramic rings and pumice stones were used for cell immobilization in a packed-bed bioreactor. For comparison purpose, a control bioreactor with suspended culture was also run. The effect of hydraulic retention time (HRT) on the production of 1,3-PDO in both immobilized and suspended bioreactors were also investigated. The study revealed that HRT is an important factor for both immobilized and suspended systems and a HRT of 2 h is the best one in terms of volumetric production rate (g 1,3-PDO/L/h). Furthermore, cell immobilization had also obvious benefits especially for the robustness and the reliability of the production. The results indicated that cell immobilization achieved a 2.5-fold higher productivity in comparison to suspended cell system. Based on our results, continuous production of 1,3-PDO with immobilized cells is an efficient method, and raw glycerol can be utilized without any pretreatment.

  15. Acinetobacter lactucae sp. nov., isolated from iceberg lettuce (Asteraceae: Lactuca sativa)

    Science.gov (United States)

    Strain NRRL B-41902 and three closely related strains were isolated from iceberg lettuce. The strain was found to consist of strictly aerobic, gram-negative rods that formed cocci in late stationary phase. Subsequent to sequencing the 16S ribosomal RNA gene, it was found that strain NRRL B-41902 was...

  16. ExaSP2

    Energy Technology Data Exchange (ETDEWEB)

    2017-09-08

    ExaSP2 is a reference implementation of typical linear algebra algorithms and workloads for a quantum molecular dynamics (QMD) electronic structure code. The algorithm is based on a recursive second-order Fermi-Operator expansion method (SP2) and is tailored for density functional based tight-binding calculations of material systems.

  17. Irradiation of Yarrowia lipolytica NRRL YB-567 creating novel strains with enhanced ammonia and oil production on protein and carbohydrate substrates.

    Science.gov (United States)

    Lindquist, Mitch R; López-Núñez, Juan Carlos; Jones, Marjorie A; Cox, Elby J; Pinkelman, Rebecca J; Bang, Sookie S; Moser, Bryan R; Jackson, Michael A; Iten, Loren B; Kurtzman, Cletus P; Bischoff, Kenneth M; Liu, Siqing; Qureshi, Nasib; Tasaki, Kenneth; Rich, Joseph O; Cotta, Michael A; Saha, Badal C; Hughes, Stephen R

    2015-11-01

    Increased interest in sustainable production of renewable diesel and other valuable bioproducts is redoubling efforts to improve economic feasibility of microbial-based oil production. Yarrowia lipolytica is capable of employing a wide variety of substrates to produce oil and valuable co-products. We irradiated Y. lipolytica NRRL YB-567 with UV-C to enhance ammonia (for fertilizer) and lipid (for biodiesel) production on low-cost protein and carbohydrate substrates. The resulting strains were screened for ammonia and oil production using color intensity of indicators on plate assays. Seven mutant strains were selected (based on ammonia assay) and further evaluated for growth rate, ammonia and oil production, soluble protein content, and morphology when grown on liver infusion medium (without sugars), and for growth on various substrates. Strains were identified among these mutants that had a faster doubling time, produced higher maximum ammonia levels (enzyme assay) and more oil (Sudan Black assay), and had higher maximum soluble protein levels (Bradford assay) than wild type. When grown on plates with substrates of interest, all mutant strains showed similar results aerobically to wild-type strain. The mutant strain with the highest oil production and the fastest doubling time was evaluated on coffee waste medium. On this medium, the strain produced 0.12 g/L ammonia and 0.20 g/L 2-phenylethanol, a valuable fragrance/flavoring, in addition to acylglycerols (oil) containing predominantly C16 and C18 residues. These mutant strains will be investigated further for potential application in commercial biodiesel production.

  18. Pseudomonas donghuensis sp. nov., exhibiting high-yields of siderophore.

    Science.gov (United States)

    Gao, Jingwei; Xie, Guanfang; Peng, Fang; Xie, Zhixiong

    2015-01-01

    A strain giving high-yields of siderophores, designated HYS(T), was isolated from the water of East Lake (also called Donghu Lake) of Wuhan in China. Strain HYS(T) is Gram-stain negative, non-spore-forming and rod-shaped with polar flagella. Phylogenetic analysis based on 16S rRNA gene and the other three housekeeping genes (gyrB, rpoD and rpoB) indicated that strain HYS(T) belongs to the genus Pseudomonas. Genomic DNA comparison experiments including DNA-DNA hybridization and whole-genome sequence similarities were performed between HYS(T) and its phylogenetically most closely related type strains, all of the relatedness values are lower than the threshold to ascribe strain HYS(T) to a known species. The major cellular fatty acids of strain HYS(T) are C16:0, C17:0 cyclo, Summed feature 3 (C16:1 ω7c or/and C16:1 ω6c) and Summed feature 8 (C18:1 ω7c or C18:1 ω6c). Its predominant isoprenoid quinone was identified as Q-9, and the minor isoprenoid quinone was Q-8. Phylogenetic analysis together with genomic DNA comparison, phenotypic metabolic tests and chemotaxonomic analysis justified the proposal of strain HYS(T) as a representative of a novel species, for which the name Pseudomonas donghuensis sp. nov. is proposed. The type strain is HYS(T) ( = CCTCC AB 2012141(T) = NRRL B-59108(T)).

  19. Terrimonas arctica sp. nov., isolated from Arctic tundra soil.

    Science.gov (United States)

    Jiang, Fan; Qiu, Xia; Chang, Xulu; Qu, Zhihao; Ren, Lvzhi; Kan, Wenjing; Guo, Youhao; Fang, Chengxiang; Peng, Fang

    2014-11-01

    A novel, Gram-stain-negative, aerobic, non-motile and rod-shaped bacterium, designated R9-86(T), was isolated from tundra soil collected near Ny-Ålesund, Svalbard Archipelago, Norway (78° N). Growth occurred at 4-28 °C (optimum, 22-25 °C) and at pH 6.0-9.0 (optimum, pH 7.0). Flexirubin-type pigments were absent. Phylogenetic analysis based on 16S rRNA gene sequences indicated that strain R9-86(T) belonged to the genus Terrimonas in the family Chitinophagaceae. 16S rRNA gene sequence similarities between strain R9-86(T) and the type strains of species of the genus Terrimonas with validly published names ranged from 93.7 to 95.0%. Strain R9-86(T) contained iso-C(15:1)-G (25.7%), iso-C(15:0) (24.5%), iso-C(17:0)-3OH (18.3%) and summed feature 3 (C(16:1)ω7c and/or C(16:1)ω6c, 8.7%) as its major cellular fatty acids; phosphatidylethanolamine and an unknown polar lipid as its main polar lipids, and MK-7 as its predominant respiratory quinone. The DNA G+C content was 48.4 mol%. On the basis of phenotypic, chemotaxonomic and phylogenetic data, strain R9-86(T) is considered to represent a novel species of the genus Terrimonas, for which the name Terrimonas arctica sp. nov. is proposed. The type strain is R9-86(T) ( =CCTCC AB 2011004(T) =NRRL B-59114(T)). © 2014 IUMS.

  20. Fuzzy SP-irresolute functions

    International Nuclear Information System (INIS)

    Abbas, S.E.

    2004-01-01

    In this paper, fuzzy SP-irresolute, fuzzy SP-irresolute open and fuzzy SP-irresolute closed functions between fuzzy topological spaces in Sostak sense are defined. Their properties and the relationships between these functions and other functions introduced previously are investigated. Next fuzzy SP-connectedness is introduced and studied with the help of r-fuzzy strongly preopen sets

  1. PRODUCCIÓN DE ÁCIDO LÁCTICO POR FERMENTACIÓN DE MUCÍLAGO DE CAFÉ CON LACTOBACILLUS BULGARICUS NRRL-B548

    Directory of Open Access Journals (Sweden)

    MARIO ARIAS ZABALA

    2009-01-01

    Full Text Available Se estudió la producción de ácido láctico (AL por hidrólisis y fermentación simultánea de mucílago de café con Lactobacillus bulgaricus NRRL-B548 en matraces de 500 ml, conteniendo 400 ml de medio, agitados a 110 rpm. El pH del medio fue controlado manualmente entre 5.6 y 6.0 por adición de NaOH 5M cada 2 horas. La temperatura fue mantenida en 45°C. El volumen de inóculo fue de 10% del volumen de trabajo. Con miras a optimizar la productividad (P del AL se ensayaron tres valores de concentración de inóculo (5, 10 y 15 g/l y tres de concentración inicial de azúcares reductores totales (ART (27, 35 y 60 g/l. La mayor concentración final de AL fue 41 g/l, obtenida con un inóculo de 10 g/l y una concentración inicial de ART de 60 g/l. La máxima productividad fue 1.44 g/l-h, a las 25 horas de fermentación, y se obtuvo con un inóculo de 10 g/l y una concentración inicial de ART de 60 g/l. Con estas mismas condiciones se obtuvo la máxima productividad al final del proceso (30 h de 1.39 g/l-h. El coeficiente de rendimiento máximo (YPS, calculado a las 30 horas de fermentación, fue de 1.67 g/g, correspondiente a un inóculo de 15 g/l y una concentración inicial de ART de 60 g/l.

  2. Description of Kribbella italica sp. nov., isolated from a Roman catacomb.

    Science.gov (United States)

    Everest, Gareth J; Curtis, Sarah M; De Leo, Filomena; Urzì, Clara; Meyers, Paul R

    2015-02-01

    A novel actinobacterium, strain BC637(T), was isolated from a biodeteriogenic biofilm sample collected in 2009 in the Saint Callixstus Roman catacomb. The strain was found to belong to the genus Kribbella by analysis of the 16S rRNA gene. Phylogenetic analysis using the 16S rRNA gene and the gyrB, rpoB, relA, recA and atpD concatenated gene sequences showed that strain BC637(T) was most closely related to the type strains of Kribbella lupini and Kribbella endophytica. DNA-DNA hybridization experiments confirmed that strain BC637(T) is a genomic species that is distinct from its closest phylogenetic relatives, K. endophytica DSM 23718(T) (63 % DNA relatedness) and K. lupini LU14(T) (63 % DNA relatedness). Physiological comparisons showed that strain BC637(T) is phenotypically distinct from the type strains of K. endophytica and K. lupini. Thus, strain BC637(T) represents the type strain of a novel species, for which the name Kribella italica sp. nov. is proposed ( = DSM 28967(T) = NRRL B-59155(T)). © 2015 IUMS.

  3. Kribbella albertanoniae sp. nov., isolated from a Roman catacomb, and emended description of the genus Kribbella.

    Science.gov (United States)

    Everest, Gareth J; Curtis, Sarah M; De Leo, Filomena; Urzì, Clara; Meyers, Paul R

    2013-10-01

    A novel actinobacterium, strain BC640(T), was isolated from a biofilm sample collected in 2009 in the Saint Callistus Roman catacombs. Analysis of the 16S rRNA gene sequence showed that the strain belonged to the genus Kribbella. Phylogenetic analysis using the 16S rRNA gene and concatenated gyrB, rpoB, relA, recA and atpD gene sequences showed that strain BC640(T) was most closely related to the type strains of Kribbella yunnanensis and Kribbella sandramycini. Based on gyrB genetic distance analysis, strain BC640(T) was shown to be distinct from all Kribbella type strains. DNA-DNA hybridization experiments confirmed that strain BC640(T) represents a genomic species distinct from its closest phylogenetic relatives, K. yunnanensis DSM 15499(T) (53.5±7.8 % DNA relatedness) and K. sandramycini DSM 15626(T) (33.5±5.0 %). Physiological comparisons further showed that strain BC640(T) is phenotypically distinct from the type strains of K. yunnanensis and K. sandramycini. Strain BC640(T) ( = DSM 26744(T) = NRRL B-24917(T)) is thus presented as the type strain of a novel species, for which the name Kribbella albertanoniae sp. nov. is proposed.

  4. Chromobacterium sphagni sp. nov., an insecticidal bacterium isolated from Sphagnum bogs.

    Science.gov (United States)

    Blackburn, Michael B; Farrar, Robert R; Sparks, Michael E; Kuhar, Daniel; Mitchell, Ashaki; Gundersen-Rindal, Dawn E

    2017-09-01

    Sixteen isolates of Gram-reaction-negative, motile, violet-pigmented bacteria were isolated from Sphagnum bogs in West Virginia and Maine, USA. 16S rRNA gene sequences and fatty acid analysis revealed a high degree of relatedness among the isolates, and genome sequencing of two isolates, IIBBL 14B-1T and IIBBL 37-2 (from West Virginia and Maine, respectively), revealed highly similar genomic sequences. The average nucleotide identity (gANI) calculated for these two isolates was found to be in excess of 99 %, but did not exceed 88 % when comparing either isolate with genomic sequences of Chromobacterium violaceum ATCC 12472T, C. haemolyticum DSM 19808T, C. piscinae ND17, C. subtsugae PRAA4-1T, C. vaccinii MWU205T or C. amazonense CBMAI 310T. Collectively, gANI and 16S rRNA gene sequence comparisons suggested that isolates IIBBL 14B-1T and IIBBL 37-2 were most closely related to C. subtsugae, but represented a distinct species. We propose the name Chromobacterium sphagni sp. nov. for this taxon; the type strain is IIBBL 14B-1T (=NRRL B-67130T=JCM 31882T).

  5. Streptomyces atlanticus sp. nov., a novel actinomycete isolated from marine sponge Aplysina fulva (Pallas, 1766).

    Science.gov (United States)

    Silva, Fábio Sérgio Paulino; Souza, Danilo Tosta; Zucchi, Tiago Domingues; Pansa, Camila Cristiane; de Figueiredo Vasconcellos, Rafael Leandro; Crevelin, Eduardo José; de Moraes, Luiz Alberto Beraldo; Melo, Itamar Soares

    2016-11-01

    The taxonomic position of a novel marine actinomycete isolated from a marine sponge, Aplysina fulva, which had been collected in the Archipelago of Saint Peter and Saint Paul (Equatorial Atlantic Ocean), was determined by using a polyphasic approach. The organism showed a combination of morphological and chemotaxonomic characteristics consistent with its classification in the genus Streptomyces and forms a distinct branch within the Streptomyces somaliensis 16S rRNA gene tree subclade. It is closely related to Streptomyces violascens ISP 5183 T (97.27 % 16S rRNA gene sequence similarity) and Streptomyces hydrogenans NBRC 13475 T (97.15 % 16S rRNA gene sequence similarity). The 16S rRNA gene similarities between the isolate and the remaining members of the subclade are lower than 96.77 %. The organism can be distinguished readily from other members of the S. violacens subclade using a combination of phenotypic properties. On the basis of these results, it is proposed that isolate 103 T (=NRRL B-65309 T  = CMAA 1378 T ) merits recognition as the type strain of a new Streptomyces species, namely Streptomyces atlanticus sp. nov.

  6. Pseudomonas aestus sp. nov., a plant growth-promoting bacterium isolated from mangrove sediments.

    Science.gov (United States)

    Vasconcellos, Rafael L F; Santos, Suikinai Nobre; Zucchi, Tiago Domingues; Silva, Fábio Sérgio Paulino; Souza, Danilo Tosta; Melo, Itamar Soares

    2017-10-01

    Strain CMAA 1215 T , a Gram-reaction-negative, aerobic, catalase positive, polarly flagellated, motile, rod-shaped (0.5-0.8 × 1.3-1.9 µm) bacterium, was isolated from mangrove sediments, Cananéia Island, Brazil. Analysis of the 16S rRNA gene sequences showed that strain CMAA 1215 T forms a distinct phyletic line within the Pseudomonas putida subclade, being closely related to P. plecoglossicida ATCC 700383 T , P. monteilii NBRC 103158 T , and P. taiwanensis BCRC 17751 T of sequence similarity of 98.86, 98.73, and 98.71%, respectively. Genomic comparisons of the strain CMAA 1215 T with its closest phylogenetic type strains using average nucleotide index (ANI) and DNA:DNA relatedness approaches revealed 84.3-85.3% and 56.0-63.0%, respectively. A multilocus sequence analysis (MLSA) performed concatenating 16S rRNA, gyrB and rpoB gene sequences from the novel species was related with Pseudomonas putida subcluster and formed a new phylogenetic lineage. The phenotypic, physiological, biochemical, and genetic characteristics support the assignment of CMAA 1215 T to the genus Pseudomonas, representing a novel species. The name Pseudomonas aestus sp.nov. is proposed, with CMAA 1215 T (=NRRL B-653100 T  = CBMAI 1962 T ) as the type strain.

  7. Tsukamurella spongiae sp. nov., a novel actinomycete isolated from a deep-water marine sponge.

    Science.gov (United States)

    Olson, Julie B; Harmody, Dedra K; Bej, Asim K; McCarthy, Peter J

    2007-07-01

    A Gram-positive, rod-shaped, non-spore-forming bacterium (strain K362(T)) was isolated from a deep-water marine sponge collected off the coast of Curaçao in the Netherlands Antilles. On the basis of 16S rRNA gene sequence similarities, strain K362(T) was shown to belong to the genus Tsukamurella, being most closely related to Tsukamurella pulmonis (99.2 %), Tsukamurella tyrosinosolvens (98.9 %), Tsukamurella strandjordii (98.8 %), Tsukamurella pseudospumae (98.8 %) and Tsukamurella spumae (98.8 %). A combination of the substrate utilization patterns, the fatty acid and mycolic acid profiles and the DNA-DNA hybridization results supported the affiliation of strain K362(T) to the genus Tsukamurella and enabled the genotypic and phenotypic differentiation of strain K362(T) from the seven recognized Tsukamurella species. Strain K362(T) therefore represents a novel species of the genus Tsukamurella, for which the name Tsukamurella spongiae sp. nov. is proposed. The type strain is K362(T) (=DSM 44990(T)=NRRL B-24467(T)).

  8. Streptomyces iconiensis sp. nov. and Streptomyces smyrnaeus sp. nov., two halotolerant actinomycetes isolated from a salt lake and saltern.

    Science.gov (United States)

    Tatar, Demet; Guven, Kiymet; Spröer, Cathrin; Klenk, Hans-Peter; Sahin, Nevzat

    2014-09-01

    The taxonomic positions of two novel actinomycetes, designated strains BNT558(T) and SM3501(T), were established by using a polyphasic approach. The organisms had chemical and morphological features that were consistent with their classification in the genus Streptomyces. The whole-cell hydrolysates of the two strains contained ll-diaminopimelic acid as the diagnostic diamino acid. The predominant menaquinones were MK-9(H6) and MK-9(H8) for strain BNT558(T) and MK-9(H8) and MK-9(H6) for strain SM3501(T). Major fatty acids of the strains were anteiso-C15 : 0, anteiso-C17 : 0 and iso-C16 : 0. The polar lipid profile of strain BNT558(T) contained diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylinositol, one unidentified glycolipid and one unidentified aminophospholipid, while that of strain SM3501(T) consisted of diphosphatidylglycerol, phosphatidylglycerol, phosphatidylinositol, phosphatidylethanolamine, three unidentified atypical aminolipids, one unidentified aminolipid and two unidentified glycolipids. The G+C contents of the genomic DNA were 70.2 and 69.6 mol% for strains BNT558(T) and SM3501(T), respectively. 16S rRNA gene sequence data supported the classification of the isolates in the genus Streptomyces and showed that they formed two distinct branches within the genus. Based on almost-complete 16S rRNA gene sequences, strain BNT558(T) was related most closely to Streptomyces albiaxialis NRRL B-24327(T) and strain SM3501(T) was related most closely to Streptomyces cacaoi subsp. cacaoi NBRC 12748(T). DNA-DNA relatedness between each of the isolates and its closest phylogenetic neighbours showed that they belonged to distinct species. The two isolates were readily distinguished from one another and from the type strains of the other species classified in the genus Streptomyces based on a combination of phenotypic and genotypic properties. Based on the genotypic and phenotypic evidence, strains BNT558(T) and SM3501(T) belong to two

  9. Assessment of fructooligosaccharides production from sucrose in aqueous and aqueous-organic systems using immobilized inulinase from Kluyveromyces marxianus NRRL Y-7571 Avaliação da produção de fruto-oligossacarídeos a partir de sacarose em meio aquoso e orgânico usando inulinase imobilizada de Kluyveromyces marxianus NRRL Y-7571

    Directory of Open Access Journals (Sweden)

    Fernanda Vaz Alves Risso

    2012-06-01

    Full Text Available This work investigated the fructooligosaccharides (FOS synthesis by immobilized inulinase obtained from Kluyveromyces marxianus NRRL Y-7571 in aqueous and aqueous-organic systems using sucrose as substrate. The sequential strategy of experimental design was used to optimize the FOS conversion in both systems. For the aqueous-organic system, a 2(6-2 fractional design was carried out to evaluate the effects of temperature, sucrose concentration, pH, aqueous/organic ratio, enzyme activity, and polyethylene glycol concentration. For the aqueous system, a central composite design for the enzyme activity and the sucrose concentration was carried out. The highest fructooligosaccharides yield (Y FOS for the aqueous-organic system was 18.2 ± S0.9 wt%, at 40 ºC, pH 5.0, sucrose concentration of 60% (w/w, enzyme activity of 4 U.mL-1, and aqueous/organic ratio of 25/75 wt%. The highest Y FOS for the aqueous system was 14.6 ± 0.9 wt% at 40 ºC, pH 5.0, sucrose concentration of 60 wt%, and enzyme activity of 4.0 U.mL-1.Este trabalho teve como objetivo investigar a síntese de fruto-oligossacarídeos (FOS a partir de inulinase imobilizada de Kluyveromyces marxianus NRRL Y-7571, em meio aquoso e orgânico usando sacarose como substrato. A estratégia sequencial de planejamento experimental foi utilizada para otimizar a produção de FOS em ambos os sistemas. Para o meio orgânico, um planejamento fatorial fracionário 2(6-2 foi utilizado, visando avaliar os efeitos principais da temperatura, concentração de sacarose, pH, razão molar água/solvente orgânico, atividade da enzima e concentração de polietilenoglicol. Para o sistema aquoso, um planejamento composto central, tendo como variáveis independentes a atividade da enzima e a concentração de sacarose, foi utilizado. A maior produção de FOS foi obtida no sistema orgânico (18,2 ± 0,9% (m/v, a 40 ºC, pH 5.0, concentração de sacarose de 60% (m/m, atividade enzimática de 4 U.mL-1 e raz

  10. Cryptosporidium sp. in lizards

    Czech Academy of Sciences Publication Activity Database

    Koudela, Břetislav; Modrý, D.

    1998-01-01

    Roč. 45, č. 1 (1998), s. 8 ISSN 1066-5234. [ Cryptosporidium sp. in lazards. 01.01.1998-02.01.1998, Praha] R&D Projects: GA ČR GA508/95/0273; GA AV ČR IPP2020702 Subject RIV: fp - Other Medical Disciplines

  11. Modelación matemática del efecto de la temperatura en la actividad y la estabilidad térmica de la inulinasa de Kluyveromyces marxianus NRRL Y-7571

    OpenAIRE

    Jesús Diestra Balta; Lucas Margarito Aguilar; Roberto Vega Paulino; Augusto Castillo Calderón

    2015-01-01

    Un modelo matemático se utilizó en este estudio para describir el efecto de la temperatura en la actividad y la estabilidad térmica (condiciones no reactivas) de la inulinasa de Kluyveromyces marxianus NRRL Y-7571. El modelo se tomó de la literatura, el cual se desarrolló utilizando la ecuación de Arrhenius y los datos experimentales. Una ecuación cinética de primer orden se asumió para la inactivación enzimática. Los parámetros del modelo se determinaron por regresión lineal y no lineal, rep...

  12. Tsukamurella inchonensis sp. nov.

    Science.gov (United States)

    Yassin, A F; Rainey, F A; Brzezinka, H; Burghardt, J; Lee, H J; Schaal, K P

    1995-07-01

    Chemotaxonomic and genomic 16S ribosomal DNA sequence analyses of two isolates obtained from two different clinical materials clearly delineated a new species of the genus Tsukamurella. This new species can be identified by its 16S ribosomal DNA similarity values, as well as its physiological characteristics. The name Tsukamurella inchonensis sp. nov. is proposed for these isolates, which are represented by strain IMMIB D-771T (= DSM 44067T) (T = type strain). This strain exhibits only 45% DNA relatedness to Tsukamurella paurometabola.

  13. SP-100 surety evaluation

    International Nuclear Information System (INIS)

    1985-06-01

    This report describes surety evaluations conducted during GFY 1985 in support of the General Electric design for a Space Nuclear Power System - SP-100. Those surety evaluations address both safety and safeguards requirements, which are derived from OSNP-1 and supporting documents. The report includes results of neutronics (criticality) calculations performed by Los Alamos. The results have been benchmarked against independent calculations performed by General Electric with different codes. These comparisons show close agreement, and are summarized. Los Alamos has also provided specifications of explosion and fire environments, which have been used in evaluation of the GE SP-100 concept. Following the summary of key results, surety requirements are given and recommendations toward specification of requirements for later SP-100 project phases are presented. A conceptual design summary is presented. To establish a comprehensive background for surety evaluations, a reference mission profile and potential accidents for each phase of the mission are identified. The main body of the report addresses surety of the General Electric Thermoelectric Conversion design. GE has also developed a Stirling Engine concept, and performed comprehensive surety evaluations for it. These evaluations are reported

  14. Control of Branchionus sp. and Amoeba sp. in cultures of Arthrospira sp. Control de Branchionus sp. y Amoeba sp. en cultivos de Arthrospira sp.

    Directory of Open Access Journals (Sweden)

    Carlos Méndez

    2012-09-01

    Full Text Available Cultivation of cyanobacterium Arthrospira sp. has been developed in many countries for the production of proteins, pigments and other compounds. Outdoor mass cultures are often affected by biological contamination, drastically reducing productivity as far as bringing death. This study evaluates the control of Branchionus sp. and Amoeba sp. with two chemical compounds: urea (U and ammonium bicarbonate (AB, in laboratory conditions and outdoor mass culture of Arthrospira sp. The lethal concentration 100 (LC100 at 24 h for Branchionus sp. and Amoeba sp. determined was of 60-80 mg L-1 (U and 100-150 mg L-1 (AB. The average effective inhibition concentration for 50% of the population (IC50 in Arthrospira sp., after 72 h, was 80 mg L-1 (U and 150 mg L-1 (AB. The application of doses of 60 mg L-1 (U or 100 mg L-1 (AB in the outdoor mass culture of this contaminated microalga, completely inhibited grazing and did not affect the growth of Arthrospira sp. but rather promoted rapid recovery of algal density at levels prior to infestation. These compounds provided an economical and effective control of predators in cultures of Arthrospira sp.El cultivo de la cianobacteria Arthrospira sp. ha sido desarrollado en muchos países para la obtención de proteínas, pigmentos y otros compuestos. Cultivo que a nivel industrial se ve afectado frecuentemente por contaminación biológica, reduciendo drásticamente la productividad hasta causar la muerte. Este estudio evalúa el control de Branchionus sp. y de Amoeba sp. con dos compuestos químicos, la urea (U y bicarbonato de amonio (AB en cultivos de Arthrospira sp. La concentración letal 100 (LC100 determinada a las 24 h para Branchionus sp. y Amoeba sp. fue de 60-80 mg L-1 (U y 100-150 mg L-1 (AB. La concentración media de inhibición efectiva, después de 72 h, para el 50% de la población (IC50 en Arthrospira fue de 80 mg L-1 (U y 150 mg L-1 (AB. La aplicación de dosis de 60 mg L-1 (U ó 100 mg L-1 (AB en

  15. Tsukamurella pulmonis sp. nov.

    Science.gov (United States)

    Yassin, A F; Rainey, F A; Brzezinka, H; Burghardt, J; Rifai, M; Seifert, P; Feldmann, K; Schaal, K P

    1996-04-01

    Chemotaxonomic and 16S ribosomal DNA sequence analyses of an isolate from the sputum of a patient with a mycobacterial lung infection clearly delineated a new species of the genus Tsukamurella. This new species can be defined on the basis of genotypic and phenotypic data. The name Tsukamurella pulmonis sp. nov. is proposed for this organism; the type strain is IMMIB D-1321T (= DSM 44142T). This isolate shows 44.2 and 36.2% DNA relatedness to Tsukamurella paurometabola DSM 20162T (T = type strain) and Tsukamurella inchonensis DSM 44067T, respectively.

  16. SACCHAROTHRIX SP. ABH26, A NEW ACTINOBACTERIAL STRAIN FROM ALGERIAN SAHARAN SOIL: ISOLATION, IDENTIFICATION AND ANTIMICROBIAL ACTIVITY

    Directory of Open Access Journals (Sweden)

    Abdelhadi Lahoum

    2015-04-01

    Full Text Available A new strain of actinobacteria, designated ABH26, was isolated from a Saharan soil in the Adrar region (Algeria, by the dilution agar plating method using a chitin-vitamins B medium supplemented with polymyxin and penicillin. The morphological studies showed that this strain represents a member of the Saccharothrix genus. Phylogenetic analysis showed that this strain had 16S rRNA gene sequence similarities ranging from 97.63% (with Saccharothrix violaceirubra NBRC 102064T to 99.86% (with Saccharothrix xinjiangensis NBRC 101911T. Furthermore, strain ABH26 presented a strong activity against mycotoxigenic and phytopathogenic fungi including Aspergillus carbonarius (M333, A. flavus (NRRL 3251, A. westerdijkiae (ATCC 3174, Fusarium oxysporum f. sp. lini (Fol and F. solani (Fsol. Additionally, the strain exhibited an important antimicrobial activity against many strains of the pathogenic yeast Candida albicans (M2, M3 and IPA200 and against methicillin resistant Staphylococcus aureus (MRSA 639c. Thus, four solvents (n-hexane, dichloromethane, ethyl acetate and n-butanol were used for the extraction of produced antibiotic compounds. The highest antimicrobial activities were obtained using the butanolic extract. The thin layer chromatography (TLC method showed two bioactive spots, named HAD1 and HAD2, which were reveled negatively by using chemical revelators (ninhydrin, naphtoresorcinol-sulfuric acid, ferrous iron chloride and formaldehyde-sulfuric. These results indicated the absence of amine group, sugar, hydroxamic acid, phenol and aromatic compound.

  17. Acetobacter intermedius, sp. nov.

    Science.gov (United States)

    Boesch, C; Trcek, J; Sievers, M; Teuber, M

    1998-03-01

    Strains of a new species in the genus Acetobacter, for which we propose the name A. intermedius sp. nov., were isolated and characterized in pure culture from different sources (Kombucha beverage, cider vinegar, spirit vinegar) and different countries (Switzerland, Slovenia). The isolated strains grow in media with 3% acetic acid and 3% ethanol as does A. europaeus, do, however, not require acetic acid for growth. These characteristics phenotypically position A. intermedius between A. europaeus and A. xylinus, DNA-DNA hybridizations of A. intermedius-DNA with DNA of the type strains of Acetobacter europaeus, A. xylinus, A. aceti, A. hansenii, A. liquefaciens, A. methanolicus, A. pasteurianus, A. diazotrophicus, Gluconobacter oxydans and Escherichia coli HB 101 indicated less than 60% DNA similarity. The important features of the new species are described. Acetobacter intermedius strain TF2 (DSM11804) isolated from the liquid phase of a tea fungus beverage (Kombucha) is the type strain.

  18. Tsukamurella tyrosinosolvens sp. nov.

    Science.gov (United States)

    Yassin, A F; Rainey, F A; Burghardt, J; Brzezinka, H; Schmitt, S; Seifert, P; Zimmermann, O; Mauch, H; Gierth, D; Lux, I; Schaal, K P

    1997-07-01

    Chemotaxonomic and 16S ribosomal DNA sequence analyses of four bacterial isolates from blood cultures from patients with cardiac pacemaker implants and sputa of patients with chronic lung infections clearly demonstrated that these bacteria belong to the genus Tsukamurella. DNA-DNA hybridization data, as well as the physiological characteristics of the isolates, indicate that they are closely related and belong to a single species that differs from previously described members of the genus Tsukamurella. The name Tsukamurella tyrosinosolvens sp. nov. is proposed for these isolates, and the new species is represented by strain IMMIB D-1397T (= DSM 44234T). Strain IMMIB D-1397T exhibits 53.4, 53.5, and 54.7% DNA-DNA relatedness to Tsukamurella paurometabola DSM 20162T, Tsukamurella inchonensis DSM 44067T, and Tsukamurella pulmonis DSM 44142T, respectively.

  19. Isolation and partial characterization of antimicrobial compounds from a new strain Streptomyces sp. CN207

    International Nuclear Information System (INIS)

    Slama, Nedra; Lazim, Hadeer; Barkallah, Insaf; Limam, Ferid

    2008-01-01

    A distinct streptomyces strains were isolated from Tunisian soil. the isolate designed CN207, was assigned to the genus streptomyces on the basis of morphological and chemotaxonomic criteria. A 16S rDNA sequence of the isolate was determined. Streptomyces sp CN207 secreted large amount antibiotic against gram positive bacteria, gram negative bacteria, yeast and fungi on his barley (HB) medium. (HB) medium was found to be suitable substrate of the medium for CN207 production. Maximum yield of CN207 product (700 mg/ml) after optimize fermentation process. Bioactive molecules from strain CN207 were extracted with ethyl acetate and analyzed by PTLC using silica gel plates.The separated compounds were visualiszed under UV at 254 nm and the active spots were detected by bioautography on silica gel plates using salmonella thyphimurium NRRL B4420 and Staphylococcus aureus CDC 103 as indicator microorganisms. The crude extract (8.36 g) was fractionated on Sep-pack column (C18 cartridge) and elution was performed using a discontinue gradient of methanol-water. Two active fractions eluted by 20% and 40% of methanol were obtained. The bioactive compounds were separated by preparative high performance liquid chromatography (HPLC) on a C18 reversed phase column and eluted with a linear gradient of acetonitrile -water in presence of 0.1% formic acid. The peaks were collected separately, concentrated and bioassayed against the routine indicator microorganisms. The absorption spectrum of the active molecules was determined with a shimadzu UV-160 a spectrophotometer. Determination of the chemical structure of these compounds on the basis on their IR, COSY and H 1: C13 is in progress

  20. Dehalogenimonas alkenigignens sp. nov., a chlorinated-alkane-dehalogenating bacterium isolated from groundwater.

    Science.gov (United States)

    Bowman, Kimberly S; Nobre, M Fernanda; da Costa, Milton S; Rainey, Fred A; Moe, William M

    2013-04-01

    Two strictly anaerobic bacterial strains, designated IP3-3(T) and SBP-1, were isolated from groundwater contaminated by chlorinated alkanes and alkenes at a Superfund Site located near Baton Rouge, Louisiana (USA). Both strains reductively dehalogenate a variety of polychlorinated aliphatic alkanes, including 1,2-dichloroethane, 1,2-dichloropropane, 1,1,2,2-tetrachloroethane, 1,1,2-trichloroethane and 1,2,3-trichloropropane, when provided with hydrogen as the electron donor. To clarify their taxonomic position, strains IP3-3(T) and SBP-1 were characterized using a polyphasic approach. Both IP3-3(T) and SBP-1 are mesophilic, non-spore-forming, non-motile and Gram-stain-negative. Cells of both strains are irregular cocci with diameters of 0.4-1.1 µm. Both are resistant to ampicillin and vancomycin. The genomic DNA G+C contents of strains IP3-3(T) and SBP-1 are 55.5±0.4 and 56.2±0.2 mol% (HPLC), respectively. Major cellular fatty acids include C18 : 1ω9c, C16 : 0, C14 : 0 and C16 : 1ω9c. 16S rRNA gene sequence based phylogenetic analyses indicated that the strains cluster within the phylum Chloroflexi most closely related to but distinct from the species Dehalogenimonas lykanthroporepellens (96.2 % pairwise similarity) and Dehalococcoides mccartyi (90.6 % pairwise similarity). Physiological and chemotaxonomic traits as well as phylogenetic analysis support the conclusion that these strains represent a novel species within the genus Dehalogenimonas for which the name Dehalogenimonas alkenigignens sp. nov. is proposed. The type strain is IP3-3(T) ( = JCM 17062(T) = NRRL B-59545(T)).

  1. Streptomyces cameroonensis sp. nov., a Geldanamycin Producer That Promotes Theobroma cacao Growth.

    Science.gov (United States)

    Boudjeko, Thaddée; Tchinda, Romaric Armel Mouafo; Zitouni, Mina; Nana, Joëlle Aimée Vera Tchatchou; Lerat, Sylvain; Beaulieu, Carole

    2017-03-31

    The taxonomy of an actinobacterial strain, designated JJY4 T , was established using a polyphasic approach. JJY4 T was isolated from the rhizosphere of Chromolaena odorata in Yaoundé (Cameroon) during a project for the selection of biological control agents. Strain JJY4 T exhibited antimicrobial activities against bacteria, fungi, and oomycetes. Strain JJY4 T also exhibited the traits of plant growth-promoting rhizobacteria such as the solubilization of inorganic phosphate, production of siderophores and indole-3-acetic acid, and 1-aminocyclopropane-1-carboxylate deaminase activity. In planta assays performed on cocoa plantlets confirmed that strain JJY4 T exhibited strong abilities to promote plant growth and protect against Phytophthora megakarya, the main causal agent of cocoa pod rot. The formation of rugose-ornamented spores in spiral spore chains by strain JJY4 T is a typical feature of members found in the Streptomyces violaceusniger clade and, similar to some members of the clade, strain JJY4 T produces geldanamycin. A phylogenetic analysis based on 16S rRNA gene sequences confirmed this classification and suggests that strain JJY4 T be added to the subclade constituted of the type strains Streptomyces malaysiensis DSM 41697 T and Streptomyces samsunensis DSM 42010 T . However, DNA-DNA relatedness and physiological characteristics allowed for the differentiation of strain JJY4 T from its closest phylogenetic relatives. Based on these results, strain JJY4 T (=NRRL B-65369, =NBRC 112705) appears to represent a novel species in the S. violaceusniger clade for which the proposed name is Streptomyces cameroonensis sp. nov.

  2. Marinobacter xestospongiae sp. nov., isolated from the marine sponge Xestospongia testudinaria collected from the Red Sea

    KAUST Repository

    Lee, O. O.

    2011-10-14

    A Gram-negative, catalase- and oxidase-positive, non-sporulating, rod-shaped and slightly halophilic bacterial strain, designated UST090418-1611(T), was isolated from the marina sponge Xestospongia testudinaria collected from the Red Sea coast of Saudi Arabia. Phylogenetic trees based on the 16S rRNA gene sequence placed strain UST090418-1611(T) in the family Alteromonadaceae with the closest relationship to the genus Marinobacter. The 16S rRNA gene sequence similarity between the strain and the type strains of recognized Marinobacter species ranged from 92.9 to 98.3%. Although strain UST090418-1611(T) shared high 16S rRNA gene sequence similarity with Marinobacter mobilis CN46(T), M. zhejiangensis CN74(T) and M. sediminum R65(T) (98.3, 97.4 and 97.3%, respectively), the relatedness of the strain to these three strains in DNA DNA hybridization was only 58, 56 and 33%, respectively, supporting the novelty of the strain. In contrast to most strains in the genus Marinobacter, strain UST090418-1611(T) tolerated only 6% (w/v) NaCl, and optimal growth occurred at 2.0% (w/v) NaCl, pH 7.0-8.0 and 28-36 degrees C. The predominant cellular fatty acids were C-12:0 3-OH, C-16:0, C-12:0 and summed feature 3 (C-16.1 omega 6c and/or C-16:1 omega 7c) The genomic DNA G+C content was 57.1 mol%. Based on the physiological, phylogenetic and chemotaxonomic characteristics presented in this study, we suggest that the strain represents a novel species in the genus Marinobacter, for which the name Marinobacter xestospongiae sp. nov. is proposed, with UST090418-1611(T) (=JCM 17469(T) =NRRL B-59512(T)) as the type strain.

  3. Erythrobacter pelagi sp. nov., a member of the family Erythrobacteraceae isolated from the Red Sea

    KAUST Repository

    Wu, H.-x.

    2011-08-05

    A novel Gram-negative, aerobic, catalase- and oxidase-positive, non-sporulating, non-motile, rod-shaped bacterium, designated strain UST081027-248(T), was isolated from seawater of the Red Sea. Phylogenetic analysis based on 16S rRNA gene sequences showed that strain UST081027-248(T) fell within the genus Erythrobacter. Levels of 16S rRNA gene sequence similarity between the novel strain and the type strains of Erythrobacter species ranged from 95.3% (with Erythrobacter gangjinensis) to 98.2% (with Erythrobacter citreus). However, levels of DNA-DNA relatedness between strain UST081027-248(T) and the type strains of closely related species were below 70%. Optimal growth of the isolate occurred in the presence of 2.0% NaCl, at pH 8.0-9.0 and at 28-36 degrees C. The isolate did not produce bacteriochlorophyll a. The predominant cellular fatty acids were C-17:1 omega 6c, summed feature 8 (C-18:1 omega 6c and/or C-18:1 omega 7c) and C-15:0 2-OH. The genomic DNA G+C content of strain UST081027-248(T) was 60.4 mol%. Phenotypic properties and phylogenetic distinctiveness clearly indicated that strain UST081027-248(T) represents a novel species of the genus Erythrobacter, for which the name Erythrobacter pelagi sp. nov. is proposed. The type strain is UST081027-248(T) (=JCM 17468(T)=NRRL 59511(T)).

  4. Single-step purification and characterization of an extreme halophilic, ethanol tolerant and acidophilic xylanase from Aureobasidium pullulans NRRL Y-2311-1 with application potential in the food industry.

    Science.gov (United States)

    Yegin, Sirma

    2017-04-15

    An extracellular xylanase from Aureobasidium pullulans NRRL Y-2311-1 produced on wheat bran was purified by a single-step chromatographic procedure. The enzyme had a molecular weight of 21.6kDa. The optimum pH and temperature for xylanase activity were 4.0 and 30-50°C, respectively. The enzyme was stable in the pH range of 3.0-8.0. The inactivation energy of the enzyme was calculated as 218kJmol -1 . The xylanase was ethanol tolerant and kept complete activity in the presence of 10% ethanol. Likewise, it retained almost complete activity at a concentration range of 0-20% NaCl. In general, the enzyme was resistant to several metal ions and reagents. Mg 2+ , Zn 2+ , Cu 2+ , K 1+ , EDTA and β-mercaptoethanol resulted in enhanced xylanase activity. The K m and V max values on beechwood xylan were determined to be 19.43mgml -1 and 848.4Uml -1 , respectively. The enzyme exhibits excellent characteristics and could, therefore, be a promising candidate for application in food and bio-industries. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Bradysia sp. em morangueiro Bradysia sp. in strawberry

    Directory of Open Access Journals (Sweden)

    Bernadete Radin

    2009-04-01

    Full Text Available No trabalho, relatam-se os primeiros registros de Bradysia sp. (Insecta: Diptera: Sciaridae em morangueiro (Fragaria x ananassa Duch., cultivado no Município de Eldorado do Sul, RS. O cultivo foi realizado em sacolas com três metros de comprimento, preenchidas com substrato composto de casca de arroz e turfa, dispostas horizontalmente sobre bancadas de madeira, em ambiente protegido. A presença de Bradysia sp. foi observada na segunda quinzena de agosto de 2005. Neste trabalho, estão descritos os sintomas apresentados no morangueiro pela praga, prováveis conseqüências sobre o aparecimento de doenças e uma breve descrição morfológica da Bradysia sp., adulto e fase larval.This paper describes the first record of Bradysia sp. (Insecta; Diptera; Sciaridae in strawberry (Fragaria x ananassa, cultivated in the city of Eldorado do Sul, RS, Brazil. Strawberry was planted in plastic bags filled with a mixture of burnt rice hulls and peat and cultivated in a greenhouse. The presence of Bradysia sp was noticed in the second fortnight of August, 2005. The symptoms in strawberry and the probable consequences in terms of disease arising were described in the present study, as well as the morphological characterization of Bradysia sp. and its illustrations.

  6. SP-100 reactor design

    International Nuclear Information System (INIS)

    Armijo, J.S.; Atwell, J.; Pluta, P.R.; Smith, M.A.; Solorzano, E.R.

    1987-01-01

    The SP-100 space reactor power system is being designed and developed as part of the Ground Engineering System (GES) contract between General Electric Company as the system developer and the Department of Energy. Other key participants in the GES program include Westinghouse Hanford Company (site operator), Los Alamos National Laboratory (fuel development and production), Oak Ridge National Laboratory (materials), and Westinghouse, Advanced Energy Systems Division (shield, HTS equipment). The GES Program includes two major elements. First, the development of a Reference Flight System design at 100 kWe output to the user, and second the validation of the Reference Flight System design by analysis and by testing. Development of key technologies along with component and system testing is an essential part of the validation program. The nuclear subsystem validation includes the design, manufacture, assembly and operational testing of a Ground Reactor Test Assembly. The subject of this paper is the reactor design for the Reference Flight System. The reference flight design is in the preliminary design stage and will evolve over the next year

  7. Penicillium araracuarense sp. nov., Penicillium elleniae sp. nov., Penicillium penarojense sp. nov., Penicillium vanderhammenii sp. nov. and Penicillium wotroi sp. nov., isolated from leaf litter

    DEFF Research Database (Denmark)

    Houbraken, Jos; López-Quintero, Carlos A.; Frisvad, Jens Christian

    2011-01-01

    Several species of the genus Penicillium were isolated during a survey of the mycobiota of leaf litter and soil in Colombian Amazon forest. Five species, Penicillium penarojense sp. nov. (type strain CBS 113178T = IBT 23262T), Penicillium wotroi sp. nov. (type strain CBS 118171T = IBT 23253T......), Penicillium araracuarense sp. nov. (type strain CBS 113149T = IBT 23247T), Penicillium elleniae sp. nov. (type strain CBS 118135T = IBT 23229T) and Penicillium vanderhammenii sp. nov. (type strain CBS 126216T = IBT 23203T) are described here as novel species. Their taxonomic novelty was determined using......, andrastin A, pulvilloric acid, paxillin, paspaline and janthitrem, were commonly produced by these phylogenetically related species. The novel species had a high growth rate on agar media, but could be distinguished from each other by several macro- and microscopical characteristics....

  8. Uji Fitokimia, Kandungan Total Fenol dan Aktivitas Antioksidan Mikroalga Spirulina sp., Chlorella sp., dan Nannochloropsis sp.

    Directory of Open Access Journals (Sweden)

    Diini Fithriani

    2015-12-01

    Full Text Available Penelitian ini bertujuan untuk mengetahui kandungan fitokimia, total fenol, dan aktivitas antioksidan dari mikroalga Spirulina sp., Nannochloropsis sp., dan Chlorella sp. Mikroalga diekstrak dengan ekstraksi tunggal menggunakan etanol. Skrining fitokimia dilakukan secara kualitatif. Analisis total fenol dilakukan secara spektrofotometri dengan metode Folin-Ciocalteu. Analisis antioksidan dilakukan dengan metode 2,2-diphenyl-1-picrylhydrazyl (DPPH dan Ferric Reducing Antioxidant Power (FRAP. Skrining fitokimia menunjukkan keberadaan tanin, flavonoid, steroid, glikosida, dan alkaloid pada ekstrak etanol ketiga jenis mikroalga, sedangkan saponin hanya terdeteksi pada ekstrak etanol Spirulina sp. dan Chlorella sp., adapun triterpenoid tidak terdeteksi pada ekstrak etanol ketiga jenis mikroalga. Hasil penelitian menunjukkan bahwa kandungan total fenol, aktivitas antioksidan (IC50, dan kapasitas antioksidan (FRAP tertinggi diperoleh pada ekstrak etanol Spirulina sp. dengan nilai berturut turut sebesar 0,32 ± 0,025 mg GAE g-1D.W., 518,94 ppm, dan  49,95 ± 2,02 (mmol Fe2+ eq.g-1D.W. Dalam penelitian ini diketahui bahwa kandungan fenol total memiliki korelasi  yang kuat  dengan kapasitas antioksidan metode FRAP (R2= 0,84, dan aktivitas antioksidan metode DPPH (R2= 0,79.

  9. Uji Fitokimia, Kandungan Total Fenol Dan Aktivitas Antioksidan Mikroalga Spirulina Sp., Chlorella Sp., dan Nannochloropsis Sp.

    Directory of Open Access Journals (Sweden)

    Diini Fithriani

    2015-12-01

    Full Text Available Penelitian ini bertujuan untuk mengetahui kandungan fitokimia, total fenol, dan aktivitas antioksidan dari mikroalga Spirulina sp., Nannochloropsis sp., dan Chlorella sp. Mikroalga diekstrak dengan ekstraksi tunggal menggunakan etanol. Skrining fitokimia dilakukan secara kualitatif. Analisis total fenol dilakukan secara spektrofotometri dengan metode Folin-Ciocalteu. Analisis antioksidan dilakukan dengan metode 2,2-diphenyl-1-picrylhydrazyl (DPPH dan Ferric Reducing Antioxidant Power (FRAP. Skrining fitokimia menunjukkan keberadaan tanin, flavonoid, steroid, glikosida, dan alkaloid pada ekstrak etanol ketiga jenis mikroalga, sedangkan saponin hanya terdeteksi pada ekstrak etanol Spirulina sp. dan Chlorella sp., adapun triterpenoid tidak terdeteksi pada ekstrak etanol ketiga jenis mikroalga. Hasil penelitian menunjukkan bahwa kandungan total fenol, aktivitas antioksidan (IC50, dan kapasitas antioksidan (FRAP tertinggi diperoleh pada ekstrak etanol Spirulina sp. dengan nilai berturut turut sebesar 0,32 ± 0,025 mg GAE g-1D.W., 518,94 ppm, dan  49,95 ± 2,02 (mmol Fe2+ eq.g-1D.W. Dalam penelitian ini diketahui bahwa kandungan fenol total memiliki korelasi  yang kuat  dengan kapasitas antioksidan metode FRAP (R2= 0,84, dan aktivitas antioksidan metode DPPH (R2= 0,79.

  10. Modelación matemática del efecto de la temperatura en la actividad y la estabilidad térmica de la inulinasa de Kluyveromyces marxianus NRRL Y-7571

    Directory of Open Access Journals (Sweden)

    Jesús Diestra Balta

    2015-01-01

    Full Text Available Un modelo matemático se utilizó en este estudio para describir el efecto de la temperatura en la actividad y la estabilidad térmica (condiciones no reactivas de la inulinasa de Kluyveromyces marxianus NRRL Y-7571. El modelo se tomó de la literatura, el cual se desarrolló utilizando la ecuación de Arrhenius y los datos experimentales. Una ecuación cinética de primer orden se asumió para la inactivación enzimática. Los parámetros del modelo se determinaron por regresión lineal y no lineal, reportando los intervalos de confianza. Los datos experimentales demostraron que la actividad máxima actuando en sacarosa e inulina se alcanzó a 55 °C y que estas actividades fueron altamente sensibles a temperaturas más altas. Además, la actividad inulolítica fue más estable térmicamente que la de invertasa en el rango de 48 a 60 °C.Utilizando el modelo, la temperatura del proceso para la hidrólisis de sacarosa e inulina se determinó en la intersección de las curvas de la actividad relativa y el tiempo de vida media relativo, resultando 49 °C para ambos procesos. Aunque este modelo se utilizó con referencia a la hidrólisis de la sacarosa e inulina, el enfoque es una herramienta útil que se puede aplicar a otros procesos enzimáticos para la determinación de la temperatura de operación, la que es últimamente determinada por una evaluación económica.

  11. Savagea faecisuis gen. nov., sp. nov., a tylosin- and tetracycline-resistant bacterium isolated from a swine-manure storage pit.

    Science.gov (United States)

    Whitehead, Terence R; Johnson, Crystal N; Patel, Nisha B; Cotta, Michael A; Moore, Edward R B; Lawson, Paul A

    2015-07-01

    A polyphasic taxonomic study using morphological, biochemical, chemotaxonomic and molecular methods was performed on three strains of a Gram-stain positive, non-sporeforming, motile aerobic rod-shaped bacterium resistant to tylosin and tetracycline isolated from a swine-manure storage pit. On the basis of 16S rRNA gene sequence analyses, it was confirmed that these isolates are highly related to each other and form a hitherto unknown lineage within the Planococcaceae. In particular, pairwise analysis of the 16S rRNA gene sequence demonstrated that the novel organism is closely related to members of the genus Sporosarcina (92.8-94.5 %), Pyschrobacillus (93.5-93.9 %) and Paenisporosarcina (93.3-94.5 %). The predominant fatty acids were found to consist of iso-C15:0 and iso-C17:1 ω10c and the G+C mol% was determined to be 41.8. Based on biochemical, chemotaxonomic, and phylogenetic evidence, it is proposed that these novel strains be classified as a novel genus and species, Savagea faecisuis gen nov., sp. nov. The type strain is Con12(T) (=CCUG 63563(T) = NRRL B-59945(T) = NBRC 109956(T)).

  12. Lactobacillus apinorum sp. nov., Lactobacillus mellifer sp. nov., Lactobacillus mellis sp. nov., Lactobacillus melliventris sp. nov., Lactobacillus kimbladii sp. nov., Lactobacillus helsingborgensis sp. nov. and Lactobacillus kullabergensis sp. nov., isolated from the honey stomach of the honeybee Apis mellifera

    Science.gov (United States)

    Alsterfjord, Magnus; Nilson, Bo; Butler, Èile; Vásquez, Alejandra

    2014-01-01

    We previously discovered a symbiotic lactic acid bacterial (LAB) microbiota in the honey stomach of the honeybee Apis mellifera. The microbiota was composed of several phylotypes of Bifidobacterium and Lactobacillus. 16S rRNA gene sequence analyses and phenotypic and genetic characteristics revealed that the phylotypes isolated represent seven novel species. One grouped with Lactobacillus kunkeei and the others belong to the Lactobacillus buchneri and Lactobacillus delbrueckiisubgroups of Lactobacillus. We propose the names Lactobacillus apinorum sp. nov., Lactobacillus mellifer sp. nov., Lactobacillus mellis sp. nov., Lactobacillus melliventris sp. nov., Lactobacillus kimbladii sp. nov., Lactobacillus helsingborgensis sp. nov. and Lactobacillus kullabergensis sp. nov. for these novel species, with the respective type strains being Fhon13NT ( = DSM 26257T = CCUG 63287T), Bin4NT ( = DSM 26254T = CCUG 63291T), Hon2NT ( = DSM 26255T = CCUG 63289T), Hma8NT ( = DSM 26256T = CCUG 63629T), Hma2NT ( = DSM 26263T = CCUG 63633T), Bma5NT ( = DSM 26265T = CCUG 63301T) and Biut2NT ( = DSM 26262T = CCUG 63631T). PMID:24944337

  13. Ecdysteroids from a Zoanthus sp.

    Science.gov (United States)

    Suksamrarn, Apichart; Jankam, Aroon; Tarnchompoo, Bongkoch; Putchakarn, Sumaitt

    2002-08-01

    A new ecdysteroid, zoanthusterone, has been isolated from a marine zoanthid, Zoanthus sp. Ten known ecdysteroids, ponasterone A, 20-hydroxyecdysone 2-acetate, viticosterone E, integristerone A 25-acetate, 2-deoxy-20-hydroxyecdysone, ecdysone, ajugasterone C, dacryhainansterone, inokosterone, and 20-hydroxyecdysone, have also been isolated. This is the first report of ecdysteroids in a Zoanthus species.

  14. Sporulation of Cyclospora sp. oocysts.

    OpenAIRE

    Smith, H V; Paton, C A; Mitambo, M M; Girdwood, R W

    1997-01-01

    Cyclospora sp. oocysts sporulated maximally at 22 and 30 degrees C for 14 days retarded sporulation. Up to 12% of human- and baboon-derived oocysts previously stored at 4 degrees C for 1 to 2 months sporulated when stored for 6 to 7 days at 30 degrees C.

  15. Classification of thermophilic actinobacteria isolated from arid desert soils, including the description of Amycolatopsis deserti sp. nov.

    Science.gov (United States)

    Busarakam, Kanungnid; Brown, Ros; Bull, Alan T; Tan, Geok Yuan Annie; Zucchi, Tiago D; da Silva, Leonardo José; de Souza, Wallace Rafael; Goodfellow, Michael

    2016-02-01

    The taxonomic position of 26 filamentous actinobacteria isolated from a hyper-arid Atacama Desert soil and 2 from an arid Australian composite soil was established using a polyphasic approach. All of the isolates gave the diagnostic amplification product using 16S rRNA oligonucleotide primers specific for the genus Amycolatopsis. Representative isolates had chemotaxonomic and morphological properties typical of members of the genus Amycolatopsis. 16S rRNA gene analyses showed that all of the isolates belong to the Amycolatopsis methanolica 16S rRNA gene clade. The Atacama Desert isolates were assigned to one or other of two recognised species, namely Amycolatopsis ruanii and Amycolatopsis thermalba, based on 16S rRNA gene sequence, DNA:DNA relatedness and phenotypic data; emended descriptions are given for these species. In contrast, the two strains from the arid Australian composite soil, isolates GY024(T) and GY142, formed a distinct branch at the periphery of the A. methanolica 16S rRNA phyletic line, a taxon that was supported by all of the tree-making algorithms and by a 100 % bootstrap value. These strains shared a high degree of DNA:DNA relatedness and have many phenotypic properties in common, some of which distinguished them from all of the constituent species classified in the A. methanolica 16S rRNA clade. Isolates GY024(T) and GY142 merit recognition as a new species within the A. methanolica group of thermophilic strains. The name proposed for the new species is Amycolatopsis deserti sp. nov.; the type strain is GY024(T) (=NCIMB 14972(T) = NRRL B-65266(T)).

  16. Lentzea cavernae sp. nov., an actinobacterium isolated from a karst cave sample, and emended description of the genus Lentzea.

    Science.gov (United States)

    Fang, Bao-Zhu; Han, Ming-Xian; Liu, Lan; Zhang, Zi-Tong; Liu, Wei-Liang; Shen, Jing-Ting; Wang, Yan; Zhang, Wan-Qin; Wei, Da-Qiao; Li, Wen-Jun

    2017-07-01

    A novel actinobacterial strain, designated SYSU K10001T, was isolated from a limestone sample collected from a karst cave in Xingyi county, Guizhou province, south-western China. The taxonomic position of the strain was investigated using a polyphasic approach. Cells of the strain were aerobic and Gram-stain-positive. On the basis of 16S rRNA gene sequence analysis, strain SYSU K10001T was most closely related to the type strains of the genus Lentzea, Lentzea albida NBRC 16102T (98.8 % similarity) and Lentzea waywayandensis NRRL B-16159T (98.6 %), and is therefore considered to represent a member of the genus Lentzea. DNA-DNA hybridization values between strain SYSU K10001T and related type strains of the genus Lentzea were less than 70 %. In addition, meso-diaminopimelic acid was the diagnostic diamino acid in the cell-wall peptidoglycan. The whole-cell sugars were arabinose, fructose, mannose and xylose. The major isoprenoid quinone was MK-9(H4), while the major fatty acids (>10 %) were iso-C16 : 0 and C14 : 0. The polar lipids were diphosphatidylglycerol, phosphatidylethanolamine, hydroxy-phosphatidylethanolamine, phosphatidylinositol, phosphatidylinositol mannoside, one unidentified phospholipid and one unidentified lipid. The genomic DNA G+C content of strain SYSU K10001T was 69.4 mol%. On the basis of phenotypic, genotypic and phylogenetic data, strain SYSU K10001T represents a novel species of the genus Lentzea, for which the name Lentzea cavernae sp. nov. is proposed. The type strain is SYSU K10001T (=KCTC 39804T=CGMCC 4.7367T=NBRC 112394T).

  17. An Sp1/Sp3 binding polymorphism confers methylation protection.

    Directory of Open Access Journals (Sweden)

    Yanis A Boumber

    2008-08-01

    Full Text Available Hundreds of genes show aberrant DNA hypermethylation in cancer, yet little is known about the causes of this hypermethylation. We identified RIL as a frequent methylation target in cancer. In search for factors that influence RIL hypermethylation, we found a 12-bp polymorphic sequence around its transcription start site that creates a long allele. Pyrosequencing of homozygous tumors revealed a 2.1-fold higher methylation for the short alleles (P<0.001. Bisulfite sequencing of cancers heterozygous for RIL showed that the short alleles are 3.1-fold more methylated than the long (P<0.001. The comparison of expression levels between unmethylated long and short EBV-transformed cell lines showed no difference in expression in vivo. Electrophorectic mobility shift assay showed that the inserted region of the long allele binds Sp1 and Sp3 transcription factors, a binding that is absent in the short allele. Transient transfection of RIL allele-specific transgenes showed no effects of the additional Sp1 site on transcription early on. However, stable transfection of methylation-seeded constructs showed gradually decreasing transcription levels from the short allele with eventual spreading of de novo methylation. In contrast, the long allele showed stable levels of expression over time as measured by luciferase and approximately 2-3-fold lower levels of methylation by bisulfite sequencing (P<0.001, suggesting that the polymorphic Sp1 site protects against time-dependent silencing. Our finding demonstrates that, in some genes, hypermethylation in cancer is dictated by protein-DNA interactions at the promoters and provides a novel mechanism by which genetic polymorphisms can influence an epigenetic state.

  18. Antioxidant capacity, polyphenol content and iron bioavailability from algae (Ulva sp., Sargassum sp. and Porphyra sp.) in human subjects.

    Science.gov (United States)

    García-Casal, Maria N; Ramírez, José; Leets, Irene; Pereira, Ana C; Quiroga, Maria F

    2009-01-01

    Marine algae are easily produced and are good sources of Fe. If this Fe is bioavailable, algae consumption could help to combat Fe deficiency and anaemia worldwide. The objective of the present study was to evaluate Fe bioavailability, polyphenol content and antioxidant capacity from three species of marine algae distributed worldwide. A total of eighty-three subjects received maize- or wheat-based meals containing marine algae (Ulva sp., Sargassum sp. and Porphyra sp.) in different proportions (2.5, 5.0 and 7.5 g) added to the water to prepare the dough. All meals administered contained radioactive Fe. Absorption was evaluated calculating radioactive Fe incorporation in subjects' blood. The three species of marine algae were analysed for polyphenol content and reducing power. Algae significantly increased Fe absorption in maize- or wheat-based meals, especially Sargassum sp., due to its high Fe content. Increases in absorption were dose-dependent and higher in wheat- than in maize-based meals. Total polyphenol content was 10.84, 18.43 and 80.39 gallic acid equivalents/g for Ulva sp., Porphyra sp. and Sargassum sp., respectively. The antioxidant capacity was also significantly higher in Sargassum sp. compared with the other two species analysed. Ulva sp., Sargassum sp. and Porphyra sp. are good sources of bioavailable Fe. Sargassum sp. resulted in the highest Fe intake due to its high Fe content, and a bread containing 7.5 g Sargassum sp. covers daily Fe needs. The high polyphenol content found in Sargassum sp. could be partly responsible for the antioxidant power reported here, and apparently did not affect Fe absorption.

  19. Clostridium tepidum sp. nov., a close relative of Clostridium sporogenes and Clostridium botulinum Group I.

    Science.gov (United States)

    Dobritsa, Anatoly P; Kutumbaka, Kirthi K; Werner, Kirsten; Wiedmann, Martin; Asmus, Aaron; Samadpour, Mansour

    2017-07-01

    Obligately anaerobic, Gram-stain-positive, spore-forming bacteria indistinguishable by pulsed-field gel electrophoresis were isolated from non-dairy protein shakes in bloated bottles. One of the isolates, strain IEH 97212T, was selected for further study. The strain was closely related to Clostridium sporogenes and Clostridium botulinum Group 1 based on 16S rRNA gene sequence similarities. Phylogenetic analysis also showed that strain IEH 97212T and strain PE (=DSM 18688), a bacterium isolated from solfataric mud, had identical 16S rRNA gene sequences. Strains IEH 97 212T and DSM 18 688 were relatively more thermophilic (temperature range for growth: 30-55 °C) and less halotolerant [growth range: 0-2.5 % (w/v) NaCl] than C. sporogenes and C. botulinum. They were negative for catalase, oxidase, urease and l-pyrrolidonyl-arylamidase and did not produce indole. The strains produced acid from d-glucose, maltose and trehalose, and hydrolysed gelatin, but did not hydrolyse aesculin. The end-products of growth included acetic acid, propionic acid, butyric acid, isobutyric acid, valeric acid, isovaleric acid, isocaproic acid, phenylpropionic acid, 2-piperidinone, 2-pyrrolidinone and gas(es). The predominant fatty acids were C14 : 0, C16 : 0 and C18 : 1ω9c. The genomic DNA G+C content of strains IEH 97212T and DSM 18688 was 26.9 and 26.7 mol%, respectively. According to the digital DNA-DNA hybridization data, the relatedness of these strains was 98.4 %, while they showed only 35.7-36.0 % relatedness to C. sporogenes. Based on the results of this polyphasic study, these strains represent a novel species, for which the name Clostridium tepidum sp. nov. is proposed, with the type strain IEH 97212T (=NRRL B-65463T=DSM 104389T).

  20. Rhizobium tarimense sp. nov., isolated from soil in the ancient Khiyik River.

    Science.gov (United States)

    Turdahon, Maripat; Osman, Ghenijan; Hamdun, Maryam; Yusuf, Khayir; Abdurehim, Zumret; Abaydulla, Gulsumay; Abdukerim, Muhtar; Fang, Chengxiang; Rahman, Erkin

    2013-07-01

    A Gram-negative, non-motile, pale-yellow, rod-shaped bacterial strain, PL-41(T), was isolated from Populus euphratica forest soil at the ancient Khiyik River valley in Xinjiang Uyghur Autonomous Region, People's Republic of China. Strain PL-41(T) grew optimally at 30 °C and pH 7.0-8.0. The major quinone was Q-10. The predominant cellular fatty acids of strain PL-41(T) were summed feature 8 (comprising C18 : 1ω7c and C18 : 1ω6c), C16 : 0 and C19 : 0 cyclo ω8c. Polar lipids of strain PL-41(T) include two unidentified aminophospholipids (APL1, 2), two unidentified phospholipids (PL1, 2), phosphatidylcholine and three unidentified lipids (L1-3). Strain PL-41(T) showed 16S rRNA gene sequence similarity of 97.0-97.5 % to the type strains of recognized species of the genus Rhizobium. Phylogenetic analysis of strain PL-41(T) based on the sequences of housekeeping genes recA and atpD confirmed (similarities are less than 90 %) its position as a distinct species of the genus Rhizobium. The DNA G+C content was 57.8 mol%. DNA-DNA relatedness between strain PL-41(T) and the type strains of Rhizobium huautlense S02(T), Rhizobium alkalisoli CCBAU 01393(T), Rhizobium vignae CCBAU 05176(T) and Rhizobium loessense CCBAU 7190B(T) were 33.4, 22.6, 25.5 and 45.1 %, respectively, indicating that strain PL-41(T) was distinct from them genetically. Strain PL-41(T) also can be differentiated from these four phylogenetically related species of the genus Rhizobium by various phenotypic properties. On the basis of phenotypic properties, phylogenetic distinctiveness and genetic data, strain PL-41(T) is considered to represent a novel species of the genus Rhizobium, for which the name Rhizobium tarimense sp. nov. is proposed. The type strain is PL-41(T) ( = CCTCC AB 2011011(T) = NRRL B-59556(T)).

  1. Rhizobium populi sp. nov., an endophytic bacterium isolated from Populus euphratica.

    Science.gov (United States)

    Rozahon, Manziram; Ismayil, Nurimangul; Hamood, Buayshem; Erkin, Raziya; Abdurahman, Mehfuzem; Mamtimin, Hormathan; Abdukerim, Muhtar; Lal, Rup; Rahman, Erkin

    2014-09-01

    An endophytic bacterium, designated K-38(T), was isolated from the storage liquid in the stems of Populus euphratica trees at the ancient Ugan River in Xinjiang, PR China. Strain K-38(T) was found to be rod-shaped, Gram-stain-negative, aerobic, non-motile and non-spore-forming. Strain K-38(T) grew at temperatures of 25-37 °C (optimum, 28 °C), at pH 6.0-9.0 (optimum, pH 7.5) and in the presence of 0-3 % (w/v) NaCl with 1 % as the optimum concentration for growth. According to phylogenetic analysis based on 16S rRNA gene sequences, strain K-38(T) was assigned to the genus Rhizobium with highest 16S rRNA gene sequence similarity of 97.2 % to Rhizobium rosettiformans W3(T), followed by Rhizobium nepotum 39/7(T) (96.5 %) and Rhizobium borbori DN316(T) (96.2 %). Phylogenetic analysis of strain K-38(T) based on the protein coding genes recA, atpD and nifH confirmed (similarities were less than 90 %) it to be a representative of a distinctly delineated species of the genus Rhizobium. The DNA G+C content was determined to be 63.5 mol%. DNA-DNA relatedness between K-38(T) and R. rosettiformans W3(T) was 48.4 %, indicating genetic separation of strain K-38(T) from the latter strain. The major components of the cellular fatty acids in strain K-38(T) were revealed to be summed feature 8 (comprising C18 : 1ω7c and/or C18 : 1ω6c; 57.2 %), C16 : 0 (13.6 %) and summed feature 2 (comprising C12 : 0 aldehyde, C14 : 0 3-OH/iso-C16 : 1 I and/or unknown ECL 10.928; 11.0 %). Polar lipids of strain K-38(T) include phosphatidylethanolamine, phosphatidylmonomethylethanolamine, phosphatidylcholine, phosphatidylglycerol, diphosphatidylglycerol, two unidentified aminophospholipids and two unidentified phospholipids. Q-10 was the major quinone in strain K-38(T). Based on phenotypic, chemotaxonomic and phylogenetic properties, strain K-38(T) represents a novel species of the genus Rhizobium, for which the name Rhizobium populi sp. nov. is proposed

  2. Marinobacter xestospongiae sp. nov., isolated from the marine sponge Xestospongia testudinaria collected from the Red Sea.

    Science.gov (United States)

    Lee, On On; Lai, Pok Yui; Wu, Hui-xian; Zhou, Xiao-jian; Miao, Li; Wang, Hao; Qian, Pei-Yuan

    2012-08-01

    A Gram-negative, catalase- and oxidase-positive, non-sporulating, rod-shaped and slightly halophilic bacterial strain, designated UST090418-1611(T), was isolated from the marine sponge Xestospongia testudinaria collected from the Red Sea coast of Saudi Arabia. Phylogenetic trees based on the 16S rRNA gene sequence placed strain UST090418-1611(T) in the family Alteromonadaceae with the closest relationship to the genus Marinobacter. The 16S rRNA gene sequence similarity between the strain and the type strains of recognized Marinobacter species ranged from 92.9 to 98.3%. Although strain UST090418-1611(T) shared high 16S rRNA gene sequence similarity with Marinobacter mobilis CN46(T), M. zhejiangensis CN74(T) and M. sediminum R65(T) (98.3, 97.4 and 97.3%, respectively), the relatedness of the strain to these three strains in DNA-DNA hybridization was only 58, 56 and 33%, respectively, supporting the novelty of the strain. In contrast to most strains in the genus Marinobacter, strain UST090418-1611(T) tolerated only 6% (w/v) NaCl, and optimal growth occurred at 2.0% (w/v) NaCl, pH 7.0-8.0 and 28-36 °C. The predominant cellular fatty acids were C(12:0) 3-OH, C(16:0), C(12:0) and summed feature 3 (C(16:1)ω6c and/or C(16:1)ω7c). The genomic DNA G+C content was 57.1 mol%. Based on the physiological, phylogenetic and chemotaxonomic characteristics presented in this study, we suggest that the strain represents a novel species in the genus Marinobacter, for which the name Marinobacter xestospongiae sp. nov. is proposed, with UST090418-1611(T) ( = JCM 17469(T)  = NRRL B-59512(T)) as the type strain.

  3. Pantoea rodasii sp. nov., Pantoea rwandensis sp. nov. and Pantoea wallisii sp. nov., isolated from Eucalyptus.

    Science.gov (United States)

    Brady, Carrie L; Cleenwerck, Ilse; van der Westhuizen, Lorinda; Venter, Stephanus N; Coutinho, Teresa A; De Vos, Paul

    2012-07-01

    Several Gram-negative-staining, facultatively anaerobic bacterial isolates were obtained from Eucalyptus seedlings showing symptoms of bacterial blight and dieback in Colombia, Rwanda and South Africa. Partial 16S rRNA gene sequencing, together with partial gyrB sequencing, placed the isolates in the genus Pantoea and indicated that they constituted three novel species. Multilocus sequence analysis (MLSA) based on partial sequences of gyrB, rpoB, infB and atpD revealed Pantoea dispersa, Pantoea eucrina and Pantoea cypripedii as their closest phylogenetic relatives. DNA-DNA hybridization studies confirmed the classification of the new isolates as three novel species and phenotypic tests allowed them to be differentiated from their closest phylogenetic neighbours. The names Pantoea rodasii sp. nov. [type strain LMG 26273(T)=BD 943(T) (deposited with the Plant Pathogenic and Plant Protecting Bacteria Collection, South Africa)=BCC 581(T) (deposited with the Bacterial Culture Collection, Forestry and Agricultural Institute, South Africa)], Pantoea rwandensis sp. nov. (type strain LMG 26275(T)=BD 944(T)=BCC 571(T)) and Pantoea wallisii sp. nov. (type strain LMG 26277(T)=BD 946(T)=BCC 682(T)) are proposed.

  4. DISTRIBUSI Solen sp DI PERAIRAN KABUPATEN BANGKALAN

    Directory of Open Access Journals (Sweden)

    Eva Ari Wahyuni

    2016-03-01

    Full Text Available DISTRIBUTION OF Solen sp IN BANGKALAN WATERSSolen sp potential needs to be developed on the island of Madura, particularly in Bangkalan. Solen sp utilization has increased which has the potential to overfishing. Therefore, this study aims to determine the density of Solen sp and their ecology in the waters Modung village, Modung District, Bangkalan. The experiment was conducted in April 2015 using the descriptive method. The materials used include Solen sp and physico-chemical parameters of the environment (temperature, salinity, pH, and substrate. The analyzes were conducted at the Laboratory of Marine Science, Department of Marine Sciences, Trunojoyo University of Madura by using the tool grabsampler, sieveshaker, and pipetting with gravimetric method. The analysis shows the range of values of temperature between 29-300C, salinity between 31-32 ppt, pH were 7.9-8.0 and the type of substrate in the form of sandy mud, as well as the density of Solen sp from 8-10 individuals/m2. All measurement results indicate normal conditions and in accordance with the sea water quality standard for marine life, which can be a suitable habitat for the growth and development of Solen sp. This condition is thought to affect the density of Solen sp.Keywords: Bangkalan, density, distribution, Solen sp, substrate.ABSTRAKPotensi Solen sp perlu dikembangkan di pulau Madura, khususnya di Kabupaten Bangkalan. Pemanfaatan Solen sp mengalami peningkatan sehingga berpotensi overfishing. Untuk itu, penelitian ini bertujuan untuk mengetahui kepadatan Solen sp dan ekologinya di perairan desa Modung, Kecamatan Modung, Kabupaten Bangkalan. Penelitian dilaksanakan pada bulan April 2015 dengan metode deskriptif. Materi dan bahan yang digunakan diantaranya Solen sp dan parameter fisika-kimia lingkungan (suhu, salinitas, pH, dan substrat. Analisa dilakukan di Laboratorium Ilmu Kelautan, Program studi/Jurusan Ilmu Kelautan Universitas Trunojoyo Madura dengan menggunakan alat

  5. Especificidad del hongo micorrizico (Rhizoctonia sp.) en Phalaenopsis sp., Cymbidium sp., Trichoceros antenifer, Oncidium excavatum, y Cyrtochilum sp.

    OpenAIRE

    Ordoñez, Silvia L.; Pillacela Zhunio, Dora Priscila; Salazar, Jazmín M.; Peña Tapia, Denisse Fabiola

    2016-01-01

    Las orquídeas producen abundantes semillas pequeñas, careciendo de endospermo, cotiledones y sustancias de reserva para llevar a cabo su germinación. Es por esto que estratégicamente las semillas establecen una relación simbiótica con un hongo micorrízico que favorece a su germinación y desarrollo. El objetivo de este estudio fue determinar la especificidad del hongo micorrízico (Rhizoctonia sp.) en la germinación de cinco géneros de orquídeas. Se usaron dos medios de cultivo: 1) PhytamaxTM y...

  6. Rodentibacter gen. nov including Rodentibacter pneumotropicus comb. nov., Rodentibacter heylii sp nov., Rodentibacter myodis sp nov., Rodentibacter ratti sp nov., Rodentibacter heidelbergensis sp nov., Rodentibacter trehalosifermentans sp nov., Rodentibacter rarus sp nov., Rodentibacter mrazii

    DEFF Research Database (Denmark)

    Adhikary, Sadhana; Nicklas, Werner; Bisgaard, Magne

    2017-01-01

    genomic comparison allowed the estimation of DNA–DNA renaturation. Rodentibacter heylii sp. nov. was proposed for a group that included the biovar Heyl of [ Pasteurella ] pneumotropica with the type strain ATCC 12555T (=CCUG 998T). A group was proposed as Rodentibacter ratti sp. nov., which included...

  7. Xylanolytic enzyme systems in Arthrobacter sp MTCC 5214 and Lactobacillus sp.

    Digital Repository Service at National Institute of Oceanography (India)

    Khandeparker, R.; Jalal, T.

    The production of extracellular xylanolytic enzymes such as xylanase, alfa-L-arabinofuranosidase (alfa-l-AFase), and acetyl xylan esterase (Axe) by marine Arthrobacter sp and Lactobacillus sp was investigated using different carbon sources Induction...

  8. Evaluation of antioxidant and cytotoxic properties of Cynobacteria, Limnothrix sp. and Leptolyngbya sp. from Arabian sea

    Digital Repository Service at National Institute of Oceanography (India)

    Anas, A.; Vinothkumar, S.; Gupta, S.; Jasmin, C.; Joseph, V.; Parameswaran, P.S.; Nair, S.

    The hexane fractions of the marine cyanobacteria: Leptolyngbya sp. and Limnothrix sp., collected from Arabian Sea were found to display promising antioxidant properties than their ethyl acetate fraction during radical scavenging ABTS/DPPH assays (IC...

  9. First report of Anisakis sp. in Epinephelus sp. in East Indonesia

    OpenAIRE

    Annytha Ina Rohi Detha; Diana Agustiani Wuri; Julianty Almet; Yuni Riwu; Christin Melky

    2018-01-01

    Objective: The present research was conducted to identify the prevalence of Anisakis sp. as fish-borne zoonoses in Epinephelus sp. in territorial waters of East Nusa Tenggara, Indonesia. Materials and methods: A total of 50 fish (Epinephelus sp.) were collected from Kupang Fish Market in East Nusa Tenggara. Identification of Anisakis sp. was performed based on morphological observations considering shape of ventriculus, boring tooth, and mucron using binocular microscope. Results: Prev...

  10. Candida bromeliacearum sp. nov. and Candida ubatubensis sp. nov., two yeast species isolated from the water tanks of Canistropsis seidelii (Bromeliaceae).

    Science.gov (United States)

    Ruivo, Carla C C; Lachance, Marc-André; Rosa, Carlos A; Bacci, Maurício; Pagnocca, Fernando C

    2005-09-01

    Strains belonging to two novel yeast species, Candida bromeliacearum and Candida ubatubensis, were isolated from the bromeliad tank of Canistropsis seidelii (Bromeliaceae) in a sandy coastal plain (restinga) ecosystem site in an Atlantic rainforest of south-eastern Brazil. These species were genetically distinct from all other currently accepted ascomycetous yeasts, based on sequence divergence in the D1/D2 domains of the large-subunit rDNA and in the small-subunit rDNA. The species occupy basal positions in the Metschnikowiaceae clade. The type strains are Candida bromeliacearum UNESP 00-103(T) (=CBS 10002(T)=NRRL Y-27811(T)) and Candida ubatubensis UNESP 01-247R(T) (=CBS 10003(T)=NRRL Y-27812(T)).

  11. Specialised predation by Palpimanus sp. (Araneae: Palpimanidae ...

    African Journals Online (AJOL)

    This is the first detailed report on the natural prey and the prey-capture tactics of a Palpimanus sp. from Entebbe (Uganda). Although this species fed occasionally on insects, its dominant prey in the field was other spiders, especially jumping spiders (Salticidae) and their eggs. Encounters between Palpimanus sp. and ...

  12. Guide til gode spørgeskemaer

    DEFF Research Database (Denmark)

    Olsen, Henning

    Spørgeskemaundersøgelser bliver ofte brugt til at dokumentere forskellige forhold og begrunde politiske beslutninger. Men resultaterne kan være forbundet med stor usikkerhed. Det kræver omhu og stor sproglig formåen at udarbejde spørgeskemaer. Seniorforsker Henning Olsen har i flere år arbejdet med...... viden om, hvordan folk forstår sproglige meddelelser og genkalder sig informationer. I guiden behandles emner som fx styrende problemstillinger og spørgsmåls fokus og neutralitet, formulering af åbne eller lukkede spørgsmål og svarkategorier, tematiske spørgeforløb, aflastning af svarpersoners...

  13. Listeria floridensis sp. nov., Listeria aquatica sp. nov., Listeria cornellensis sp. nov., Listeria riparia sp. nov. and Listeria grandensis sp. nov., from agricultural and natural environments.

    Science.gov (United States)

    den Bakker, Henk C; Warchocki, Steven; Wright, Emily M; Allred, Adam F; Ahlstrom, Christina; Manuel, Clyde S; Stasiewicz, Matthew J; Burrell, Angela; Roof, Sherry; Strawn, Laura K; Fortes, Esther; Nightingale, Kendra K; Kephart, Daniel; Wiedmann, Martin

    2014-06-01

    Sampling of agricultural and natural environments in two US states (Colorado and Florida) yielded 18 Listeria-like isolates that could not be assigned to previously described species using traditional methods. Using whole-genome sequencing and traditional phenotypic methods, we identified five novel species, each with a genome-wide average BLAST nucleotide identity (ANIb) of less than 85% to currently described species. Phylogenetic analysis based on 16S rRNA gene sequences and amino acid sequences of 31 conserved loci showed the existence of four well-supported clades within the genus Listeria; (i) a clade representing Listeria monocytogenes, L. marthii, L. innocua, L. welshimeri, L. seeligeri and L. ivanovii, which we refer to as Listeria sensu stricto, (ii) a clade consisting of Listeria fleischmannii and two newly described species, Listeria aquatica sp. nov. (type strain FSL S10-1188(T) = DSM 26686(T) = LMG 28120(T) = BEI NR-42633(T)) and Listeria floridensis sp. nov. (type strain FSL S10-1187(T) = DSM 26687(T) = LMG 28121(T) = BEI NR-42632(T)), (iii) a clade consisting of Listeria rocourtiae, L. weihenstephanensis and three novel species, Listeria cornellensis sp. nov. (type strain TTU A1-0210(T) = FSL F6-0969(T) = DSM 26689(T) = LMG 28123(T) = BEI NR-42630(T)), Listeria grandensis sp. nov. (type strain TTU A1-0212(T) = FSL F6-0971(T) = DSM 26688(T) = LMG 28122(T) = BEI NR-42631(T)) and Listeria riparia sp. nov. (type strain FSL S10-1204(T) = DSM 26685(T) = LMG 28119(T) = BEI NR- 42634(T)) and (iv) a clade containing Listeria grayi. Genomic and phenotypic data suggest that the novel species are non-pathogenic. © 2014 IUMS.

  14. Predictive value of Sp1/Sp3/FLIP signature for prostate cancer recurrence.

    Directory of Open Access Journals (Sweden)

    Roble G Bedolla

    Full Text Available Prediction of prostate cancer prognosis is challenging and predictive biomarkers of recurrence remain elusive. Although prostate specific antigen (PSA has high sensitivity (90% at a PSA level of 4.0 ng/mL, its low specificity leads to many false positive results and considerable overtreatment of patients and its performance at lower ranges is poor. Given the histopathological and molecular heterogeneity of prostate cancer, we propose that a panel of markers will be a better tool than a single marker. We tested a panel of markers composed of the anti-apoptotic protein FLIP and its transcriptional regulators Sp1 and Sp3 using prostate tissues from 64 patients with recurrent and non-recurrent cancer who underwent radical prostatectomy as primary treatment for prostate cancer and were followed with PSA measurements for at least 5 years. Immunohistochemical staining for Sp1, Sp3, and FLIP was performed on these tissues and scored based on the proportion and intensity of staining. The predictive value of the FLIP/Sp1/Sp3 signature for clinical outcome (recurrence vs. non-recurrence was explored with logistic regression, and combinations of FLIP/Sp1/Sp3 and Gleason score were analyzed with a stepwise (backward and forward logistic model. The discrimination of the markers was identified by sensitivity-specificity analysis and the diagnostic value of FLIP/Sp1/Sp3 was determined using area under the curve (AUC for receiver operator characteristic curves. The AUCs for FLIP, Sp1, Sp3, and Gleason score for predicting PSA failure and non-failure were 0.71, 0.66, 0.68, and 0.76, respectively. However, this increased to 0.93 when combined. Thus, the "biomarker signature" of FLIP/Sp1/Sp3 combined with Gleason score predicted disease recurrence and stratified patients who are likely to benefit from more aggressive treatment.

  15. Antibacterial Actions and Potential Phototoxic Effects of Volatile oils of Foeniculum sp. (fennel, Salvia sp. (sage, Vitis sp. (grape, Lavandula sp. (lavender

    Directory of Open Access Journals (Sweden)

    Elif Ayse Erdogan Eliuz

    2016-09-01

    Full Text Available In the present study, the volatile compounds of essential oil of Foeniculum vulgare (fennel, Salvia officinalis (sage, Vitis vinifera (grape, Lavandula angustifolia (lavender were analysed by gas chromatography-mass spectrometry (GC-MS using the Nist and Willey libraries. It was determined that the main components of Foeniculum sp. were anethole (41.11%, carvacrol (9.18%. whereas main components of Salvia sp were 1.8 cineole (34.09%, caryophyllene (10.95%, camphor (9.44%, α-pinene (8.42%. Vitis sp. contained linoleic acid (36.98%, 2,4-decadienal (30.79%. Finally, volatile component of Lavandula sp. was linalool (33.57%, linalyl acetate (30.74%. Photoxic antibacterial activity of volatile oil of those plants against Escherichia coli (ATCC 25293, Klebsiella pneumoniae (10031, Salmonella thyphimurium, Bacillus subtilis (ATCC 6633, Staphylococcus aureus (ATCC 25925, Enterococcus feacalis (ATCC 29212 were examined by using disc diffusion method. We demonstrated that volatile oil effectively can be activated by a standard LED light. In vitro, significant phototoxicity was demonstrated by volatile oil of Foeniculum sp. and Vitis sp. (P < 0.05, while minor phototoxicity was induced by Lavandula sp. Therefore, volatile oil of plant can be considered as a potential photosensitizer in the photochemical therapy.

  16. NCBI nr-aa BLAST: CBRC-ACAR-01-1054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1054 ref|ZP_01169668.1| conserved membrane-spanning protein [Bacillus ...sp. NRRL B-14911] gb|EAR67900.1| conserved membrane-spanning protein [Bacillus sp. NRRL B-14911] ZP_01169668.1 1.3 33% ...

  17. NCBI nr-aa BLAST: CBRC-ACAR-01-0955 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0955 ref|ZP_01169668.1| conserved membrane-spanning protein [Bacillus ...sp. NRRL B-14911] gb|EAR67900.1| conserved membrane-spanning protein [Bacillus sp. NRRL B-14911] ZP_01169668.1 2.3 33% ...

  18. TurboSP and the Topological Trigger

    CERN Document Server

    Belavin, Vladislav

    2016-01-01

    TurboSP was originally proposed as an alternative to Full stream in LHCb data flow. TurboSP is a data flow strategy which not only selects events that should be preserved, like in Full stream, but also provides selective persistence. This is achieved by saving candidates and subset of the reconstruction. During this summer project we investigated the physics viability of using TurboSP with the topological lines and found out a possibility to reduce the number of kept tracks per event by two times while keeping a ratio of fully picked up interesting decay modes on $\\sim 97 \\%$ level.

  19. Amphibian (Xenopus sp.) iodothyronine deiodinase ...

    Science.gov (United States)

    The U.S. EPA-MED amphibian thyroid group is currently screening chemicals for inhibition of human iodothyronine deiodinase activity as components of the thyroid system important in human development. Amphibians are a bellwether taxonomic group to gauge toxicity of chemicals in the environment. Amphibian thyroid function is not only important in development but also metamorphosis. Xenopus sp. have been used extensively as model organisms and are well characterized genetically. We propose to screen a list of chemicals (selected from the human DIO screening results) to test for inhibition of Xenopus deiodinases. Large quantities of the enzymes will be produced using an adenovirus system. Our preliminary results show that there may be catalytic differences between human and Xenopus deiodinases. The Twin Ports Early Career Scientists is a new group formed within the Duluth-Superior scientific community. This presentation will provide a basic introduction to my research and our mission at EPA, and help to establish networking and collaboration relationships across disciplines and institutions.

  20. Detection of Salmonella sp., Vibrio sp. and total plate count bacteria on blood cockle (Anadara granosa)

    Science.gov (United States)

    Ekawati, ER; Yusmiati, S. N. H.

    2018-01-01

    Blood cockle (Anadara granosa) has high level of zinc and protein, which is beneficial for therapeutic function for malnourished particularly stunting case in children. Zinc in animal foods is more absorbable than that from vegetable food. Blood cockle (Anadara granosa) is rich in nutrient and an excellent environment for the growth of microorganisms. This research aimed to identify the contamination of Salmonella sp., Vibrio sp. and total plate count bacteria on blood cockle (Anadara granosa). This was observation research with laboratory analysis. Salmonella sp. and Vibrio sp. were detected from blood cockle. Total plate count was determine of the total amount of the bacteria. Results detected from 20 samples of blood cockle showed that all samples were negative of Salmonella sp. and 1 sample positive Vibrio sp. The result of total plate count bacteria was sample.

  1. Helicotylenchus stylocercus n. sp. and Rotylenchus phaliurus n. sp. (Nematoda: Hoplolaimidae) from Costa Rica.

    Science.gov (United States)

    Siddiqi, M R; Pinochet, J

    1979-10-01

    Two new species of plant-parasitic nematodes from Costa Rica are described. Helicotygenchus styloeercus n. sp., from soil around roots of banana at Coto, is distinguished hy the female tail, which bears a large pillarlike ventral projection. Rotylenchus phaliurus n. sp., from soil artmnd roots of Dioscoroea sp. at Sixaola, differs from R. caudaphasmidius in having the conus equal to or more than half the spear length, and large terminal annules on the female tail.

  2. SP (4,R) symmetry in light nuclei

    International Nuclear Information System (INIS)

    Peterson, D.R.

    1979-01-01

    A classification of nuclear states according to the noncompact sympletic Lie algebras sp(2n,R), n = 1, 2, 3, is investigated. Such a classification has recently been shown to be physically meaningful. This classification scheme is the appropriate generalization fo Elliott's SU 3 model of rotational states in deformed light nuclei to include core excitations. A restricted classification according to the Lie algebra, sp(4,R), is motivated. Truncation of the model space to a single sp(4,R) irreducible representation allows the inclusion of states possessing very high excitation energy. An sp(4,R) model study is performed on S = T = 0 positive-parity rotational bands in the deformed light nuclei 16 O and 24 Mg. States are included in the model space that possess up to 10h ω in excitation energy. Results for the B(E2) transition rates compare favorable with experiment, without resort to effective charges

  3. EOP Gold Coral (Gerardia sp.) Growth Measurements

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Gold coral (Gerardia sp.) trees that were inspected years earlier on Pisces submersible dives were revisited and their change in size measured. The fishery for...

  4. Silencing the SpMPK1, SpMPK2, and SpMPK3 Genes in Tomato Reduces Abscisic Acid—Mediated Drought Tolerance

    Directory of Open Access Journals (Sweden)

    Yan Liang

    2013-11-01

    Full Text Available Drought is a major threat to agriculture production worldwide. Mitogen-activated protein kinases (MAPKs play a pivotal role in sensing and converting stress signals into appropriate responses so that plants can adapt and survive. To examine the function of MAPKs in the drought tolerance of tomato plants, we silenced the SpMPK1, SpMPK2, and SpMPK3 genes in wild-type plants using the virus-induced gene silencing (VIGS method. The results indicate that silencing the individual genes or co-silencing SpMPK1, SpMPK2, and SpMPK3 reduced the drought tolerance of tomato plants by varying degrees. Co-silencing SpMPK1 and SpMPK2 impaired abscisic acid (ABA-induced and hydrogen peroxide (H2O2-induced stomatal closure and enhanced ABA-induced H2O2 production. Similar results were observed when silencing SpMPK3 alone, but not when SpMPK1 and SpMPK2 were individually silenced. These data suggest that the functions of SpMPK1 and SpMPK2 are redundant, and they overlap with that of SpMPK3 in drought stress signaling pathways. In addition, we found that SpMPK3 may regulate H2O2 levels by mediating the expression of CAT1. Hence, SpMPK1, SpMPK2, and SpMPK3 may play crucial roles in enhancing tomato plants’ drought tolerance by influencing stomatal activity and H2O2 production via the ABA-H2O2 pathway.

  5. Burkholderia dabaoshanensis sp. nov., a heavy-metal-tolerant bacteria isolated from Dabaoshan mining area soil in China.

    Directory of Open Access Journals (Sweden)

    Honghui Zhu

    Full Text Available Heavy-metal-tolerant bacteria, GIMN1.004(T, was isolated from mine soils of Dabaoshan in South China, which were acidic (pH 2-4 and polluted with heavy metals. The isolation was Gram-negative, aerobic, non-spore-forming, and rod-shaped bacteria having a cellular width of 0.5-0.6 µm and a length of 1.3-1.8 µm. They showed a normal growth pattern at pH 4.0-9.0 in a temperature ranging from 5 °C to 40 °C.The organism contained ubiquinone Q-8 as the predominant isoprenoid quinine, and C(16:0, summed feature 8 (C(18:1ω7c and C(18:1ω6c, C(18:0, summed feature 3 (C(16:1ω7c or iso-C(15:0 2-OH, C(17:0 cyclo, C(18:1ω9c, C(19:0 cyclo ω8c, C(14:0 as major fatty acid. These profiles were similar to those reported for Burkholderia species. The DNA G+C % of this strain was 61.6%. Based on the similarity to 16S rRNA gene sequence, GIMN1.004(T was considered to be in the genus Burkholderia. The similarities of 16S rRNA gene sequence between strain GIMN1.004(T and members of the genus Burkholderia were 96-99.4%, indicating that this novel strain was phylogenetically related to members of that genus. The novel strain showed the highest sequence similarities to Burkholderia soli DSM 18235(T (99.4%; Levels of DNA-DNA hybridization with DSM 18235(T was 25%. Physiological and biochemical tests including cell wall composition analysis, differentiated phenotype of this strain from that closely related Burkholderia species. The isolation had great tolerance to cadmium with MIC of 22 mmol/L, and adsorbability of 144.94 mg/g cadmium,and it was found to exhibit antibiotic resistance characteristics. The adsorptive mechanism of GIMN1.004(T for cadmium depended on the action of the amide,carboxy and phosphate of cell surface and producing low-molecular-weight (LMW organic acids to complex or chelated Cd(2+.Therefore, the strain GIMN1.004(T represented a new cadmium resistance species, which was tentatively named as Burkholderia dabaoshanensis sp. nov. The strain type

  6. Penggunaan Jamur Antagonis Trichoderma SP. Dan Gliocladium SP. Untuk Mengendalikan Penyakit Layu Fusarium Pada Tanaman Bawang Merah (Allium Ascalonicum L.)

    OpenAIRE

    Arie Ramadhina, Arie Ramadhina; Lisnawita, Lisnawita; Lubis, Lahmuddin

    2013-01-01

    The use of antagonism fungus of Trichoderma sp. and Gliocladium sp. for controlling wilt(Fusarium oxysporum) in red onion plants. The aim of the research was to know the effectiviness ofantagonism fungus of Trichoderma sp. and Gliocladium sp. in controlling wilt in red onion plants.The research used non-factorial RAK (random group design) with eight treatments: control, 10grams of F. oxysporum, 12 grams of Trichoderma sp., 18 grams of Trichoderma sp., 24 grams ofTrichoderma sp., and 12 grams ...

  7. Chaenorhinum semispeluncarum sp. nov. and C. yildirimlii sp. nov. (Scrophulariaceae) from east Anatolia, Turkey

    DEFF Research Database (Denmark)

    Yildirim, Hasan; Tan, Kit; Senol, Serdar

    2010-01-01

    Chaenorhinum semispeluncarum H. Yildirim, Kit Tan, S. Senol & A. Pirhan sp. nov. and C. yildirimlii Kit Tan, H. Yildirim, S. Senol & A. Pirhan sp. nov. (Scrophulariaceae, C. sect. Microrrhinum) from east Anatolia are described and illustrated. They are both narrow endemics related to the rare C...

  8. Profundibacterium mesophilum gen. nov., sp. nov., a novel member in the family Rhodobacteraceae isolated from deep-sea sediment in the Red Sea, Saudi Arabia

    KAUST Repository

    Lai, PokYui

    2012-06-08

    A slow-growing, strictly aerobic, Gram-negative, coccus bacterial strain, designated KAUST100406-0324T, was isolated from sea-floor sediment collected from the Red Sea, Saudi Arabia. The catalase- and oxidase-positive strain was non-sporulating and only slightly halophilic. Optimum growth occurred at 20-25 °C and at pH values ranging from 7.0 to 8.0. The major cellular fatty acids of the strain were unsaturated C18: 1ω6c and/or C18:1ω7c, C18:1ω7c 11-methyl and C16:1ω7c and/or C16:1ω6c. The major polar lipids were phosphatidylglycerol, phosphatidylethanolamine and two unidentified phospholipids. Ubiquinone 10 was the predominant lipoquinone. The DNA G+C content of strain KAUST100406-0324T was 64.0 mol%. Phylogenetic analysis of 16S rRNA gene sequences revealed that the novel strain belonged to the family Rhodobacteraceae of the class Alphaproteobacteria but formed a distinct evolutionary lineage from other bacterial species with validly published names. The 16S rRNA gene sequence of the novel strain was distantly related, but formed a monophyletic cluster with, those of bacteria from two moderately halophilic genera, Hwanghaeicola and Maribius. The similarity of the sequence between the novel strain KAUST100406-0324T and the type strains Hwanghaeicola aestuarii Y26T (accession number FJ230842), Maribius pelagius B5-6T (DQ514326) and Maribius salinus CL-SP27T (AY906863) were 94.5 %, 95.2 % and 95.3 %, respectively. Based on the physiological, phylogenetic and chemotaxonomic characteristics presented in this study, we propose that this strain represents a novel species of a new genus in the family Rhodobacteraceae, for which the name of Profundibacterium mesophilum gen. nov., sp. nov. was proposed, with KAUST100406-0324T (= JCM 17872T = NRRL B-59665T) as the type strain. © 2013 IUMS.

  9. Metallaphotoredox-catalysed sp3-sp3 cross-coupling of carboxylic acids with alkyl halides

    Science.gov (United States)

    Johnston, Craig P.; Smith, Russell T.; Allmendinger, Simon; MacMillan, David W. C.

    2016-08-01

    In the past 50 years, cross-coupling reactions mediated by transition metals have changed the way in which complex organic molecules are synthesized. The predictable and chemoselective nature of these transformations has led to their widespread adoption across many areas of chemical research. However, the construction of a bond between two sp3-hybridized carbon atoms, a fundamental unit of organic chemistry, remains an important yet elusive objective for engineering cross-coupling reactions. In comparison to related procedures with sp2-hybridized species, the development of methods for sp3-sp3 bond formation via transition metal catalysis has been hampered historically by deleterious side-reactions, such as β-hydride elimination with palladium catalysis or the reluctance of alkyl halides to undergo oxidative addition. To address this issue, nickel-catalysed cross-coupling processes can be used to form sp3-sp3 bonds that utilize organometallic nucleophiles and alkyl electrophiles. In particular, the coupling of alkyl halides with pre-generated organozinc, Grignard and organoborane species has been used to furnish diverse molecular structures. However, the manipulations required to produce these activated structures is inefficient, leading to poor step- and atom-economies. Moreover, the operational difficulties associated with making and using these reactive coupling partners, and preserving them through a synthetic sequence, has hindered their widespread adoption. A generically useful sp3-sp3 coupling technology that uses bench-stable, native organic functional groups, without the need for pre-functionalization or substrate derivatization, would therefore be valuable. Here we demonstrate that the synergistic merger of photoredox and nickel catalysis enables the direct formation of sp3-sp3 bonds using only simple carboxylic acids and alkyl halides as the nucleophilic and electrophilic coupling partners, respectively. This metallaphotoredox protocol is suitable for

  10. Five novel Wickerhamomyces- and Metschnikowia-related yeast species, Wickerhamomyces chaumierensis sp. nov., Candida pseudoflosculorum sp. nov., Candida danieliae sp. nov., Candida robnettiae sp. nov. and Candida eppingiae sp. nov., isolated from plants

    NARCIS (Netherlands)

    Groenewald, Marizeth; Robert, Vincent; Smith, Maudy Th

    On the basis of nucleotide divergences in the D1/D2 domain of the 26S rRNA gene and the internal transcribed spacers (ITS) domain of the rRNA gene, five novel yeast species, Wickerhamomyces chaumierensis sp. nov. (CBS 8565(T)  = JCM 17246(T)), Candida pseudoflosculorum sp. nov. (CBS 8584(T)  = JCM

  11. SP-100/Brayton power system concepts

    International Nuclear Information System (INIS)

    Owen, D.F.

    1989-01-01

    Use of closed Brayton cycle (CBC) power conversion technology has been investigated for use with SP-100 reactors for space power systems. The CBC power conversion technology is being developed by Rockwell International under the Dynamic Isotype Power System (DIPS) and Space Station Freedom solar dynamic power system programs to provide highly efficient power conversion with radioisotype and solar collector heat sources. Characteristics including mass, radiator area, thermal power, and operating temperatures for systems utilizing SP-100 reactor and CBC power conversion technology were determined for systems in the 10-to 100-kWe power range. Possible SP-100 reactor/CBC power system configurations are presented. Advantages of CBC power conversion technology with regard to reactor thermal power, operating temperature, and development status are discussed

  12. Ovos de Toxocara sp. e larvas de Ancylostoma sp. em praça pública de Lavras, MG Toxocara sp. eggs and Ancylostoma sp. larva in public parks, Brazil

    Directory of Open Access Journals (Sweden)

    Antônio Marcos Guimarães

    2005-04-01

    Full Text Available Larva migrans visceral e cutânea são zoonoses parasitárias causadas pela infecção da larva de Toxocara sp. e Ancylostoma sp., respectivamente. O objetivo do estudo foi verificar a contaminação por ovos de Toxocara sp. e ovos e larvas de Ancylostoma sp. em amostras de solos coletadas de praças públicas e de áreas de recreação infantil de Lavras, Estado de Minas Gerais, por meio da técnica de centrífugo-flutuação e do método de Baermann. A ocorrência de ovos de Toxocara sp. e, ovos e larvas de Ancylostoma sp. foi observada em 69,6% (16/23 das amostras de solo coletadas de praças públicas. A contaminação somente por ovos de Ancylostoma sp. em amostras de solo coletadas em escolas/creches foi de 22,2% (4/18. A percentagem de amostras de areia coletadas de escolas/creches contaminadas somente com larvas de Ancylostoma sp. foi de 11,1% (2/18. Praças públicas são as áreas com maior risco potencial de infecção por Toxocara sp. e Ancylostoma sp. Exame coproparasitológico realizado em 174 amostras de fezes de cães observou 58% e 23%, respectivamente, com ovos de Ancylostoma sp. e Toxocara sp.Visceral and cutaneous larva migrans are parasitic zoonoses caused by the infection of larval nematodes Toxocara sp. and Ancylostoma sp. respectively. The objective of this study was to investigate the contamination by Toxocara sp. eggs and Ancylostoma sp. eggs and larva of soil samples collected from public parks and children's playground areas in state of Minas Gerais, Brazil, using both Baermann's method and centrifugal flotation technique. Toxocara sp. and Ancylostoma sp. eggs were observed in soil samples collected from public squares in 17.4% (4/23 and 69.6 (16/23 respectively. In schools and child day care settings the contamination by Ancylostoma sp. larva in sand samples was 11.1% (2/18. Public parks are settings of more potential risk of Toxocara sp. eggs and Ancylostoma sp. infection. Stool parasitology testing of 174 stool

  13. Nitrogen fixation in Asaia sp. (family Acetobacteraceae).

    Science.gov (United States)

    Samaddar, Neeloy; Paul, Arundhati; Chakravorty, Somnath; Chakraborty, Writachit; Mukherjee, Joydeep; Chowdhuri, Debarati; Gachhui, Ratan

    2011-08-01

    The genus Asaia (family Acetobacteraceae) was first introduced with a single species-Asaia bogorensis and later six more species were described namely A. siamensis, A. krungthepensis, A. lannaensis, A. platycodi, A. prunellae, and A. astilbes. Acetobacteraceae family has been divided into ten genera but, only three of them include nitrogen fixing species: Gluconacetobacter, Acetobacter, and Swaminathania. This article originated from our study primarily aimed to isolate new endosymbiotic nitrogen fixer among Acetobacteraceae during which we have isolated, for the first time in India, four different strains of Asaia sp. from three different sources: Michalia champaca flower, Anopheles mosquito, and ant Tetraponera rufonigra. All the endosymbiotic strains isolated possess the ability to fix nitrogen. Evidence for both nitrogenase activity and the presence of nifH gene in isolated Asaia sp. is presented. Asaia bogorensis (MTCC 4041(T)) and A. siamensis (MTCC 4042(T)), two of the validated type strains available from the repository, were tested positive for the presence of functional nitrogenase. The nifH gene sequences from these type strains were also confirmed and compared with other nitrogen fixing members of the family Acetobacteraceae. Our result corroborate with the previous reports that Asaia sp. are indeed widely distributed in nature but this is the first time demonstration of their functional nitrogenase activity. This study shows Asaia sp. as fourth genera of nitrogen fixing bacteria in the family Acetobacteraceae.

  14. Molecular characterization of Trichoderma sp. isolated from ...

    African Journals Online (AJOL)

    The genetic relatedness among 15 isolates of Trichoderma sp. was analyzed with six micro-satellite primers. ISSR profiles showed 83.7% genetic diversity among the isolates with the formation of four clusters. Analysis of dendrogram revealed that similarity coefficient ranged from 0.27 to 0.95. ITS-PCR of rDNA region with ...

  15. Som man spørger

    DEFF Research Database (Denmark)

    Bjerg, Lars

    Indhold: Input og outputinterview ; Tre interviewtyper ; Tre grundprincipper ; De syv dødssynder ; Åbne, simple og neutrale spørgsmål ; Skuffespørgsmål ; Fokus ; Aktiv lytning ; Mål ; Strategi ; Abstrakt og konkret ; Det kritiske interview ; Kilder med et budskab ; Oldfruens fif ; Resumé i punktform...

  16. POTENSI MELANOTUS SP. DALAM MENDEGRADASI LIGNIN

    Directory of Open Access Journals (Sweden)

    NUNIK SULISTINAH

    2008-06-01

    Full Text Available Ten isolates of fungus were isolated from oil palm stem at oil palm plantation in Medan All of them were tested its abilities to degrade lignin. The results showed that one of them was able to grow on ligninase media and the fungi has the ability to degrade ligin. The fungi is identified as Melanotus sp.

  17. Biosorption of uranium by Azolla, SP, Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Ludmila C.; Alves, Eliakim G.; Marumo, Julio T., E-mail: lcvieira@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil); Ferreira, Rafael V. de P., E-mail: rafael@itatijuca.com [Itatijuca Biotech, Sao Paulo, SP (Brazil); Canevesi, Rafael L.S.; Silva, Edson A., E-mail: edson.silva2@unioeste.br [Universidade Estadual do Oeste Parana (UNIOESTE), Toledo, PR (Brazil)

    2015-07-01

    Radioactive liquid waste needs special attention and requires suitable treatment before deposition. Among the potential technologies under development for the treatment of liquid radioactive wastes the biosorption has been highlighted by being an efficient and low cost technique. Biosorption process involves the exchange of ions contained in the biomass matrix by others present in solution. There are many biomasses that could be applied in treatment of radioactive wastes, for example, agricultural residues and macrophyte. The aim of this study is evaluate the ability of the Azolla sp., a floating aquatic plant, to absorb uranium in solution. Azolla sp. is a macrophyte that has been used to treat effluents containing heavy metals. The biosorption capacity of uranium by Azolla sp. was experimentally determined and modeled by isotherms. Experiments were performed to determine metal uptake, and then the solutions were analyzed by inductively coupled plasma optical emission spectrometry (ICP-OES). The isotherms applied to model the data was Langmuir, Freundlich, Sips Toth, Redlich Peternson, Two-Site-Langmuir, Radke Prausnitz to develop a technique for the treatment of radioactive liquid waste generated at the Nuclear and Energy Research Institute (IPEN-CNEN/SP), Brazil. (author)

  18. Biosorption of uranium by Azolla, SP, Brazil

    International Nuclear Information System (INIS)

    Vieira, Ludmila C.; Alves, Eliakim G.; Marumo, Julio T.; Ferreira, Rafael V. de P.; Canevesi, Rafael L.S.; Silva, Edson A.

    2015-01-01

    Radioactive liquid waste needs special attention and requires suitable treatment before deposition. Among the potential technologies under development for the treatment of liquid radioactive wastes the biosorption has been highlighted by being an efficient and low cost technique. Biosorption process involves the exchange of ions contained in the biomass matrix by others present in solution. There are many biomasses that could be applied in treatment of radioactive wastes, for example, agricultural residues and macrophyte. The aim of this study is evaluate the ability of the Azolla sp., a floating aquatic plant, to absorb uranium in solution. Azolla sp. is a macrophyte that has been used to treat effluents containing heavy metals. The biosorption capacity of uranium by Azolla sp. was experimentally determined and modeled by isotherms. Experiments were performed to determine metal uptake, and then the solutions were analyzed by inductively coupled plasma optical emission spectrometry (ICP-OES). The isotherms applied to model the data was Langmuir, Freundlich, Sips Toth, Redlich Peternson, Two-Site-Langmuir, Radke Prausnitz to develop a technique for the treatment of radioactive liquid waste generated at the Nuclear and Energy Research Institute (IPEN-CNEN/SP), Brazil. (author)

  19. Carbon sp chains in graphene nanoholes

    DEFF Research Database (Denmark)

    Castelli, Ivano Eligio; Ferri, Nicola; Onida, Giovanni

    2012-01-01

    Nowadays sp carbon chains terminated by graphene or graphitic-like carbon are synthesized routinely in several nanotech labs. We propose an ab initio study of such carbon-only materials, by computing their structure and stability, as well as their electronic, vibrational and magnetic properties. We...

  20. Lipid contents of the sponge Haliclona sp.

    Digital Repository Service at National Institute of Oceanography (India)

    Parameswaran, P.S.; Das, B.; Kamat, S.Y.

    Several fatty acids, sterols, batyl alcohol and its analogs and an N-acylated sphingosine (ceramide) have been isolated from the lipid fraction of the extract of the sponge Haliclona sp. The major sterol is found to be cholesterol (54%), followed...

  1. Test af spørgeskema

    DEFF Research Database (Denmark)

    Hermansen, Jonathan

    2017-01-01

    Denne bog gennemgår alle surveyarbejdets faser og giver en praktisk indføring i •design af undersøgelsen og udvælgelse af stikprøver, •formulering af spørgeskemaer samt indsamling og kodning af data, •metoder til at analysere resultaterne....

  2. Botrallin from the endophytic fungus Hyalodendriella sp ...

    African Journals Online (AJOL)

    use

    2011-12-12

    Dec 12, 2011 ... Bioassay-guided fractionation of the crude methanol extract of the mycelia from the endophytic fungus. Hyalodendriella sp. Ponipodef12, associated with the hybrid 'Neva' of Populus deltoides Marsh × P. nigra L., led to the isolation of one compound coded as P12-1 which was identified as botrallin (1,7-.

  3. C (sp2)–C (sp2) cross coupling reaction catalyzed by a palladacycle ...

    Indian Academy of Sciences (India)

    (sp2) cross coupling reaction catalyzed by a palladacycle phosphine complex: A simple and sustainable protocol in aqueous media. Seyyed Javad Sabounchei Marjan Hosseinzadeh. Articles Volume 127 Issue 11 November 2015 pp 1919- ...

  4. Nanocrystalline sp{sup 2} and sp{sup 3} carbons: CVD synthesis and applications

    Energy Technology Data Exchange (ETDEWEB)

    Terranova, M. L. [Università degli Studi di Roma “Tor Vergata,” via Della Ricerca Scientifica, Dipartimento di Scienze e Tecnologie Chimiche—MinimaLab (Italy); Rossi, M. [Università degli Studi di Roma “Sapienza,” via A. Scarpa, Dipartimento di Scienze di Base e Applicate per l’Ingegneria and Centro di Ricerca per le Nanotecnologie Applicate all’Ingegneria (CNIS) (Italy); Tamburri, E., E-mail: emanuela.tamburri@uniroma2.it [Università degli Studi di Roma “Tor Vergata,” via Della Ricerca Scientifica, Dipartimento di Scienze e Tecnologie Chimiche—MinimaLab (Italy)

    2016-11-15

    The design and production of innovative materials based on nanocrystalline sp{sup 2}- and sp{sup 3}-coordinated carbons is presently a focus of the scientific community. We present a review of the nanostructures obtained in our labs using a series of synthetic routes, which make use of chemical vapor deposition (CVD) techniques for the selective production of non-planar graphitic nanostructures, nanocrystalline diamonds, and hybrid two-phase nanostructures.

  5. Analisis Fosfor pada Cacing Tanah (Megascolex sp. dan Fridericia sp.) Secara Spektrofotometri Sinar Tampak

    OpenAIRE

    Safira, Cut Shafa

    2015-01-01

    Earthworm is natural resource which can be used for medication due to its highly amount of minerals. One of these minerals is phosphorus. The aim of this research are to identify, determine and know the difference content of phosphorus in Megascolex sp. and Fridericia sp. Qualitative analysis shows positive results with addition of ammonium molybdate 4% and BaCl2 5%. Quantitative analysis was done using visible spectrophotometer with ascorbic acid method, measuring blu-colored molybdenum ...

  6. Differences in nutrient uptake capacity of the benthic filamentous algae Cladophora sp., Klebsormidium sp. and Pseudanabaena sp. under varying N/P conditions.

    Science.gov (United States)

    Liu, Junzhuo; Vyverman, Wim

    2015-03-01

    The N/P ratio of wastewater can vary greatly and directly affect algal growth and nutrient removal process. Three benthic filamentous algae species Cladophora sp., Klebsormidium sp. and Pseudanabaena sp. were isolated from a periphyton bioreactor and cultured under laboratory conditions on varying N/P ratios to determine their ability to remove nitrate and phosphorus. The N/P ratio significantly influenced the algal growth and phosphorus uptake process. Appropriate N/P ratios for nitrogen and phosphorus removal were 5-15, 7-10 and 7-20 for Cladophora sp., Klebsormidium sp. and Pseudanabaena sp., respectively. Within these respective ranges, Cladophora sp. had the highest biomass production, while Pseudanabaena sp. had the highest nitrogen and phosphorus contents. This study indicated that Cladophora sp. had a high capacity of removing phosphorus from wastewaters of low N/P ratio, and Pseudanabaena sp. was highly suitable for removing nitrogen from wastewaters with high N/P ratio. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Anomalous self potential (sp) log signatures observed in a water ...

    African Journals Online (AJOL)

    Geophysical logging was done after drilling had been completed in a water well at Okwudor, South Eastern Nigeria. Three electric logs were run viz: Self Potential (SP), Resistivity N16″ and N64″ logs. An anomaly was observed in the SP log. The SP results from this well show some deviation from the standard norm.

  8. Biosorption of chromium by mangrove-derived Aplanochytrium sp ...

    African Journals Online (AJOL)

    The microbial dried biomass of Thraustochytrids is used as bioadsorbent for the removal of the chromium in aqueous solution. In this investigation, three species of Thraustochydrids namely Aplanochytrium sp., Thraustochytrium sp. and Schizochytrium sp. were tested for the efficiency of chromium accumulation by culturing ...

  9. Babesia peircei sp. nov. from the jackass penguin

    African Journals Online (AJOL)

    1992-01-09

    Jan 9, 1992 ... An avian piroplasm, Babesia peircei sp. nov. is described from the jackass penguin Spheniscus demersus. Morphological differences between Babesia peircei sp. nov. and the other valid Babesia spp. are discussed together with the possible vectors. 'n Voal-piroplasma, Babesia peircei sp. nov. afkomstig ...

  10. Occurrence of Aspergillus sp., Fusarium sp., and aflatoxins in corn hybrids with different systems of storage

    Directory of Open Access Journals (Sweden)

    Adriana Sbardelotto Di Domenico

    2016-01-01

    Full Text Available The aim of this study was to assess alternatives for viable corn storage for small rural properties in two annual storage experiments. A 4×5 factorial design was used with four types of storage (conventional bags, hermetic bags, metal silos and corncobs and five periods of storage (0, 3, 6, 9 and 12 months. We used corn hybrids 2B688RR and 30K73Hx cultivated in winter 2012 and summer 2012/2013 in the city of Dois Vizinhos, Paraná, Brazil. The moisture contents, counts of Aspergillus sp. and Fusarium sp., and the occurrence of aflatoxins (B1, B2, G1 and G2 were assessed. The kernels stored in hermetic bags had lower moisture contents. Aspergillus sp. and Fusarium sp. were observed in 20.37 and 86.11% of winter storage samples, respectively, and in 83.3 and 91.6% of summer storage samples, respectively. The storage system and time of storage had no influence on the occurrence of Aspergillus sp. and aflatoxins in the winter crop samples. The corncobs from the summer crop samples had the lowest counts of Aspergillus sp. and did not have aflatoxins. We detected aflatoxins at concentrations of 2.8-14.5 and 3-197.5 µg kg-1 in the winter and summer crop samples, respectively.

  11. Two new species of suctorians, Acineta satyanandani sp. nov. and Paracineta karunakarani sp. nov. epizoic on ostracods

    Digital Repository Service at National Institute of Oceanography (India)

    Santhakumari, V.

    Two, species of protozoic suctorians, Acineta satyanandani sp. nov. and Paracineta karunakarani sp. nov., are described. These were found attached on the body of the marine ostracod, Cypridina dentata (Muller), collected from the shelf and slope...

  12. The family Carabodidae (Acari, Oribatida) VIII. The genus Machadocepheus (first part) Machadocepheusleoneae sp. n. and Machadocepheusrachii sp. n. from Gabon.

    Science.gov (United States)

    Fernandez, Nestor; Theron, Pieter; Rollard, Christine; Leiva, Sergio

    2014-01-01

    The genus Machadocepheus, being one of the more complex genera of the Carabodidae family, is briefly outlined to demonstrate this complexity. Descriptions of two new species from Gabon, Machadocepheusleoneae sp. n. and Machadocepheusrachii sp. n. are given.

  13. First report of Giardia sp. and Cryptosporidium sp. in fecal samples in blue macaw (Anodorhynchus hyacinthinus) in southern Brazil

    OpenAIRE

    Matheus Hillard Farret; Vinicius da Rosa Fanfa; Luisa Ragagnin; Aleksandro Schafer da Silva; Silvia Gonzalez Monteiro

    2010-01-01

    This study reports the gastrointestinal parasitism by Giardia sp. and Cryptosporidium sp. in blue macaw (Anodorhynchus hyacinthinus) in the southern region of Brazil. Fecal samples of two species kept in captivity in the state of Rio Grande do Sul were analyzed by the direct smear method, centrifugal flotation technique with zinc sulfate and Kinyoun staining technique for research of parasites. Mixed infection by eggs of Capillaria, cysts of Giardia sp. and oocysts of Cryptosporidium sp. was ...

  14. Agromyces italicus sp. nov., Agromyces humatus sp. nov. and Agromyces lapidis sp. nov., isolated from Roman catacombs.

    Science.gov (United States)

    Jurado, Valme; Groth, Ingrid; Gonzalez, Juan M; Laiz, Leonila; Schuetze, Barbara; Saiz-Jimenez, Cesareo

    2005-03-01

    A polyphasic study was carried out to clarify the taxonomic positions of three Gram-positive isolates from the Catacombs of Domitilla, Rome (Italy). 16S rRNA gene sequence comparisons placed these strains within the genus Agromyces. The morphological and chemotaxonomic characteristics of these isolates were consistent with the description of the genus Agromyces. The three isolates could be readily distinguished from one another and from representatives of all Agromyces species with validly published names by a broad range of phenotypic characteristics and DNA-DNA relatedness studies. Therefore, these isolates are proposed to represent three novel species of the genus Agromyces, Agromyces italicus sp. nov. (type strain CD1(T)=HKI 0325(T)=DSM 16388(T)=NCIMB 14011(T)), Agromyces humatus sp. nov. (type strain CD5(T)=HKI 0327(T)=DSM 16389(T)=NCIMB 14012(T)) and Agromyces lapidis sp. nov. (type strain CD55(T)=HKI 0324(T)=DSM 16390(T)=NCIMB 14013(T)).

  15. Cryptotrichosporon argae sp. nov., Cryptotrichosporon brontae sp. nov. and Cryptotrichosporon steropae sp. nov., isolated from forest soils.

    Science.gov (United States)

    Pontes, Ana; Röhl, Oliver; Maldonado, Cristina; Yurkov, Andrey M; Sampaio, José Paulo

    2017-09-01

    Yeast strains belonging to the basidiomycetous genus Cryptotrichosporon were isolated from forest soils in Serra da Arrábida Natural Park in Portugal. Similar to the already-known representatives of this genus, the new isolates formed pigmented colonies of a distinctive pale orange colour. Phylogenetic analyses employing concatenated sequences of the D1/D2 domains of the 26S (large subunit) rRNA gene and the internal transcribed spacer (ITS) region supported the recognition of three novel species: Cryptotrichosporon argae sp. nov. (type strain CM 19T=CBS 14376T=PYCC 7010T=DSM 104550T; MycoBank accession number MB 817168), Cryptotrichosporon brontae sp. nov. (type strain CM 1562T=CBS 14303T=PYCC 7011T=DSM 104551T; MycoBank accession number MB 817077) and Cryptotrichosporon steropae sp. nov. (type strain OR 395T=CBS 14302T=PYCC 7012T=DSM 104552T; MycoBank accession number MB 817078).

  16. Fitoremediasi limbah budidaya sidat menggunakan filamentous algae (Spirogyra sp.

    Directory of Open Access Journals (Sweden)

    Tri Apriadi

    2014-09-01

    Full Text Available Penelitian ini bertujuan untuk mengetahui potensi dari filamentous algae (Spirogyra sp. sebagai agen bioremediasi dalam mereduksi kandungan bahan organik limbah budidaya sidat. Penelitian menggunakan rancangan acak lengkap dengan perlakuan perbedaan dosis limbah (25 %, 50 %, 75 %, 100%. Wadah penelitian berupa akuarium resirkulasi menggunakan sistem carrousel. Dilakukan pengukuran secara rutin terhadap beberapa parameter kualitas air serta perubahan bobot Spirogyra sp. selama dua minggu retensi. Diperoleh hasil bahwa penurunan konsentrasi bahan organik menggunakan Spirogyra sp. berlangsung efektif hingga hari keenam. Spirogyra sp. mampu mentolelir limbah budidaya sidat pada dosis limbah 25% dan 50%. Spirogyra sp. pada perlakuan dosis limbah 50% memiliki kemampuan yang lebih baik dalam menurunkan bahan organik limbah budidaya sidat.

  17. A superhard sp3 microporous carbon with direct bandgap

    Science.gov (United States)

    Pan, Yilong; Xie, Chenlong; Xiong, Mei; Ma, Mengdong; Liu, Lingyu; Li, Zihe; Zhang, Shuangshuang; Gao, Guoying; Zhao, Zhisheng; Tian, Yongjun; Xu, Bo; He, Julong

    2017-12-01

    Carbon allotropes with distinct sp, sp2, and sp3 hybridization possess various different properties. Here, a novel all-sp3 hybridized tetragonal carbon, namely the P carbon, was predicted by the evolutionary particle swarm structural search. It demonstrated a low density among all-sp3 carbons, due to the corresponding distinctive microporous structure. P carbon is thermodynamically stable than the known C60 and could be formed through the single-walled carbon nanotubes (SWCNTs) compression. P carbon is a direct bandgap semiconductor displaying a strong and superhard nature. The unique combination of electrical and mechanical properties constitutes P carbon a potential superhard material for semiconductor industrial fields.

  18. Sp6 and Sp8 Transcription Factors Control AER Formation and Dorsal-Ventral Patterning in Limb Development

    Science.gov (United States)

    Haro, Endika; Delgado, Irene; Junco, Marisa; Yamada, Yoshihiko; Mansouri, Ahmed; Oberg, Kerby C.; Ros, Marian A.

    2014-01-01

    The formation and maintenance of the apical ectodermal ridge (AER) is critical for the outgrowth and patterning of the vertebrate limb. The induction of the AER is a complex process that relies on integrated interactions among the Fgf, Wnt, and Bmp signaling pathways that operate within the ectoderm and between the ectoderm and the mesoderm of the early limb bud. The transcription factors Sp6 and Sp8 are expressed in the limb ectoderm and AER during limb development. Sp6 mutant mice display a mild syndactyly phenotype while Sp8 mutants exhibit severe limb truncations. Both mutants show defects in AER maturation and in dorsal-ventral patterning. To gain further insights into the role Sp6 and Sp8 play in limb development, we have produced mice lacking both Sp6 and Sp8 activity in the limb ectoderm. Remarkably, the elimination or significant reduction in Sp6;Sp8 gene dosage leads to tetra-amelia; initial budding occurs, but neither Fgf8 nor En1 are activated. Mutants bearing a single functional allele of Sp8 (Sp6−/−;Sp8+/−) exhibit a split-hand/foot malformation phenotype with double dorsal digit tips probably due to an irregular and immature AER that is not maintained in the center of the bud and on the abnormal expansion of Wnt7a expression to the ventral ectoderm. Our data are compatible with Sp6 and Sp8 working together and in a dose-dependent manner as indispensable mediators of Wnt/βcatenin and Bmp signaling in the limb ectoderm. We suggest that the function of these factors links proximal-distal and dorsal-ventral patterning. PMID:25166858

  19. Bioakumulasi logam berat Cu oleh Bacillus sp

    Directory of Open Access Journals (Sweden)

    Riesta Primaharinastiti

    2012-02-01

    Full Text Available The research was conducted to investigate the ability of Bacillus sp in accumulating Cu and how much it can be acumulated. Themedium used to growth the bacterium was Nutrient Broth and Atomic Absorption Spectrophotometry methods was used to assay theCu, both in the cells and medium. The result of this study showed that Bacillus sp incubated in the Nutrient Broth medium containing10 ppm of Cu, with continuous stirring in the room temperature was able to reduce Cu in the medium 8.912–12.623% and accumulateCu in the cell 0.1149–0.1400 %/mg cells. Based on this result, it is necessary to develop more studies to find out what factors thatinfluence the accumulation process and to optimize the bioprocess.

  20. Analysis list: SP2 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available SP2 Blood,Liver,Pluripotent stem cell + hg19 http://dbarchive.biosciencedbc.jp/kyus...hu-u/hg19/target/SP2.1.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/target/SP2.5.tsv http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/target/SP2.10.tsv http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/SP2.B...lood.tsv,http://dbarchive.biosciencedbc.jp/kyushu-u/hg19/colo/SP2.Liver.tsv,http://dbarchive.bioscience...dbc.jp/kyushu-u/hg19/colo/SP2.Pluripotent_stem_cell.tsv http://dbarchive.biosciencedbc

  1. Superfield quantization in Sp(2) covariant formalism

    CERN Document Server

    Lavrov, P M

    2001-01-01

    The rules of the superfield Sp(2) covariant quantization of the arbitrary gauge theories for the case of the introduction of the gauging with the derivative equations for the gauge functional are generalized. The possibilities of realization of the expanded anti-brackets are considered and it is shown, that only one of the realizations is compatible with the transformations of the expanded BRST-symmetry in the form of super translations along the Grassmann superspace coordinates

  2. Carbon sp chains in graphene nanoholes

    Science.gov (United States)

    Castelli, Ivano E.; Ferri, Nicola; Onida, Giovanni; Manini, Nicola

    2012-03-01

    Nowadays sp carbon chains terminated by graphene or graphitic-like carbon are synthesized routinely in several nanotech labs. We propose an ab initio study of such carbon-only materials, by computing their structure and stability, as well as their electronic, vibrational and magnetic properties. We adopt a fair compromise of microscopic realism with a certain level of idealization in the model configurations, and predict a number of properties susceptible to comparison with experiment.

  3. Commercial technologies from the SP-100 program

    International Nuclear Information System (INIS)

    Truscello, V.C.; Fujita, T.; Mondt, J.F.

    1995-01-01

    For more than a decade, Jet Propulsion Labortory and Los Alamos have managed a multi-agency funded effort to develop a space reactor power system. This SP-100 Program has developed technologies required for space power systems that can be implemented in the industrial and commercial sectors to improve competitiveness in the global economy. Initial steps taken to transfer this technology from the laboratories to industrial and commercial entities within United States include: (1) identifying specific technologies having commercial potential; (2) distributing information describing the identified technologies and interacting with interested commercial and industrial entities to develop application-specific details and requirements; and (3) providing a technological data base that leads to transfer of technology or the forming of teaming arrangements to accomplish the transfer by tailoring the technology to meet application-specific requirements. SP-100 technologies having commercial potential encompass fabrication processes, devices, and components. Examples: a process for bonding refractory metals to graphite, a device to sense the position of an actuator and a component to enable rotating machines to operate without supplying lubrication (self-lubricating ball bearing). Shortly after the NASA Regional Technology Transfer Centers widely disseminated information covering SP-100 technologies, over one hundred expressions of interest were received, which indicate that there is a large potential benefit in transferring SP-100 technology. Interactions with industrial and commercial entities have identified a substantial need for creating teaming arrangements involving the interested entity and personnel from laboratories and their contractors, who have the knowledge and ability to tailor the technology to meet application-specific requirements. copyright 1995 American Institute of Physics

  4. Sterols from the Madagascar sponge Fascaplysinopsis sp.

    Science.gov (United States)

    Aknin, Maurice; Gros, Emmanuelle; Vacelet, Jean; Kashman, Yoel; Gauvin-Bialecki, Anne

    2010-12-17

    The sponge Fascaplysinopsis sp. (order Dictyoceratida, Family Thorectidae) from the west coast of Madagascar (Indian Ocean) is a particularly rich source of bioactive nitrogenous macrolides. The previous studies on this organism led to the suggestion that the latter should originate from associated microsymbionts. In order to evaluate the influence of microsymbionts on lipid content, 10 samples of Fascaplysinopsis sp. were investigated for their sterol composition. Contrary to the secondary metabolites, the sterol patterns established were qualitatively and quantitatively stable: 14 sterols with different unsaturated nuclei, Δ(5), Δ(7) and Δ(5,7), were identified; the last ones being the main sterols of the investigated sponges. The chemotaxonomic significance of these results for the order Dictyoceratida is also discussed in the context of the literature. The conjugated diene system in Δ(5,7) sterols is known to be unstable and easily photo-oxidized during storage and/or experiments to produce 5α,8α-epidioxy sterols. However, in this study, no 5α,8α-epidioxysterols (or only trace amounts) were observed. Thus, it was supposed that photo-oxidation was avoided thanks to the natural antioxidants detected in Fascaplysinopsis sp. by both the DPPH and β-caroten bleaching assays.

  5. Sterols from the Madagascar Sponge Fascaplysinopsis sp.

    Directory of Open Access Journals (Sweden)

    Yoel Kashman

    2010-12-01

    Full Text Available The sponge Fascaplysinopsis sp. (order Dictyoceratida, Family Thorectidae from the west coast of Madagascar (Indian Ocean is a particularly rich source of bioactive nitrogenous macrolides. The previous studies on this organism led to the suggestion that the latter should originate from associated microsymbionts. In order to evaluate the influence of microsymbionts on lipid content, 10 samples of Fascaplysinopsis sp. were investigated for their sterol composition. Contrary to the secondary metabolites, the sterol patterns established were qualitatively and quantitatively stable: 14 sterols with different unsaturated nuclei, D5, D7 and D5,7, were identified; the last ones being the main sterols of the investigated sponges. The chemotaxonomic significance of these results for the order Dictyoceratida is also discussed in the context of the literature. The conjugated diene system in D5,7 sterols is known to be unstable and easily photo-oxidized during storage and/or experiments to produce 5a,8a-epidioxy sterols. However, in this study, no 5a,8a-epidioxysterols (or only trace amounts were observed. Thus, it was supposed that photo-oxidation was avoided thanks to the natural antioxidants detected in Fascaplysinopsis sp. by both the DPPH and b-caroten bleaching assays.

  6. Syrian hamsters (Mesocricetus auratus) with simultaneous intestinal Giardia sp., Spironucleus sp., and trichomonad infections.

    Science.gov (United States)

    Sheppard, Barbara J; Stockdale Walden, Heather D; Kondo, Hirotaka

    2013-11-01

    A commercial facility producing hamsters with a history of infection by dwarf tapeworm (Hymenolepis nana) submitted 15 animals for necropsy and postmortem parasitological and microscopic examination. No tapeworms were detected grossly or microscopically. Fecal examination including gastrointestinal mucosal smears demonstrated mixed intestinal bacteria and low numbers of Giardia sp. Histologic examination of small intestine demonstrated filling of the small intestinal crypts by large numbers of 7-9 µm × 3 µm, rod to crescent or teardrop-shaped flagellates consistent with Spironucleus sp. These organisms had two 1-µm, basophilic, oval nuclei and multiple superficial flagella-like structures. Much larger 10-15 µm × 8-10 µm, oval to pear-shaped organisms were also present in lower numbers and usually located with the crypts. These larger flagellates had multiple flagella and a basophilic rod-shaped nucleus. The larger flagellates included Giardia sp., which had an intimate interface with the surface of the mucosal epithelium, bilaterally symmetry, and binucleation. Lower numbers of trichomonads were also present and were distinguished by an undulating surface membrane and a single nucleus. The mucosa was hyperplastic and moderately inflamed. Although the tapeworm infection was resolved, diagnosis of multiple intestinal flagellates by fecal examination is complicated by the varying sensitivity and diagnostic accuracy of different types of fecal analysis for different flagellate types. Key differences in the morphology and location of the different types of flagellates as observed by histology of intestinal tissues provide important additional diagnostic information to distinguish trichomonads, Spironucleus sp., and Giardia sp.

  7. Borrelia bissettiae sp. nov. and Borrelia californiensis sp. nov. prevail in diverse enzootic transmission cycles

    Science.gov (United States)

    Margos, Gabriele; Lane, Robert S.; Fedorova, Natalia; Koloczek, Johannes; Piesman, Joseph; Hojgaard, Andrias; Sing, Andreas; Fingerle, Volker

    2018-01-01

    Two species of the genus Borrelia, Borrelia bissettiae sp. nov. and Borrelia californiensis sp. nov., were first described by Postic and co-workers on the basis of genetic analyses of several loci. Multilocus sequence analysis of eight housekeeping loci confirmed that these two Borrelia genomospecies are distinct members of the Borrelia burgdorferi sensu lato complex. B. bissettiae sp. nov. was initially described in transmission cycles involving Neotoma fuscipes wood rats and Ixodes pacificus ticks in California, and Neotoma mexicana and Ixodes spinipalpis in Colorado. The preferred host of B. californiensis sp. nov. appears to be the California kangaroo rat, Dipodomys californicus; Ixodes jellisoni, I. spinipalipis and I. pacificus ticks are naturally infected with it. Thus, the ecological associations of the two genomospecies and their genetic distance from all other known Borrelia genomospecies species justify their description as separate genomospecies: B. bissettiae sp. nov. (type strain DN127T=DSM 17990T= CIP 109136T) and B. californiensis (type strain CA446T=DSM 17989T=ATCC BAA-2689T). PMID:26813420

  8. EFEKTIFITAS DAYA HAMBAT BAKTERI Streptomyces sp TERHADAP Erwinia sp PENYEBAB PENYAKIT BUSUK REBAH PADA TANAMAN LIDAH BUAYA (Aloe barbadensis Mill

    Directory of Open Access Journals (Sweden)

    SARMILA TASNIM

    2013-05-01

    Full Text Available Streptomyces sp was conducted from December 2010 - June 2011 at the Laboratoryof Microbiology, Biology Department, Math and Science Faculty, UdayanaUniversity Bukit Jimbaran-Bali. Implementation stages of the research consisted ofisolation and testing of the antibiotic activity Streptomyces sp to inhibit growthbacterial pathogens Erwinia sp as a cause of disease in plants fallen foul (Soft rot ofAloe barbadensis Mill.The results of this study have eight isolates of Streptomyces spwith macroscopic and microscopic characters are varied. Furthermore, all isolateswere obtained and then tested against antibiotic activity to inhibit growth the bacteriaErwinia sp. Test results obtained by Streptomyces sp that has the most effective ininhibiting the ability of the bacteria Erwinia sp isolates are Streptomyces sp2for (45%.

  9. SpAHA1 and SpSOS1 Coordinate in Transgenic Yeast to Improve Salt Tolerance.

    Directory of Open Access Journals (Sweden)

    Yang Zhou

    Full Text Available In plant cells, the plasma membrane Na+/H+ antiporter SOS1 (salt overly sensitive 1 mediates Na+ extrusion using the proton gradient generated by plasma membrane H+-ATPases, and these two proteins are key plant halotolerance factors. In the present study, two genes from Sesuvium portulacastrum, encoding plasma membrane Na+/H+ antiporter (SpSOS1 and H+-ATPase (SpAHA1, were cloned. Localization of each protein was studied in tobacco cells, and their functions were analyzed in yeast cells. Both SpSOS1 and SpAHA1 are plasma membrane-bound proteins. Real-time polymerase chain reaction (PCR analyses showed that SpSOS1 and SpAHA1 were induced by salinity, and their expression patterns in roots under salinity were similar. Compared with untransformed yeast cells, SpSOS1 increased the salt tolerance of transgenic yeast by decreasing the Na+ content. The Na+/H+ exchange activity at plasma membrane vesicles was higher in SpSOS1-transgenic yeast than in the untransformed strain. No change was observed in the salt tolerance of yeast cells expressing SpAHA1 alone; however, in yeast transformed with both SpSOS1 and SpAHA1, SpAHA1 generated an increased proton gradient that stimulated the Na+/H+ exchange activity of SpSOS1. In this scenario, more Na+ ions were transported out of cells, and the yeast cells co-expressing SpSOS1 and SpAHA1 grew better than the cells transformed with only SpSOS1 or SpAHA1. These findings demonstrate that the plasma membrane Na+/H+ antiporter SpSOS1 and H+-ATPase SpAHA1 can function in coordination. These results provide a reference for developing more salt-tolerant crops via co-transformation with the plasma membrane Na+/H+ antiporter and H+-ATPase.

  10. Copper resistance of different ectomycorrhizal fungi such as Pisolithus microcarpus, Pisolithus sp., Scleroderma sp. and Suillus sp.

    Directory of Open Access Journals (Sweden)

    R.F. Silva

    2013-01-01

    Full Text Available Environments contaminated with heavy metals negatively impact the living organisms. Ectomycorrhizal fungi have shown important role in these impacted sites. Thus, this study aimed to evaluate the copper-resistance of ectomycorrhizal fungi isolates Pisolithus microcarpus - UFSC-Pt116; Pisolithus sp. - UFSC-PT24, Suillus sp. - UFSM RA 2.8 and Scleroderma sp. - UFSC-Sc124 to different copper doses in solid and liquid media. The copper doses tested were: 0.00, 0.25, 0.5, 0.75, 1.0 and 1.25 mmol L-1 in the solid medium and 0.00, 0.32, 0.64 and 0.96 mmol L-1 in the liquid medium. Copper was amended as copper sulphate in order to supplement the culture medium MNM at pH 4.8, with seven replicates to each fungus-dose combination. The fungal isolates were incubated for 30 days at 28 °C. UFSC-Pt116 showed high copper-resistance such as accessed by CL50 determinations (concentration to reduce 50% of the growth as while as UFSC-PT24 displayed copper-resistance mechanism at 0.50 mmol L-1 in solid medium. The UFSC-PT24 and UFSC-Sc124 isolates have increased copper-resistance in liquid medium. The higher production of extracellular pigment was detected in UFSC-Pt116 cultures. The UFSC-Pt116 and UFSC-PT24 isolates showed higher resistance for copper and produced higher mycelium biomass than the other isolates. In this way, the isolates UFSG-Pt116 and UFSC-PT24 can be important candidates to survive in copper-contaminated areas, and can show important role in plants symbiosis in these contaminated sites.

  11. Isolation of C11 Cyclopentenones from Two Didemnid Species, Lissoclinum sp. and Diplosoma sp.

    Directory of Open Access Journals (Sweden)

    Katsuhiro Ueda

    2009-12-01

    Full Text Available A series of new C11 cyclopentenones 1-7 was isolated, together with four known metabolites 9/10, 12 and 13, from the extract of the didemnid ascidian Lissoclinum sp. The other didemnid ascidian Diplosoma sp. contained didemnenones 1, 2 and 5, and five known metabolites 8-12. The structures of 1-7 were elucidated by spectroscopic analyses. Cytotoxicity of the isolated compounds was evaluated against three human cancer cell lines (HCT116, A431 and A549.

  12. Construction of human MASP-2-CCP1/2SP, CCP2SP, SP plasmid DNA nanolipoplexes and the effects on tuberculosis in BCG-infected mice.

    Science.gov (United States)

    Gao, Qi; Dong, Xinfang; Luo, Yanping; Zhang, Guochao; Shan, Jinyu; Wang, Qian; He, Qi; Zhang, Lifeng; Wang, Jingqiu; Zhu, Bingdong; Ma, Xingming

    2017-08-01

    The lectin pathway, one of the complement cascade systems, provides the primary line of defense against invading pathogens. The serine protease of MASP-2 plays an essential role in complement activation of the lectin pathway. The C-terminal segment of MASP-2 is comprised of the CCP1-CCP2-SP domains, and is the crucial catalytic segment. However, what is the effect of CCP1-CCP2-SP domains in controlling chronic infection is unknown. In order to evaluate the potential impact of CCP1-CCP2-SP domains on tuberculosis, we constructed the human MASP-2 CCP1/2SP, CCP2SP and SP recombinant plasmids, and delivered these plasmids by DNA-DOTAP:cholesterol cationic nanolipoplexes to BCG-infected mice. After 21 days post DNA-DOTAP:chol nanolipoplexes application, we analyzed bacteria loads of pulmonary, pathology of granuloma, lymphocyte subpopulations. The C3a, C4a and MASP-2 levels in serum were measured with enzyme-linked immunosorbent assays. Compared to the control group that received GFP DNA-DOTAP:chol nanolipoplexes, MASP-2 CCP1/2SP DNA-DOTAP:chol nanolipoplexes treated group showed significantly enlarged pulmonary granulomas lesion (P  0.05). These findings provided experimental evidence that MASP-2 CCP1/2SP DNA nanolipoplexes shown the negative efficacy in controlling Mycobacterium tuberculosis infection, and displayed a potential role of down-regulating T-cell-mediated immunity in tuberculosis. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Quality improvement on half-fin anchovy (Setipinna taty) fish sauce by Psychrobacter sp. SP-1 fermentation.

    Science.gov (United States)

    Zheng, Bin; Liu, Yu; He, Xiaoxia; Hu, Shiwei; Li, Shijie; Chen, Meiling; Jiang, Wei

    2017-10-01

    A method of improving fish sauce quality during fermentation was investigated. Psychrobacter sp. SP-1, a halophilic protease-producing bacterium, was isolated from fish sauce with flavor-enhancing properties and non-biogenic amine-producing activity. The performance of Psychrobacter sp. SP-1 in Setipinna taty fish sauce fermentation was investigated further. The inoculation of Psychrobacter sp. SP-1 did not significantly affect pH or NaCl concentration changes (P > 0.05), although it significantly increased total moderately halophilic microbial count, protease activity, total soluble nitrogen content and amino acid nitrogen content, and also promoted the umami taste and meaty aroma (P < 0.05). Furthermore, the inoculation of Psychrobacter sp. SP-1 significantly decreased total volatile basic nitrogen content and biogenic amines content (P < 0.05), which were regarded as harmful compounds in foods. The results of the present study demonstrate that Psychrobacter sp. SP-1 can be used as a potential starter culture for improving fish sauce quality by fermentation. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  14. Dominancy of Trichodesmium sp. in the Biawak Island

    Science.gov (United States)

    Prihadi, D. J.

    2018-03-01

    The Biawak Island is one of the small islands in West Java Province with an abundance of marine biological resources. This research was conducted to collect the primary producer zooplankton and water quality parameters. Direct observation is done by field surveys and measurement in situ for plankton and environmental parameters such as temperature, water transparency, water current, salinity, dissolved oxygen, and pH. Trichodesmium sp. was found dominance in where some other types of zooplankton were found in the area, like Scenedesmus sp., Sagitta sp., Acartia sp. also occurred. Further, the most abundance of Trichodesmium sp. was found in southern of Biawak Island where mangroves, coral and seagrass ecosystem provide nutrients which indirectly support the abundance of planktons. Trichodesmium sp. is plankton that can survive in water with minimum nutrient.

  15. The SP Theory of Intelligence: An Overview

    Directory of Open Access Journals (Sweden)

    J Gerard Wolff

    2013-08-01

    Full Text Available This article is an overview of the SP theory of intelligence, which aims to simplify and integrate concepts across artificial intelligence, mainstream computing and human perception and cognition, with information compression as a unifying theme. It is conceived of as a brain-like system that receives "New" information and stores some or all of it in compressed form as "Old" information; and it is realised in the form of a computer model, a first version of the SP machine. The matching and unification of patterns and the concept of multiple alignment are central ideas. Using heuristic techniques, the system builds multiple alignments that are "good" in terms of information compression. For each multiple alignment, probabilities may be calculated for associated inferences. Unsupervised learning is done by deriving new structures from partial matches between patterns and via heuristic search for sets of structures that are "good" in terms of information compression. These are normally ones that people judge to be "natural", in accordance with the "DONSVIC" principle—the discovery of natural structures via information compression. The SP theory provides an interpretation for concepts and phenomena in several other areas, including "computing", aspects of mathematics and logic, the representation of knowledge, natural language processing, pattern recognition, several kinds of reasoning, information storage and retrieval, planning and problem solving, information compression, neuroscience and human perception and cognition. Examples include the parsing and production of language with discontinuous dependencies in syntax, pattern recognition at multiple levels of abstraction and its integration with part-whole relations, nonmonotonic reasoning and reasoning with default values, reasoning in Bayesian networks, including "explaining away", causal diagnosis, and the solving of a geometric analogy problem.

  16. Early SP-100 flight mission designs

    International Nuclear Information System (INIS)

    Josloff, A.T.; Shepard, N.F.; Kirpich, A.S.; Murata, R.; Smith, M.A.; Stephen, J.D.

    1993-01-01

    Early flight mission objectives can be met with a Space Reactor Power System (SRPS) using thermoelectric conversion in conjunction with fast spectrum, lithium-cooled reactors. This paper describes two system design options using thermoelectric technology to accommodate an early launch. In the first of these options, radiatively coupled Radioiosotope Thermoelectric Generator (RTG) unicouples are adapted for use with a SP-100-type reactor heat source. Unicouples have been widely used as the conversion technology in RTGs and have demonstrated the long-life characteristics necessary for a highly relible SRPS. The thermoelectric leg height is optimized in conjunction with the heat rejection temperature to provide a mass optimum 6-kW e system configured for launch on a Delta II launch vehicle. The flight-demonstrated status of this conversion technology provides a high confidence that such a system can be designed, assembled, tested, and launched by 1997. The use of a SP-100-type reactor assures compliance with safety requirements and expedites the flight safety approval process while, at the same time, providing flight performance verification for a heat source technology with the growth potential to meet future national needs for higher power levels. A 15-kW 2 , Atlas IIAS-launched system using the compact, conductively coupled multicouple converters being developed under the SP-100 program to support an early flight system launch also described. Both design concepts have been scaled to 20-kW e in order to support recent studies by DOE/NASA for higher power early launch missions

  17. Amino Alcohols from the Ascidian Pseudodistoma sp.

    Directory of Open Access Journals (Sweden)

    Tae Hyung Won

    2014-06-01

    Full Text Available Seven new amino alcohol compounds, pseudoaminols A–G (1–7, were isolated from the ascidian Pseudodistoma sp. collected off the coast of Chuja-do, Korea. Structures of these new compounds were determined by analysis of the spectroscopic data and from chemical conversion. The presence of an N-carboxymethyl group in two of the new compounds (6 and 7 is unprecedented among amino alcohols. Several of these compounds exhibited moderate antimicrobial activity and cytotoxicity, as well as weak inhibitory activity toward Na+/K+-ATPase.

  18. SP-100 control drive assembly development

    Science.gov (United States)

    Gleason, Thomas; Gilchrist, A. Richard; Schuster, Gary

    1993-01-01

    The SP-100 is an electrical generating nuclear power system for space operation. This paper describes the nuclear reactor control systems and the methods used to assure reliable performance for the 10-year design life. Reliable performance is achieved by redundancy and by selecting highly reliable components and design features. Reliability is quantified by analysis using established reliability data. Areas lacking reliability data are identified for development testing. A specific development test description is provided as an example to demonstrate how this process is meeting the system reliability goals.

  19. ANCAMAN DARI NYAMUK Culex sp YANG TERABAIKAN

    Directory of Open Access Journals (Sweden)

    Zumrotus Sholichah

    2012-11-01

    Full Text Available Nyamuk Culex sp lebih menyukai meletakkan telurnya pada genangan air berpolutan tinggi, berkembang biak di air keruh dan lebih menyukai genangan air yang sudah lama daripada genangan air yang baru. Aktif menggigit pada malam hari. Tempat yang gelap, sejuk dan lembab merupakan tempat yang disukai untuk beristirahat. Nyamuk betina dewasa menggigit dengan abdomen terletak sejajar dengan permukaan induk semang yang sedang digigit.Gangguan yang ditimbulkan oleh nyamuk selain dapat menularkan penyakit juga dapat sangat mengganggu dengan dengungan dan gigitannya sehingga bagi orang-orang tertentu dapat menimbulkan phobi (entomopobhia serta dapat menyebabkan dermatitis dan urticaria.

  20. Methyl (Sp-2-(diphenylphosphinoferrocene-1-carboxylate

    Directory of Open Access Journals (Sweden)

    Petr Štěpnička

    2009-10-01

    Full Text Available The title compound, [Fe(C5H5(C19H16O2P], obtained serendipitously during recrystallization of 1-hydroxybenzotriazolyl (Sp-2-(diphenylphosphinoferrocene-1-carboxylate from methanol, crystallizes in the chiral space group P212121. Its crystal structure not only confirms the anticipated absolute configuration but also establishes a rather regular geometry for the ferrocene unit, devoid of any significant deformation due to the attached substituents. In the crystal, symmetry-related molecules are linked via weak C—H...O interactions.

  1. Genome Sequence of Streptomyces sp. Strain Tü6071▿

    OpenAIRE

    Erxleben, Anika; Wunsch-Palasis, Julia; Grüning, Björn A.; Luzhetska, Marta; Bechthold, Andreas; Günther, Stefan

    2011-01-01

    Streptomyces sp. Tü6071 is a soil-dwelling bacterium which has a highly active isoprenoid biosynthesis. Isoprenoids are important precursors for biopharmaceutical molecules such as antibiotics or anticancer agents, e.g., landomycin. Streptomyces sp. Tü6071 produces the industrially important terpene glycosides phenalinolactones, which have antibacterial activity against several Gram-positive bacteria. The availability of the genome sequence of Streptomyces sp. Tü6071 allows for understanding ...

  2. Screening of biodiesel production from waste tuna oil (Thunnus sp.), seaweed Kappaphycus alvarezii and Gracilaria sp.

    Science.gov (United States)

    Alamsjah, Mochammad Amin; Abdillah, Annur Ahadi; Mustikawati, Hutami; Atari, Suci Dwi Purnawa

    2017-09-01

    Biodiesel has several advantages over solar. Compared to solar, biodiesel has more eco-friendly characteristic and produces lower greenhouse gas emissions. Biodiesel that is made from animal fats can be produced from fish oil, while other alternative sources from vegetable oils are seaweed Kappaphycus alvarezii and Gracilaria sp. Waste tuna oil (Thunnus sp.) in Indonesia is commonly a side product of tuna canning industries known as tuna precook oil; on the other hand, seaweed Gracilaria sp. and Kappaphycus alvarezii are commonly found in Indonesia's seas. Seaweed waste that was used in the present study was 100 kg and in wet condition, and the waste oil was 10 liter. The seaweed was extracted with soxhletation method that used n-hexane as the solvent. To produce biodiesel, trans esterification was performed on the seaweed oil that was obtained from the soxhletation process and waste tuna oil. Biodiesel manufactured from seaweed K. alvarezii obtained the best score in flash point, freezing point, and viscosity test. However, according to level of manufacturing efficiency, biodiesel from waste tuna oil is more efficient and relatively easier compared to biodiesel from waste K. alvarezii and Gracilaria sp.

  3. SHEAR STRENGTH IN THE GLUE LINE OF Eucalyptus sp. AND Pinus sp.WOOD

    Directory of Open Access Journals (Sweden)

    Juliana Jerásio Bianche

    Full Text Available ABSTRACT To evaluate the adhesive efficiency on the union of glued joints in a particular temperature and humidity conditions for a specified time the adhesive must be submitted to specific load tests, such as shear in the glue line. The objective of this study was to evaluate the shear strength in the glue line of Eucalyptus sp and Pinus sp.woods. Five adhesives (castor oil, sodium silicate, modified silicate, , PVA and resorcinol-formaldehyde, three weights (150 g/m2, 200 g/m2, and 250 g/m2 and two species (Eucalyptus sp. and Pinus sp. of wood were used. Twelve specimens were obtained from each repetition per treatment, corresponding to 108 specimens that were conditioned at a temperature of 23 ± 1°C and relative humidity of 50 ± 2%. The interaction between the weight and type of adhesive was significant for the shear strength in the glue line of eucalyptus wood. However, no interaction between the weight and the adhesive was found for pinus, only the isolated from the adhesive effect. Chemical bonds originated in the polymerization of resorcinol-formaldehyde adhesives and castor bi-component conferred upon these adhesives the greatest resistance in the glue line. Castor and resorcinol-formaldehyde adhesives showed the highest shear strength values in the line of glue and wood failure. Castor adhesive presented satisfactory performance for bonding of eucalyptus and pine woods.

  4. Genetic diversity in Fusarium oxysporum f.sp. dianthi and F. redolens f.sp. dianthi

    NARCIS (Netherlands)

    Baayen, R.P.; Dreven, van F.; Krijger, M.C.; Waalwijk, C.

    1997-01-01

    Pathogenic isolates were selected representing all known vegetative compatibility groups (VCGs) and races of Fusarium oxysporum sensu lato from Dianthus spp. On basis of differences in the internal transcribed spacer region of the ribosomal DNA, six VCGs were classified as F. oxysporum f.sp. dianthi

  5. Biodegradation of hexavalent chromium (Cr+6) in wastewater using Pseudomonas sp. and Bacillus sp. bacterial strains

    Energy Technology Data Exchange (ETDEWEB)

    Qasim, Muhammad [Department of Chemical Engineering, American University of Sharjah (United Arab Emirates)

    2013-07-01

    The recovery of toxic metal compounds is a deep concern in all industries. Hexavalent chromium is particularly worrying because of its toxic influence on human health. In this paper, biodegradation of hexavalent chromium (Cr+6) present in wastewater has been studied using two different bacterial strains; Pseudomonas sp. and Bacillus sp. A chemostat (with and without recycle of cells) with 10 L liquid culture volume was used to study the substrate and the biomass cell concentrations with time. Also, the degree of substrate conversion was studied by the varying the dilution rate as an independent parameter. The dilution rate (ratio of feed flow rate to the culture volume) was varied by varying the feed volumetric rate from 110-170 mL/h for inlet hexavalent chromium concentrations of 70 mg/dm3. The results show that a chemostat with recycle gives a better performance in terms of substrate conversion than a chemostat without a recycle. Moreover, the degree of substrate conversion decreases as the dilution rate is increased. Also, Bacillus sp. was found to give higher conversions compared to pseudomonas sp.

  6. Sp(2) covariant quantisation of general gauge theories

    International Nuclear Information System (INIS)

    Vazquez-Bello, J.L.

    1994-11-01

    The Sp(2) covariant quantization of gauge theories is studied. The geometrical interpretation of gauge theories in terms of quasi principal fibre bundles Q(M s , G s ) is reviewed. It is then described the Sp(2) algebra of ordinary Yang-Mills theory. A consistent formulation of covariant Lagrangian quantisation for general gauge theories based on Sp(2) BRST symmetry is established. The original N = 1, ten dimensional superparticle is considered as an example of infinitely reducible gauge algebras, and given explicitly its Sp(2) BRST invariant action. (author). 18 refs

  7. Lagenidium callinectes INFECTION ON ROTIFERS Brachionus sp.

    Directory of Open Access Journals (Sweden)

    Des Roza

    2007-06-01

    Full Text Available Milkfish, Chanos chanos and humpback grouper, Cromileptes altivelis hatcheries have developed at Gondol, Bali since 1995 and until now still rely on rotifers, the main natural food, supply. Recent problem on mass culture of rotifer, Brachionus sp. is harvest failure caused by fungus infection. Under light microscope, infected eggs and bodies of the rotifers was filled with numerous aseptate hyphae. Two isolates of fungi were isolated from rotifer eggs and carcass on June 21st, 2004 and on June 25th, 2004 obtained from milkfish and humpback grouper hatcheries at Gondol. Based on its morphological characteristics, the pathogenic fungus was identified as Lagenidium callinectes which grows optimally at 25°C and survives in 1.0%, 2.5%, and 5.0% NaCl as well as in 1.0% and 2.5% KCl. Both of the present isolates utilize only 8 out of 26 carbohydrates and derivatives tested as carbon, nutrition and energy sources. This finding is the first report on rotifer, Brachionus sp. infected with L. callinectes causing up to 100% mortality.

  8. Polyhydroxybutyrate by Streptomyces sp.: Production and characterization.

    Science.gov (United States)

    Krishnan, Sivakumar; Chinnadurai, Gandhi Shree; Perumal, Palani

    2017-11-01

    A total number of 20 actinomycetes isolates were isolated from soil sediments obtained from Semmancheri coastal areas of Bay of Bengal, India and they were qualitatively screened for the production of polyhydroxybutyrate (PHB) on a medium containing Sudan black stain. Nine of the 20 isolates produced PHB and the quantity of PHB produced varied from 1.79 to 4.26g -L . Among the positive isolates an actinomycete isolate which was identified as Streptomyces sp. through 16S rRNA sequencing analysis (Accession No: KF667247) produced relatively higher PHB than other positive isolates. Subsequently, the growth conditions were optimized for the maximum PHB production by the chosen organism. Attempt was also made to utilize natural carbon sources such as paddy straw, wheat bran, rice bran, sugarcane molasses and oil cake for the production of PHB in an attempt to reduce the cost production of PHB. The purified PHB was analyzed by Solid-State 13 C NMR, Fourier Transformed Infrared spectroscopy, Powder X-ray diffraction, Thermogravimetric Analysis, Scanning and Transmission Electron Microscopic analyses to determine the structure, crystallinity, purity and thermal stability. The present investigation has revealed that Streptomyces sp. could be a potential source for the production of PHB with desirable characteristics and could also be exploited for the industrial production. Copyright © 2017. Published by Elsevier B.V.

  9. Fluorescence Properties of Chlorella sp. Algae

    Directory of Open Access Journals (Sweden)

    Tibor Teplicky

    2017-01-01

    Full Text Available Water quality and its fast and reliable monitoring is the challenge of the future. Design of appropriate biosensors that would be capable of non-invasive identification of water pollution is an important prerequisite for such challenge. Chlorophylls are pigments, naturally presented in all plants that absorb light. The main forms of chlorophyll in algae are chlorophyll a and chlorophyll b, other pigments include xantophylls and beta-carotenes. Our aim was to characterize endogenous fluorescence of the Chlorella sp. algae, present naturally in drinking water. We recorded spatial, spectral and lifetime fluorescence distribution in the native algae. We noted that the fluorescence was evenly distributed in the algae cytosol, but lacked in the nucleus and reached maximum at 680-690 nm. Fluorescence decay of chlorella sp. was double-exponential, and clearly shorter than that of its isolated pigments. For the first time, fluorescence lifetime image of the algae is presented. Study of the fluorescence properties of algae is aimed at the improvement of water supply contamination detection and cleaning.

  10. Karakterisasi protease Bacillus sp. UGM5

    Directory of Open Access Journals (Sweden)

    Titik Purwati Widowati

    1999-07-01

    Full Text Available The objective of this experiment is to indentify the characters of proetease produced by Bacillus sp.UGM5.the protease secreted by Bacillus sp.UGM5 was first isolated,purified and then charactirezed.The crude enzyme has spesific actifity of 1.14 U/mg,however,the spesific activity of purified enzyme was increased by 23.8 times fold and recovery was 33.69%.The Page of nondenatured crude enzymes showes two type of proreases,however ,the SDS-Page of denatured purified enzyme showed four protein-bends with molecular weights of 55.5 kDa,18kDa respecetively.The optimum pH and temperature for the enzyme acrivity are 8.5 and 420C and belongs to serin protease type,with Km 3 X 10-3mM and Vmax 0.0890mM/30 minutes.The activity is not inhibited by Ca+2,Fe+2 and EDTA.

  11. UTILIZAÇÃO DE ADESIVO PVA EM COMPENSADOS DE Pinus sp. E Eucalyptus sp. / UTILIZATION OF PVA ADHESIVES IN Pinus sp. and Eucalyptus sp. PLYWOOD

    Directory of Open Access Journals (Sweden)

    C. I. De Campos

    2014-12-01

    Full Text Available Estudos sobre novos adesivos ou resinas para colagem de madeira e derivados estão sendo realizados com a intenção de diminuir o impacto ambiental sem alterar suas propriedades. Por este motivo, novas formulações de adesivos PVA (Acetato de Polivinila vêm sendo desenvolvidas. Este trabalho testou a utilização deste adesivo na produção de compensado de Eucalyptus sp. e Pinus sp., com tempo e temperatura de prensagem, respectivamente, de 10 minutos e90°C. Foram realizados os ensaios físicos de densidade, teor de umidade e absorção, e os ensaios mecânicos de flexão estática e de resistência ao cisalhamento na linha de cola, todos de acordo com as normas ABNT. Obtiveram-se bons resultados com relação à resistência ao cisalhamento na linha de cola, a qual foi superior para os adesivos PVA, se comparados com compensados produzidos com ureia-formaldeído e o fenol-formaldeído, enquanto que os resultados de MOE e MOR apresentaram-se inferiores em ambos os casos. 

  12. The Effect of Acupuncture to SP6 on Skin Temperature Changes of SP6 and SP10: An Observation of “Deqi”

    Directory of Open Access Journals (Sweden)

    Jia-Min Yang

    2014-01-01

    Full Text Available Background. Deqi sensation is a complex but an important component for acupuncture effect. In this study, we tried to observe the relationship between Deqi and skin temperature changes and whether there was some relativity between Deqi and needle stimulations on cold congealing and dysmenorrhea rat model. Thirty-two female Sprague Dawley (SD rats were randomly divided into four groups (Saline Control Group, Model Group, Group A with strong stimulation, and Group B with small stimulation. Group A and Group B were performed with different stimulations. We found that, compared with saline control group, model group, and Group B, Group A showed that the skin temperature changes on right acupoint SP6 and SP10 increased significantly at 5 min–10 min interval. The skin temperature changes on left SP6 decreased at instant–5 min interval. The skin temperature changes on right SP10 decreased significantly at instant–5 min interval and 10 min–20 min interval. Thermogenic action along Spleen Meridian of Foot Greater Yin was manifested as simultaneous skin temperature increase on right SP6 and SP10 at 5 min–10 min interval after needling SP6, which was helpful to illustrate the relationship between the characteristic of Deqi and needle stimulations.

  13. First report of Giardia sp. and Cryptosporidium sp. in fecal samples in blue macaw (Anodorhynchus hyacinthinus in southern Brazil

    Directory of Open Access Journals (Sweden)

    Matheus Hillard Farret

    2010-09-01

    Full Text Available This study reports the gastrointestinal parasitism by Giardia sp. and Cryptosporidium sp. in blue macaw (Anodorhynchus hyacinthinus in the southern region of Brazil. Fecal samples of two species kept in captivity in the state of Rio Grande do Sul were analyzed by the direct smear method, centrifugal flotation technique with zinc sulfate and Kinyoun staining technique for research of parasites. Mixed infection by eggs of Capillaria, cysts of Giardia sp. and oocysts of Cryptosporidium sp. was observed. This is the first report this protozoa in blue macaw.

  14. Integrative Gene Cloning and Expression System for Streptomyces sp. US 24 and Streptomyces sp. TN 58 Bioactive Molecule Producing Strains

    Directory of Open Access Journals (Sweden)

    Samiha Sioud

    2009-01-01

    Full Text Available Streptomyces sp. US 24 and Streptomyces sp. TN 58, two strains producing interesting bioactive molecules, were successfully transformed using E. coli ET12567 (pUZ8002, as a conjugal donor, carrying the integrative plasmid pSET152. For the Streptomyces sp. US 24 strain, two copies of this plasmid were tandemly integrated in the chromosome, whereas for Streptomyces sp. TN 58, the integration was in single copy at the attB site. Plasmid pSET152 was inherited every time for all analysed Streptomyces sp. US 24 and Streptomyces sp. TN 58 exconjugants under nonselective conditions. The growth, morphological differentiation, and active molecules production of all studied pSET152 integrated exconjugants were identical to those of wild type strains. Consequently, conjugal transfer using pSET152 integration system is a suitable means of genes transfer and expression for both studied strains. To validate the above gene transfer system, the glucose isomerase gene (xylA from Streptomyces sp. SK was expressed in strain Streptomyces sp. TN 58. Obtained results indicated that heterologous glucose isomerase could be expressed and folded effectively. Glucose isomerase activity of the constructed TN 58 recombinant strain is of about eighteenfold higher than that of the Streptomyces sp. SK strain. Such results are certainly of importance due to the potential use of improved strains in biotechnological process for the production of high-fructose syrup from starch.

  15. Microfungi on the Pandanaceae: Linocarpon lammiae sp. nov., L. siamensis sp. nov. and L. suthepensis sp. nov. are described with a key to Linocarpon species from the Pandanaceae.

    Science.gov (United States)

    Thongkantha, S; Lumyong, S; Lumyong, P; Whitton, S R; McKenzie, E H C; Hyde, K D

    2003-01-01

    Linocarpon species are reported from Pandanaceae in Australia, Brunei, Hong Kong, Nepal, New Zealand, Philippines, Seychelles, Thailand and Vanuatu. Linocarpon lammiae sp. nov. were collected on decaying leaves of Pandanus tectorius in Hong Kong. Linocarpon siamensis sp. nov. and L. suthepensis sp. nov. were collected from decaying leaves of P. penetrans in Thailand. These taxa are described, illustrated and compared with Linocarpon species with similar ascospore morphology and dimensions. Included are a synoptic table, which compares the new species to similar known species, and a dichotomous key to species of Linocarpon known from members of the Pandanaceae.

  16. 75 FR 42411 - Orders Finding That the SP-15 Financial Day-Ahead LMP Peak Daily Contract; SP-15 Financial Day...

    Science.gov (United States)

    2010-07-21

    ... COMMODITY FUTURES TRADING COMMISSION Orders Finding That the SP-15 Financial Day-Ahead LMP Peak Daily Contract; SP-15 Financial Day-Ahead LMP Off-Peak Daily Contract; SP-15 Financial Swap Real Time...-Peak Daily (``SQP'') contract; SP-15 Financial Swap Real Time LMP-Peak Daily (``SRP'') contract; NP-15...

  17. Kroyeria deetsi n.sp. (Kroyeriidae: Siphonostomatoida), a parasitic ...

    African Journals Online (AJOL)

    Kroyeria deetsi n.sp. (Kroyeriidae: Siphonostomatoida) is described from both sexes collected from the gills of spinner sharks, Carcharhinus brevipinna (Müller & Henle, 1839), captured in the Indian Ocean off the coast of South Africa. Kroyeria deetsi n.sp. can easily be distinguished from all of its congeners because the ...

  18. Evaluation of Cr (VI) remediation potential of Eichornia sp in ...

    African Journals Online (AJOL)

    Purpose: Evaluation of Cr (VI) removal by indigenous chromium resistant bacterial strains alone and in combination with Eichornia sp. Methods: Three chromium resistant bacterial strains S-4 Ochrobactrum grignonense, SF-5 Bacillus sp. and S-6 Ochrobactrum pseudogrignonenses were isolated from industrial effluent.

  19. Antibiotic Resistance in Salmonella sp and Escherichia coli Isolated ...

    African Journals Online (AJOL)

    Strains of Salmonella sp and E. coli isolated were significantly resistant to gentamicin, erythromycin, chloramphenicol, tetracycline, streptomycin, cefixine and ampicillin. Resistance to gentamicin was the least with 33-71% in Salmonella sp and 25-80% in E. coli. The level of drug resistance in these organisms is ascribed to ...

  20. Biochemical characterization of Fusarium oxysporum f . sp. cubense ...

    African Journals Online (AJOL)

    The Fusarium wilt caused by Fusarium oxyspoum f. sp. cubense (Foc) is a major biotic constraint for banana production. The characteristics of F. oxyspoum f. sp. cubense isolates were investigated using electrophoretic studies of isozyme and whole-cell protein. The morphological characteristics of the isolates were very ...

  1. LOCALIZATION OF SP22 ON HUMAN SPERM OF DIFFERING QUALITY

    Science.gov (United States)

    LOCALIZATION OF SP22 ON HUMAN SPERM OF DIFFERING QUALITY. AE Lavers*1, GR Klinefelter2, DW Hamilton1, KP Roberts1, 1University of Minnesota, Minneapolis, MN and 2US EPA, Research Triangle Park, NC. SP22 is a sperm membrane protein that has been implicated in sperm function d...

  2. Biochemical characterization of Fusarium oxysporum f. sp. cubense ...

    African Journals Online (AJOL)

    PRECIOUS

    2010-01-25

    Jan 25, 2010 ... Department of Studies in Biotechnology, University of Mysore, Manasagangotri, Mysore – 570 006, India. Accepted 24 November, 2009. The Fusarium wilt caused by Fusarium oxyspoum f. sp. cubense (Foc) is a major biotic constraint for banana production. The characteristics of F. oxyspoum f. sp. cubense ...

  3. Effects of phosphate solubilizing microorganisms and Rhizobium sp ...

    African Journals Online (AJOL)

    Effects of Phosphate solubilizing microorganisms ( Glomus intraradices, Pseudomonas putida, P. alcaligenes, P. aeruginosa (Pa28), A. awamori) and Rhizobium sp. was observed on the growth, nodulation yield and root-rot disease complex of chickpea under field condition. Inoculation of Rhizobium sp. caused a greater ...

  4. HANSENULA WICKERHAMII SP. N., A NEW YEAST FROM FINNISH SOIL

    Science.gov (United States)

    Capriotti, Augusto

    1961-01-01

    Capriotti, Augusto (l'Università di Perugia, Perugia, Italy). Hansenula wickerhamii sp. n., a new yeast from Finnish soil. J. Bacteriol. 82:259–360. 1961.—Hansenula wickerhamii sp. n. is described; it was isolated from a Finnish soil, and is named in honor of Lynferd J. Wickerham. Images PMID:13690638

  5. Linking surfactant protein SP-D and IL-13

    DEFF Research Database (Denmark)

    Qaseem, Asif S; Sonar, Sanchaita; Mahajan, Lakshna

    2012-01-01

    Surfactant protein D (SP-D) is an innate immune molecule that plays a protective role against lung infection, allergy, asthma and inflammation. In vivo experiments with murine models have shown that SP-D can protect against allergic challenge via a range of mechanisms including inhibition...

  6. Biofixation of carbon dioxide by Chlorococcum sp. in a ...

    African Journals Online (AJOL)

    In this study, Chlorococcum sp. was cultured in a photobioreactor with a polytetrafluoroethene membrane sparger (PTFE) to study CO2 biofixation and microalgae growth. Daily variations of dissolved oxygen (DO), pH and dissolved CO2 were analyzed during batch culture of Chlorococcum sp. in the photobioreactor.

  7. Production of mycelium and blastospores of sp. in submerged culture

    African Journals Online (AJOL)

    Hirsutella sp. was grown in four liquid media containing either casamino acids, corn steep liquor, collagen peptone or casein peptone. These media were inoculated with a 7 day-old culture of mycelia and blastospores of Hirsutella sp. and the cultures incubated with shaking at 250 rpm at 26°C. The media containing corn ...

  8. Brachystelma nallamalayana sp. Nov. (Apocynaceae: Asclepiadoideae: Ceropegieae from India

    Directory of Open Access Journals (Sweden)

    K. Prasad

    2014-10-01

    Full Text Available Brachystelma nallamalayana sp. nov., collected from Nallamalais, the Eastern Ghats of Andhra Pradesh, India is described and illustrated. The new species is compared to its closest species, Brachystelma maculatum Hook. f. Brachystelma nallamalayana, sp. nov. is distinct from other species of Brachystelma in having ca 80cm high glabrous stems, peduncled cymes, basally united calyx lobes and biseriate corona.

  9. Effects of phosphate solubilizing microorganisms and Rhizobium sp ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-08-04

    Aug 4, 2009 ... Effects of Phosphate solubilizing microorganisms (Glomus intraradices, Pseudomonas putida, P. alcaligenes, P. aeruginosa (Pa28), A. awamori) and Rhizobium sp. was observed on the growth, nodulation yield and root-rot disease complex of chickpea under field condition. Inoculation of. Rhizobium sp.

  10. Antioxidant activity of aqueous extract of a Tolypocladium sp ...

    African Journals Online (AJOL)

    Tolypocladium sp. Ts-1 was isolated from the fruiting body of a wild Cordyceps sinensis, one of the best known traditional Chinese medicine and health foods. The antioxidant activities of hot-water extracts from cultured mycelia of Tolypocladium sp. were assessed in different in vitro systems. The extracts showed ...

  11. Antioxidant activity of aqueous extract of a Tolypocladium sp. fungus ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-09-03

    Sep 3, 2008 ... Tolypocladium sp. Ts-1 was isolated from the fruiting body of a wild Cordyceps sinensis, one of the best known traditional Chinese medicine and health foods. The antioxidant activities of hot-water extracts from cultured mycelia of Tolypocladium sp. were assessed in different in vitro systems. The extracts ...

  12. Oncholaim~ jessicae n.sp. (Nematoda: Oncholaimidae) from fresh ...

    African Journals Online (AJOL)

    Oncholaim~ jessicae n.sp. (Nematoda: Oncholaimidae) from fresh water in the Transvaal. A. Coomans. Instituut voor Dierkunde, Rijksuniversiteit Gent, Gent, Belgium. J. Heyns. Department of Zoology, Rand Afrikaans University, Johannesburg. Oncholaimus jessicae n.sp. is described from several sites in the Blyde River ...

  13. Truncated recombinant human SP-D attenuates emphysema and type II cell changes in SP-D deficient mice

    Directory of Open Access Journals (Sweden)

    Mühlfeld Christian

    2007-10-01

    Full Text Available Abstract Background Surfactant protein D (SP-D deficient mice develop emphysema-like pathology associated with focal accumulations of foamy alveolar macrophages, an excess of surfactant phospholipids in the alveolar space and both hypertrophy and hyperplasia of alveolar type II cells. These findings are associated with a chronic inflammatory state. Treatment of SP-D deficient mice with a truncated recombinant fragment of human SP-D (rfhSP-D has been shown to decrease the lipidosis and alveolar macrophage accumulation as well as production of proinflammatory chemokines. The aim of this study was to investigate if rfhSP-D treatment reduces the structural abnormalities in parenchymal architecture and type II cells characteristic of SP-D deficiency. Methods SP-D knock-out mice, aged 3 weeks, 6 weeks and 9 weeks were treated with rfhSP-D for 9, 6 and 3 weeks, respectively. All mice were sacrificed at age 12 weeks and compared to both PBS treated SP-D deficient and wild-type groups. Lung structure was quantified by design-based stereology at the light and electron microscopic level. Emphasis was put on quantification of emphysema, type II cell changes and intracellular surfactant. Data were analysed with two sided non-parametric Mann-Whitney U-test. Main Results After 3 weeks of treatment, alveolar number was higher and mean alveolar size was smaller compared to saline-treated SP-D knock-out controls. There was no significant difference concerning these indices of pulmonary emphysema within rfhSP-D treated groups. Type II cell number and size were smaller as a consequence of treatment. The total volume of lamellar bodies per type II cell and per lung was smaller after 6 weeks of treatment. Conclusion Treatment of SP-D deficient mice with rfhSP-D leads to a reduction in the degree of emphysema and a correction of type II cell hyperplasia and hypertrophy. This supports the concept that rfhSP-D might become a therapeutic option in diseases that are

  14. Truncated recombinant human SP-D attenuates emphysema and type II cell changes in SP-D deficient mice.

    Science.gov (United States)

    Knudsen, Lars; Ochs, Matthias; Mackay, Rosemarie; Townsend, Paul; Deb, Roona; Mühlfeld, Christian; Richter, Joachim; Gilbert, Fabian; Hawgood, Samuel; Reid, Kenneth; Clark, Howard

    2007-10-03

    Surfactant protein D (SP-D) deficient mice develop emphysema-like pathology associated with focal accumulations of foamy alveolar macrophages, an excess of surfactant phospholipids in the alveolar space and both hypertrophy and hyperplasia of alveolar type II cells. These findings are associated with a chronic inflammatory state. Treatment of SP-D deficient mice with a truncated recombinant fragment of human SP-D (rfhSP-D) has been shown to decrease the lipidosis and alveolar macrophage accumulation as well as production of proinflammatory chemokines. The aim of this study was to investigate if rfhSP-D treatment reduces the structural abnormalities in parenchymal architecture and type II cells characteristic of SP-D deficiency. SP-D knock-out mice, aged 3 weeks, 6 weeks and 9 weeks were treated with rfhSP-D for 9, 6 and 3 weeks, respectively. All mice were sacrificed at age 12 weeks and compared to both PBS treated SP-D deficient and wild-type groups. Lung structure was quantified by design-based stereology at the light and electron microscopic level. Emphasis was put on quantification of emphysema, type II cell changes and intracellular surfactant. Data were analysed with two sided non-parametric Mann-Whitney U-test. After 3 weeks of treatment, alveolar number was higher and mean alveolar size was smaller compared to saline-treated SP-D knock-out controls. There was no significant difference concerning these indices of pulmonary emphysema within rfhSP-D treated groups. Type II cell number and size were smaller as a consequence of treatment. The total volume of lamellar bodies per type II cell and per lung was smaller after 6 weeks of treatment. Treatment of SP-D deficient mice with rfhSP-D leads to a reduction in the degree of emphysema and a correction of type II cell hyperplasia and hypertrophy. This supports the concept that rfhSP-D might become a therapeutic option in diseases that are characterized by decreased SP-D levels in the lung.

  15. Post-neonatal drop in alveolar SP-A expression

    DEFF Research Database (Denmark)

    Stray-Pedersen, Arne; Vege, Ashild; Stray-Pedersen, Asbjorg

    2008-01-01

    BACKGROUND: Surfactant protein A (SP-A) is synthesized in the lung and is a part of the innate immune system. The aim of this study was to evaluate the expression of SP-A in lung tissue from fetuses, infants, children and adults with special regard to sudden infant death syndrome (SIDS). METHODS......: A total of 160 cases were studied; 19 fetuses and neonates, 59 SIDS and 49 explained infant deaths below 1 year of age, 19 toddlers and 14 adults. Immunohistochemical detection of SP-A using monoclonal antibodies was performed by microscopy of lung tissue specimens collected at autopsy. A scoring system...... was developed enabling semi-quantitative estimation of staining intensity and distribution. RESULTS: SP-A was detected in the terminal bronchioles and alveolar spaces of fetuses >35 weeks gestation. The intra-alveolar SP-A expression increased in the perinatal period followed by a marked drop in infants aged...

  16. SP-100 space reactor power system

    International Nuclear Information System (INIS)

    Kirpich, A.; Kruger, G.; Matteo, D.; Stephen, J.

    1990-01-01

    A generic flight system (GFS) design for a 100-kWe space reactor power (SP-100) system is presented. The design has evolved around issues such as the selection of a lithium liquid-metal-cooled reactor built of refractory metals and permitting operation in the range of 1300-1400 K; heat transport by lithium circulation using thermoelectrically driven liquid-metal pumps; thermoelectric power conversion; and waste heat rejection at approximately 800 K through lithium circulation to potassium heat pipe radiators. Various thermal-hydraulic analytical procedures have been utilized in the design of the reactor, ducting, hot-side and cold-side heat exchangers, circulating pumps, and heat pipe radiators. The physical and performance characteristics of the GFS and its power margins are estimated as a function of mission time

  17. Thermoelectric electromagnetic pump design for SP-100

    International Nuclear Information System (INIS)

    Collett, J.; Kugler, W.; Sinha, U.; Surjadi, T.

    1988-01-01

    This paper describes the design of the Thermoelectric Electromagnetic (TEM) pump used in the SP-100 space power system. The TEM pump is designed to pump liquid (molten) lithium (Li) coolant in the Primary Heat Transport Subsystem (PHTS) and Heat Rejection Subsystem (HRSS). The pump utilizes advanced Thermoelectric (TE) cells to generate electric current that induces magnetic flux in a Z-shaped magnetic structure. The electric current and magnetic flux pass through the liquid Li perpendicular to each other to create the pumping force. The TE cells are semiconductors located between rectangular ducts connected to the reactor hot PHTS piping and the cooler HRSS piping. The temperature difference (ΔT) across the TE cells generates the voltage to power the pump. The design provides a minimum mass, self-regulated pump, with no moving parts and self-powered by an internal temperature gradient

  18. SP-100 status and technology accomplishments

    International Nuclear Information System (INIS)

    Armijo, J.S.

    1989-01-01

    There are many space missions that require electric power in the 10-kW(electric) to 1-MW(electric) range. The SP-100 program will provide technology that demonstrates that a nuclear reactor heat source and passive thermoelectric conversion can reliably provide electrical power over this full range for 10 yr. Based on the generic flight system (GFS) design at 100 kW(electric), tests will be conducted to demonstrate that technologies required for the GFS have been validated. In addition, system-level tests will show that the GFS design and predictive capability to design at other power levels are well understood and meet an enveloping set of requirements. Technology and component testing has begun at General Electric (GE), its subcontractors, and several national laboratories. This paper reviews the significant progress made to date and major planned future tests with respect to the reference flight system, technology and component achievements, and nuclear assembly and integrated assembly tests

  19. Epitheliotropic lymphoma in a squirrel (Sciurus sp.).

    Science.gov (United States)

    Honnold, Shelley P; Arun, Iyampillai; Saturday, Greg; McLeod, Charles

    2007-09-01

    A 12-yr-old, intact male squirrel (Sciurus sp.) presented with a 15 mm-by-20 mm area of alopecia and plaque-like dermal thickening over the left caudolateral thorax. Routine diagnostic tests ruled out more common conditions that result in alopecia, such as dermatophytosis and acariasis. A punch biopsy was obtained under anesthesia and submitted for histopathologic evaluation. The diagnosis of epitheliotropic lymphoma was made, and follow-up surgical excision was performed. Histopathologic features were consistent with epitheliotropic lymphoma, and immunohistochemistry confirmed a T-cell origin. There was no local recurrence, new lesions, or evidence of metastasis 10 mo after surgical excision. To our knowledge, to date, epitheliotropic lymphoma has not been described in a squirrel.

  20. Chitinase Production by Streptomyces sp. ANU 6277

    Directory of Open Access Journals (Sweden)

    Kolla J.P. Narayana

    2009-12-01

    Full Text Available Chitinase production by a terrestrial Streptomyces sp. ANU 6277 was studied under sub-merged fermentation. Chitinase production started after 24 h of incubation and reached maximum levels after 60 h of cultivation. A high level of chitinase activity was observed in the culture medium with pH 6 at 35ºC. Culture medium amended with 1% chitin was found to be suitable for maximum production of chitinase. An optimum concentration of colloidal chitin for chitinase production was determined. Studies on the influence of additional carbon and nitrogen sources on chitinase production revealed that starch and yeast extract served as good carbon and nitrogen sources to enhance chitinase yield.Chitinase was purified from crude enzyme extract by single step gel filtration by Sephadex G-100. Purified chitinase of the strain exhibited a distinct protein band near 45 kDa by means of SDS-PAGE.

  1. Kinerja probiotik Bacillus sp. pada pendederan benih ikan lele Clarias sp. yang diinfeksi Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    , Sukenda

    2016-12-01

    Full Text Available ABSTRACT This experiment was conducted to assess performance of Bacillus sp. probiotic on catfish juvenile Clarias sp. infected by Aeromonas hydrophila. The probiotic content in the diets were 0% (K+ and K-, 1%, and 2% in duplicates. This experiment used randomized design with four treatments and two replications. Juveniles with average body weight of 3.22±0.15 g/fish were reared in the 1.5×2.8×0.5 m3 pond with density of 800 fish/pond. Fish were reared for 30 days and fed three times a day at rate 8% of  total body weight. At day 31, catfish were challenged by A. hydrophila 0.1 mL (106 cfu/mL. Post infection observation was carried out ten days with density 10 fish/aquaria. The result showed that fish fed diet containing 2% probiotic gave the best probiotic performance with survival rate of catfish 83.33% after challenged, spesific growth rate 5.40%, and 0,75 of feed conversion ratio. The results of the blood profile showed significantly better results in the treatment of probiotics compared to the positive control after challenge test A. hydrophila. Probiotic Bacillus sp. has given as much as 2% on feed provides better performance on catfish juvenile. Keywords: probiotic, Bacillus sp., A. hydrophila, catfish juvenille, growth  ABSTRAK Penelitian ini bertujuan untuk menguji kinerja probiotik Bacillus sp. dalam pakan pada pendederan benih ikan lele Clarias sp. yang diinfeksi bakteri Aeromonas hydrophila. Penelitian ini menggunakan rancangan acak lengkap dengan empat perlakuan yaitu kandungan probiotik dalam pakan perlakuan yaitu 0% (K+ dan K-, 1%,  dan 2%, masing-masing dengan dua ulangan. Ikan lele yang digunakan memiliki bobot rata-rata 3,22±0,15 g/ekor, dipelihara dalam kolam terpal berukuran 1,5×2,8×0,5 m3 dengan kepadatan 800 ekor/kolam. Ikan dipelihara selama 30 hari dengan frekuensi pemberian pakan tiga kali sehari sebanyak 8% dari bobot tubuh ikan. Hari ke-31 benih lele diinjeksi bakteri A. hydrophila dosis 0,1 m

  2. Neorickettsia risticii, Rickettsia sp. and Bartonella sp. in Tadarida brasiliensis bats from Buenos Aires, Argentina.

    Science.gov (United States)

    Cicuttin, Gabriel L; De Salvo, María N; La Rosa, Isabel; Dohmen, Federico E Gury

    2017-06-01

    Bats are potential reservoirs of many vector-borne bacterial pathogens. The aim of the present study was to detect species of Anaplasma, Ehrlichia, Neorickettsia, Rickettsia, Borrelia and Bartonella in Brazilian free-tailed bats (Tadarida brasiliensis, Molossidae) from Buenos Aires city, Argentina. Between 2012 and 2013, 61 T. brasiliensis from urban areas of Buenos Aires city were studied. The samples were molecularly screened by PCR and sequencing. Five bats (8.2%) were positive to Neorickettsia risticii, one (1.6%) was positive to Rickettsia sp. and three bats (4.9%) to Bartonella sp. For molecular characterization, the positive samples were subjected to amplification and sequencing of a fragment of p51 gene for N. risticii, a fragment of citrate synthase gene (gltA) for Rickettsia genus and a fragment of gltA for Bartonella genus. Phylogenetic tree was constructed using the maximum-likelihood method. Phylogenetic analysis of N. risticii detect in our study revealed that it relates to findings in the USA West Coast; Rickettsia sp. detected is phylogenetically within R. bellii group, which also includes many other Rickettsia endosymbionts of insects; and Bartonella sp. found is related to various Bartonella spp. described in Vespertilionidae bats, which are phylogenetically related to Molossidae. Our results are in accordance to previous findings, which demonstrate that insectivorous bats could be infected with vector-borne bacteria representing a potential risk to public health. Future research is necessary to clarify the circulation of these pathogens in bats from Buenos Aires. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. From spent graphite to amorphous sp2+sp3 carbon-coated sp2 graphite for high-performance lithium ion batteries

    Science.gov (United States)

    Ma, Zhen; Zhuang, Yuchan; Deng, Yaoming; Song, Xiaona; Zuo, Xiaoxi; Xiao, Xin; Nan, Junmin

    2018-02-01

    Today, with the massive application of lithium ion batteries (LIBs) in the portable devices and electric vehicles, to supply the active materials with high-performances and then to recycle their wastes are two core issues for the development of LIBs. In this paper, the spent graphite (SG) in LIBs is used as raw materials to fabricate two comparative high-capacity graphite anode materials. Based on a microsurgery-like physical reconstruction, the reconstructed graphite (RG) with a sp2+sp3 carbon surface is prepared through a microwave exfoliation and subsequent spray drying process. In contrast, the neural-network-like amorphous sp2+sp3 carbon-coated graphite (AC@G) is synthesized using a self-reconfigurable chemical reaction strategy. Compared with SG and commercial graphite (CG), both RG and AC@G have enhanced specific capacities, from 311.2 mAh g-1 and 360.7 mAh g-1 to 409.7 mAh g-1 and 420.0 mAh g-1, at 0.1C after 100 cycles. In addition, they exhibit comparable cycling stability, rate capability, and voltage plateau with CG. Because the synthesis of RG and AC@G represents two typical physical and chemical methods for the recycling of SG, these results on the sp2+sp3 carbon layer coating bulk graphite also reveal an approach for the preparation of high-performance graphite anode materials derived from SG.

  4. Wnt-mediated down-regulation of Sp1 target genes by a transcriptional repressor Sp5

    Czech Academy of Sciences Publication Activity Database

    Fujimura, Naoko; Vacík, Tomáš; Machoň, Ondřej; Vlček, Čestmír; Scalabrin, S.; Speth, M.; Diep, D.; Krauss, S.; Kozmik, Zbyněk

    2007-01-01

    Roč. 282, č. 2 (2007), s. 1225-1237 ISSN 0021-9258 Institutional research plan: CEZ:AV0Z50520514 Keywords : Wnt -mediated signaling * Sp5 transcription factor * Sp1 target genes Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.581, year: 2007

  5. Desulfuromonas svalbardensis sp nov and Desulfuromusa ferrireducens sp nov., psychrophilic, Fe(III)-reducing bacteria isolated from Arctic sediments, Svalbard

    DEFF Research Database (Denmark)

    Vandieken, V.; Mussmann, M.; Niemann, Hans Henrik

    2006-01-01

    succinoxidans Gylac(T) (95.9%) within the Deltaproteobacteria. Strains 112(T) and 102(T) therefore represent novel species, for which the names Desulfuromonas svalbardensis sp. nov. (type strain 112(T) = DSM 16958(T) = JCM 12927(T)) and Desulfuromusa ferrireducens sp. nov. (type strain 102(T) = DSM 16956 (T...

  6. Elevated expression and potential roles of human Sp5, a member of Sp transcription factor family, in human cancers

    International Nuclear Information System (INIS)

    Chen Yongxin; Guo Yingqiu; Ge Xijin; Itoh, Hirotaka; Watanabe, Akira; Fujiwara, Takeshi; Kodama, Tatsuhiko; Aburatani, Hiroyuki

    2006-01-01

    In this report, we describe the expression and function of human Sp5, a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Our experiments employing Gal4-Sp5 fusion proteins reveal multiple transcriptional domains, including a N-terminal activity domain, an intrinsic repressive element, and a C-terminal synergistic domain. Elevated expression of Sp5 was noted in several human tumors including hepatocellular carcinoma, gastric cancer, and colon cancer. To study the effects of the Sp5 protein on growth properties of human cancer cells and facilitate the identification of its downstream genes, we combined an inducible gene expression system with microarray analysis to screen for its transcriptional targets. Transfer of Sp5 into MCF-7 cells that expressed no detectable endogenous Sp5 protein elicited significant growth promotion activity. Several of the constitutively deregulated genes have been associated with tumorigenesis (CDC25C, CEACAM6, TMPRSS2, XBP1, MYBL1, ABHD2, and CXCL12) and Wnt/β-Catenin signaling pathways (BAMBI, SIX1, IGFBP5, AES, and p21 WAF1 ). This information could be utilized for further mechanistic research and for devising optimized therapeutic strategies against human cancers

  7. Direct transesterification of Oedogonium sp. oil be using immobilized isolated novel Bacillus sp. lipase.

    Science.gov (United States)

    Sivaramakrishnan, Ramachandran; Muthukumar, Karuppan

    2014-01-01

    This work emphasizes the potential of the isolated Bacillus sp. lipase for the production of fatty acid methyl ester by the direct transesterification of Oedogonium sp. of macroalgae. Dimethyl carbonate was used as the extraction solvent and also as the reactant. The effect of solvent/algae ratio, water addition, catalyst, temperature, stirring and time on the direct transesterification was studied. The highest fatty acid methyl ester yield obtained under optimum conditions (5 g Oedogonium sp. powder, 7.5 ml of solvent (dimethyl carbonate)/g of algae, 8% catalyst (%wt/wt of oil), distilled water 1% (wt/wt of algae), 36 h, 55°C and 180 rpm) was 82%. Final product was subjected to thermogravimetric analysis and (1)H NMR analysis. The results showed that the isolated enzyme has good potential in catalyzing the direct transesterification of algae, and the dimethyl carbonate did not affect the activity of the isolated lipase. Copyright © 2013 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  8. PENGGUNAAN EKSTRAK BIOTA LAUTAGLAOPHENIA SP. UNTUK MENGENDALIKANFUSARIUM OXYSPORUM F.SP.VANILLAE PENYEBAB BUSUK BATANG VANILI

    Directory of Open Access Journals (Sweden)

    I KETUT SUADA

    2012-11-01

    Full Text Available The Use of Aglaophenia sp. Marine Biota Extract to Control Fusarium oxysporum f. sp. vanillae, a Pathogen of Vanilla Stem Rot The use of marine biota for organic fungicide material has enormous potential to be developed. The organic fungicide was directed to substitute synthetic fungicide for vanilla cultivation. Application of synthetic fungicide degraded environmental quality, therefore its applications does not support sustainable agriculture. The objective of this research was to know the potence of Aglaopheniain suppressing the growth of F. oxysporum f. sp.vanillae, the pathogen of vanilla stem rot. The research was done in green house in order to find the best substance for formulation of the extract. The substances screened were water, tween-80, and detergents with two different concentrations. Subsequently, two best formulas were chosen to apply in endemic area in Tabanan. The green house and field trial research used Randomized Completely Design with three and five replications respectively. Results showed that tween was the best substance used for formulation and concentration of 0.2% was better than other concentrations. The extract diluted in tween-80 on the concentration of 0.2% showed the lowest rot on stem, longest shoot, and the most leaves on vanilla shoot. Because of its significant performance, the 0.1% extract ofAglaopheniain 0.1% tween-80 was proposed to be the best formula to suppress the vanilla stem rot disease.

  9. Kinetics of petroleum oil biodegradation by a consortium of three protozoan isolates (Aspidisca sp., Trachelophyllum sp. and Peranema sp.

    Directory of Open Access Journals (Sweden)

    L. Kachieng’a

    2017-09-01

    Full Text Available Petroleum oil is a complex mixture of substances, the majority of which are hydrocarbons; the latter represent an extremely important and heterogeneous group of compounds that find their way into water resources by anthropogenic or natural ways. The majority of toxic hydrocarbon components of petroleum are biodegradable, where bioremediation using microbial species has become an integral process for the restoration of oil-polluted areas. In this study, three bioremediation processes, namely natural attenuation, nutrient supplementation by adding glucose and biostimulation by adding Tween® 80, were carried out in various petroleum hydrocarbon concentrations in polluted water media using a consortium of three protozoan isolates (Aspidisca sp., Trachelophyllum sp. and Peranema sp.. A first-order kinetics model was fitted to the biodegradation data to evaluate the biodegradation rate and to determine the corresponding half-life time. First-order kinetics satisfactorily described the biodegradation of the petroleum-based contaminants under abiotic conditions. The results showed an increase in the percentage removal of petroleum oil at the lower petroleum concentrations and a gradual percentage decrease in removing petroleum oil residues occurred when there was an increase in the initial concentrations of the petroleum oil: 39%, 27%, 22%, 12%, 10% for various petroleum oil concentrations of 50, 100, 150, 200, 250 mg/L, respectively. A similar trend was also observed in the glucose-supplemented culture media where the reduction was 45% and 78% for petroleum concentrations of 250 mg/L and 50 mg/L, respectively. Biodegradation of between 33 and 90% was achieved at a Tween® 80 concentration of between 50 mg/L and 250 mg/L. The degradation rate constants for the natural attenuation process ranged between ≥0 to ≤0.50, ≥0 to ≤0.35, ≥0 to ≤0.25, ≥0 to ≤ 0.14 and ≥ 0 to ≤0.11 for petroleum oil concentrations varying from 50, 100, 150

  10. A sp2+sp3 hybridized carbon allotrope transformed from AB stacking graphyne and THD-graphene

    Directory of Open Access Journals (Sweden)

    Yu Zhang

    2018-01-01

    Full Text Available New carbon allotropes can be designed by combining sp, sp2 and sp3 three hybridization states. And the hybridization states or coordination numbers of carbon atoms can be changed by applying high pressure on carbon materials. In this study, a common high pressure phase (named as TBBC transformed from AB-stacking graphyne or THD-graphene is predicted. Its kinetic stability is examined using finite displacement method. We find that the sp2 and sp3 hybridized carbon atoms behave different vibration features at high frequency region. Both graphene-like and diamond-like vibration peaks occurs. Phase transition energy barriers from both graphyne and THD-graphene to TBBC are estimated. Electronic structure calculations show that the TBBC is an indirect semiconductor with a bandgap of 0.66 eV. The ideal tensile strength of TBBC is high in [0001] and [11¯00] directions, but is weak along [12¯10] direction.

  11. A sp2+sp3 hybridized carbon allotrope transformed from AB stacking graphyne and THD-graphene

    Science.gov (United States)

    Zhang, Yu; Shang, Jiacheng; Fu, Weida; Zeng, Li; Tang, Tao; Cai, Yingxiang

    2018-01-01

    New carbon allotropes can be designed by combining sp, sp2 and sp3 three hybridization states. And the hybridization states or coordination numbers of carbon atoms can be changed by applying high pressure on carbon materials. In this study, a common high pressure phase (named as TBBC) transformed from AB-stacking graphyne or THD-graphene is predicted. Its kinetic stability is examined using finite displacement method. We find that the sp2 and sp3 hybridized carbon atoms behave different vibration features at high frequency region. Both graphene-like and diamond-like vibration peaks occurs. Phase transition energy barriers from both graphyne and THD-graphene to TBBC are estimated. Electronic structure calculations show that the TBBC is an indirect semiconductor with a bandgap of 0.66 eV. The ideal tensile strength of TBBC is high in [0001] and [1 1 ¯ 00 ] directions, but is weak along [1 2 ¯ 10 ] direction.

  12. DAN IDENTIFIKASI PATOGEN POTENSIAL YANG MENGINFEKSI IKAN RAINBOW (Melanotaenia sp.

    Directory of Open Access Journals (Sweden)

    Lili Sholichah

    2014-03-01

    Full Text Available Pemeliharaan ikan rainbow (Melanotaenia sp. di Balai Penelitian dan Pengembangan Budidaya Ikan Hias selalu terjadi kematian secara bertahap mulai calon induk hingga proses pemijahan. Hal ini terjadi berulang kali sehingga ketersediaan induk Melanotaenia sp. sangat terancam. Ikan ini berasal dari Papua yang diperoleh mengandalkan penangkapan di alam. Tujuan dari penelitian ini adalah untuk menginventarisir dan mengidentifikasi berbagai patogen (parasit, jamur, bakteri potensial yang menginfeksi ikan rainbow yang dipelihara di dalam akuarium berukuran 50 cm x 50 cm x 50 cm dengan sistem aliran air stagnan. Tiga jenis rainbow yang dipelihara yaitu: rainbow Sungai Salawati, asal Sungai Sawiat, dan asal Danau Kurumoi. Setiap ikan masing-masing berjumlah 100 ekor dipelihara di akuarium dengan penambahan batu karang dan tanpa penambahan karang (kontrol ke dalam akuarium. Ikan diberi pakan sekenyangnya berupa jentik nyamuk dan cacing rambut beku setiap pagi dan sore hari. Sampling dilakukan secara random sebulan sekali dan secara unrandom setiap ada kejadian ikan sakit. Gejala klinis ikan yang sakit sebagai berikut: ikan berenang di permukaan dan menggosok-gosokkan badan di dinding akuarium, nafsu makan berkurang, gerakan berputar-putar, warna memudar menjadi putih, penekanan warna hitam pada sirip punggung dan perut meningkat, pendarahan pada perut, lendir berlebihan dan sangat berbau, serta sisik berdiri/terbuka. Diagnosa dan deteksi penyakit awal berupa pengamatan parasit baik ektoparasit maupun endoparasit, pengamatan dan isolasi jamur pada media selektif jamur, dan isolasi bakteri dilakukan untuk mengetahui jenis-jenis patogen yang menginfeksi ketiga jenis ikan rainbow. Selanjutnya dilakukan uji histologi dan analisa DNA beberapa patogen. Hasil pengamatan diperoleh patogen berupa parasit (Ichthyophthirius sp., Dactylogyrus sp., Gyrodactylus sp., dan Trichodina sp. dan bakteri (Aeromonas hydrophila, Acinetobacter sp

  13. Genetic polymorphism of horse serum protein 3 (SP3).

    Science.gov (United States)

    Juneja, R K; Sandberg, K; Kuryl, J; Gahne, B

    1989-01-01

    Two-dimensional agarose gel (pH 8.6)-horizontal polyacrylamide gel (pH 9.0) electrophoresis of horse serum samples, followed by general protein staining, revealed genetic polymorphism of an unidentified protein tentatively designated serum protein 3 (SP3). The SP3 fractions appeared distinctly when a 14% concentration of acrylamide was used in the separation gels. The 2-D mobilities of SP3 fractions were quite similar to that of albumin. Family data were consistent with the hypothesis that the observed SP3 phenotypes were controlled by four co-dominant, autosomal alleles (D, F, I, S). Evidence was provided that the F allele can be further divided into two alleles (F1 and F2); the mobilities of F1 and F2 variants were very similar. Each of the SP3 alleles gave rise to one fraction and each of the heterozygous types showed two fractions. More than 600 horses representing five different breeds (Swedish Trotter, North-Swedish Trotter, Thoroughbred, Arab and Polish Tarpan) were typed for SP3, and allele frequency estimates were calculated. SP3 was highly polymorphic in all breeds studied.

  14. Efektivitas Ovitrap Bambu terhadap Jumlah Jentik Aedes sp yang Terperangkap

    Directory of Open Access Journals (Sweden)

    Wiwit Aditama

    2015-05-01

    places of 10 subdistricts. Data of trapped Aedes sp larvae numbers was collected four times repeatedly within one week time-lapse. Analysis was conducted using the mean number of larvae in ovitraps and ovitrap index. The number of Aedes sp larvae trapped was 1,265. The most effective ovitrap is piece of bamboo, mean = 123, p value = 0.006, HI = 10.01% (16.66 26.67%, CI = 36.8% (336.06 - 39.74%, BI = 29.97% (73.33 - 103.3%. Health authorities should promote bamboo ovitrap, especially to public as an effort to control Aedes sp.

  15. Pengaruh Perbedaan Konsentrasi Ekstrak Sargassum sp. dan Lama Penyimpanan terhadap Oksidasi Lemak pada Fillet Ikan Patin (Pangasius sp.

    Directory of Open Access Journals (Sweden)

    Fatin Hidayati

    2017-05-01

    Full Text Available ABSTRAK Ikan patin merupakan ikan air tawar yang mengandung lemak dan protein tinggi sehingga apabila dilakukan penyimpanan rentan terjadi oksidasi yang mengakibatkan ketengikan. Sargassum sp. dengan kandungan fenol dan flavonoid mampu menghambat terjadinya oksidasi pada fillet ikan patin. Penelitian ini bertujuan untuk mengetahui pengaruh perbedaan ekstrak Sargassum sp. dan lama penyimpanan dalam menghambat terjadinya oksidasi pada fillet ikan patin. Materi yang digunakan dalam penelitian ini adalah ekstrak Sargassum sp. dan fillet ikan patin. Metode penelitian yang digunakan adalah experimental laboratories dengan menggunakan Rancangan Acak Lengkap (RAL faktorial dengan 2 faktor yaitu konsentrasi ekstrak Sargassum sp. (0%, 1%, 1,5% dan 2% dan lama penyimpanan (hari ke-0, hari ke-2, hari ke-4, dan hari ke-6. Hasil penelitian menunjukkan bahwa perbedaan penambahan konsentrasi ekstrak Sargassum sp. dan lama penyimpanan memberikan pengaruh nyata terhadap nilai PV, nilai TBA, kadar lemak, kadar protein, kadar air serta organoleptik (P < 0,05. Hasil penelitian tahap I didapatkan rendemen Sargassum sp. dengan pelarut etanol 96% sebesar 1,39%, kandungan fenol 1,813%, flavonoid 0,278% dan aktivitas antioksidan 99,1659 ppm (kuat. Hasil penelitian tahap II didapatkan nilai PV berkisar antara 2,03 - 19,82 meq/kg, nilai TBA 0,63 - 6,72 mg.mal/kg. Konsentrasi 1,5% merupakan konsentrasi terbaik ekstrak Sargassum sp. dalam menghambat oksidasi lemak pada fillet ikan patin selama penyimpanan. Kata kunci: Antioksidan, Ekstrak Sargassum sp., Lama Penyimpanan, Oksidasi lemak, Fillet Ikan patin ABSTRACT Catfish is a freshwater fish that contain high fat and protein so that if its stored it will susceptible to oxidation process which leads to rancidity. Sargassum sp. with its phenolic and flavonoid content are able to inhibit the oxidation process in catfish fillet. This research was aimed to know the effects of different concentrations of Sargassum sp. extracts and

  16. Description of Pristina armata n. sp. (Clitellata: Naididae: Pristininae) from a carnivorous plant (Nepenthes sp.) in Borneo, Indonesia.

    Science.gov (United States)

    Schenková, Jana; Čermák, Václav

    2013-01-01

    A new clitellate species of Pristininae (Naididae), Pristina armata n. sp., found in the pitcher of the carnivorous plant Nepenthes sp., is reported from East Kalimantan, Indonesia. P. armata n. sp. is a very small clitellate, less than 1 mm long in fixed state, and without proboscis on the prostomium. Signs of reproduction by paratomy were observed, but the generic placement remains preliminary because sexually mature individuals were not found. P. armata n. sp. is characterized by giant hook-like dorsal chaetae at IV. The description of P. armata n. sp. was based on six fixed specimens of different size and stage of development. Noteworthy is the habitat of P. armata n. sp. in Nepenthes pitchers, this being the first clitellate species described from such a habitat. P. armata n. sp. may be a member of the nepenthebionts' community, realizing its life cycle inside the digestive fluid of the Nepenthes pitcher, or it belongs to nepenthephiles, species that commonly occur in this habitat but do not specialize on it.

  17. Plant growth promoting properties of Halobacillus sp. and Halomonas sp. in presence of salinity and heavy metals.

    Science.gov (United States)

    Desale, Prithviraj; Patel, Bhargav; Singh, Sukrit; Malhotra, Aakshi; Nawani, Neelu

    2014-08-01

    Salinity and heavy metal stress are challenging problems in agriculture. Here we report the plant growth promoting ability of three moderate halophiles, Halobacillus sp. ADN1, Halomonas sp. MAN5, and Halobacillus sp. MAN6, in presence of both salinity and heavy metal stress. Halobacillus sp. ADN1, Halomonas sp. MAN5, and Halobacillus sp. MAN6 can tolerate 25, 21, and 29% NaCl, respectively and grow in presence of 1 mM cobalt, cadmium, and nickel and 0.04 mM mercury and 0.03 mM silver. Halobacillus sp. ADN1, Halomonas sp. MAN5, and Halobacillus sp. MAN6 produced 152.5, 95.3, and 167.3 µg/ml indole acetic acid (IAA) and could solubilize 61, 53, and 75 parts per million (ppm) phosphate, respectively in the presence of 15% NaCl. The production of IAA and solubilization of phosphate was well retained in the presence of salinity and heavy metals like 1 mM cadmium, 0.7 mM nickel, 0.04 mM mercury, and 0.03 mM silver. Besides, the strains showed amylase and protease activities and could produce hydrogen cyanide and ammonia in presence of salinity and heavy metals. A mixture of three strains enhanced the root growth of Sesuvium portulacastrum under saline and heavy metal stress, where the root length increased nearly 4.5 ± 0.6 times and root dry weight increased 5.4 ± 0.5 times as compared to control. These strains can thus be useful in microbial assisted phytoremediation of polluted saline soils. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  18. Lactobacillus oeni sp. nov., from wine.

    Science.gov (United States)

    Mañes-Lázaro, Rosario; Ferrer, Sergi; Rosselló-Mora, Ramón; Pardo, Isabel

    2009-08-01

    Ten Lactobacillus strains, previously isolated from different Bobal grape wines from the Utiel-Requena Origin Denomination of Spain, were characterized phylogenetically, genotypically and phenotypically. The 16S rRNA genes were sequenced and phylogenetic analysis showed that they form a tight phylogenetic clade that is closely related to reference strains Lactobacillus satsumensis NRIC 0604T, 'Lactobacillus uvarum' 8 and Lactobacillus mali DSM 20444T. DNA-DNA hybridization results confirmed the separation of the strains from other Lactobacillus species. Genotypically, the strains could be differentiated from their closest neighbours by 16S amplified rDNA restriction analysis and random amplified polymorphic DNA patterns. The strains were Gram-staining-positive, facultatively anaerobic rods that did not exhibit catalase activity. Phenotypically, they could be distinguished from their closest relatives by several traits such as their inabilities to grow at pH 3.3, to ferment sucrose, amygdalin and arbutin or to hydrolyse aesculin. The characteristics of the ten wine isolates suggest that they represent a novel species, for which the name Lactobacillus oeni sp. nov. is proposed. The type strain is 59bT (=CECT 7334T=DSM 19972T).

  19. Cellulomonas bogoriensis sp. nov., an alkaliphilic cellulomonad.

    Science.gov (United States)

    Jones, Brian E; Grant, William D; Duckworth, A W; Schumann, Peter; Weiss, Norbert; Stackebrandt, Erko

    2005-07-01

    An alkaliphilic, slightly halotolerant, chemo-organotrophic, Gram-positive, rod-shaped bacterium, strain 69B4(T), was isolated from the sediment of the littoral zone of Lake Bogoria, Kenya. Phylogenetically, it is a member of the genus Cellulomonas, showing less than 97.5 % sequence similarity to the type strains of other Cellulomonas species. The highest level of similarity, albeit moderate, was found with respect to Cellulomonas cellasea DSM 20118(T). Chemotaxonomic properties confirm the 16S rRNA gene-based generic affiliation, i.e. a DNA G+C content of 71.5 mol%, anteiso-C(15:0) and C(16:0) as the major fatty acids, MK-9(H(4)) as the major isoprenoid quinone, a peptidoglycan containing L-ornithine as the diamino acid and D-aspartic acid in the interpeptide bridge and phosphatidylglycerol as the only identified main polar lipid. The strain is aerobic to facultatively anaerobic, being capable of growth under strictly anaerobic conditions. Optimal growth occurs between pH values 9.0 and 10.0. On the basis of its distinct phylogenetic position and metabolic properties, strain 69B4(T) represents a novel species of the genus Cellulomonas, for which the name Cellulomonas bogoriensis sp. nov. is proposed. The type strain is 69B4(T) (=DSM 16987(T)=CIP 108683(T)).

  20. Preliminary SP-100/Stirling heat exchanger designs

    International Nuclear Information System (INIS)

    Schmitz, P.; Tower, L.; Blue, B.; Dunn, P.

    1994-01-01

    Analytic modeling of several heat exchanger concepts to couple the SP-100 nuclear reactor lithium loop and the Space Stirling Power Convertor (SSPC) was performed. Four 25 kWe SSPC's are used to produce the required 100 kW of electrical power. This design work focused on the interface between a single SSPC and the primary lithium loop. Manifolding to separate and collect the four channel flow was not modeled. This work modeled two separate types of heat exchanger interfaces (conductive coupling and radiative coupling) to explore their relative advantages and disadvantages. The minimum mass design of the conductively coupled concepts was 18 kg or 0.73 kg/kWe for a single 25 kWe convertor. The minimum mass radiatively coupled concept was 41 kg or 1.64 kg/kWe. The direct conduction heat exchanger provides a lighter weight system because of its ability to operate the Stirling convertor evaporator at higher heat fluxes than those attainable by the radiatively coupled systems. Additionally the conductively coupled concepts had relatively small volumes and provide potentially simpler assembly. Their disadvantages were the tight tolerances and material joining problems associated with this refractory to superalloy interface. The advantages of the radiatively coupled designs were the minimal material interface problems

  1. Preliminary SP-100/Stirling heat exchanger designs

    International Nuclear Information System (INIS)

    Schmitz, P.; Tower, L.; Dawson, R.; Blue, B.; Dunn, P.

    1993-12-01

    Analytic modeling of several heat exchanger concepts to couple the SP-100 nuclear reactor primary lithium loop and the Space Stirling Power Convertor (SSPC) was performed. Four 25 kWe SSPC's are used to produce the required 100 kW of electrical power. This design work focused on the interface between a single SSPC and the primary lithium loop. Manifolding to separate and collect the four channel flow was not modeled. This work modeled two separate types of heat exchanger interfaces (conductive coupling and radiative coupling) to explore their relative advantages and disadvantages. The minimum mass design of the conductively coupled concepts was 18 kg or 0.73 kg/kWe for a single 25 kWe convertor. The minimum mass radiatively coupled concept was 41 kg or 1.64 kg/kWe. The direct conduction heat exchanger provides a lighter weight system because of its ability to operate the Stirling convertor evaporator at higher heat fluxes than those attainable by the radiatively coupled systems. Additionally the conductively coupled concepts had relatively small volumes and provide potentially simpler assembly. Their disadvantages were the tight tolerances and material joining problems associated with this refractory to superalloy interface. The advantages of the radiatively coupled designs were the minimal material interface problems

  2. Accomplishments and plans of SP-100 program

    International Nuclear Information System (INIS)

    Wright, W.E.

    1985-01-01

    The SP-100 program is proceeding toward concept definitions for a space nuclear reactor which is safe and suitable for civilian and military applications. The selection of a specific design and demonstration of the base technologies was scheduled for the end of 1985, to be followed by engineering development and ground testing in 1986. The main current uses/users thus far anticipated are communications satellites, both military and civilian, radar (and possibly laser) surveillance and remote sensing systems, and manufacturing and other extensions of a space station growth scenario. The reactor will weigh no more than 3000 kg and must fit into the Orbiter bay with a payload and OTV. Three concepts are still under evaluation: a lithium-cooled reactor with thermoelectrics; an in-core thermionic system with pumped sodium-potassium coolant; and a configuration with a Stirling engine to convert reactor heat into electricity. If the engineering analyses and base tests are successful, it is expected that the flight application phase can be reached by 1991 at the latest

  3. Phenotypic diversity of Xanthomonas sp. mangiferaeindicae.

    Science.gov (United States)

    Pruvost, O; Couteau, A; Perrier, X; Luisetti, J

    1998-01-01

    Carbohydrate utilization profiles by means of the API (Appareils et Procédés d'Identification) system and sensitivity to antibiotics and heavy metal salts of 68 Xanthomonas sp. mangiferaeindicae strains isolated in nine countries from mango (Mangifera indica L.) and other genera of the Anacardiaceae were examined to assess the variability of the taxon. The strains could be separated into 10 groups according to Ward clustering. Apigmented strains isolated from the pepper tree [syn. Brazilian pepper] (Schinus terebenthifolius Raddi) could not be clearly differentiated from most apigmented strains isolated from mango. Yellow-pigmented strains isolated from mango in Brazil and Reunion Island, apigmented strains isolated from mango in Brazil and from ambarella in the French West Indies, clustered in distinct groups. The results are consistent with those of other studies, based on isozyme analysis of esterase, phosphoglucomutase and superoxide dismutase, and hrp-RFLP analysis; they indicate the need for a comprehensive taxonomic evaluation of xanthomonads associated with Anacardiaceae.

  4. Kribbella sindirgiensis sp. nov. isolated from soil.

    Science.gov (United States)

    Ozdemir-Kocak, Fadime; Isik, Kamil; Saricaoglu, Salih; Saygin, Hayrettin; Inan-Bektas, Kadriye; Cetin, Demet; Guven, Kiymet; Sahin, Nevzat

    2017-12-01

    A Kribbella strain FSN23 T was isolated from soil sample which was collected from Caygoren Dam lakeside located in Sındırgı, Turkey. The isolate was investigated using a polyphasic approach consisting of numeric, chemotaxonomic and molecular analysis. The isolate indicated chemotaxonomic, morphological and phylogenetic properties associated with members of the genus Kribbella. Phylogenetic analysis based on the 16S rRNA sequence of the strain demonstrated that the strain forms a subclade with K. aluminosa HKI 0478 T and K. jejuensis HD9 T . The organism formed an extensively branched substrate and aerial hyphae which generated spiral chains of spores with smooth surfaces. The cell wall contained LL-diaminopimelic acid, and the whole cell sugars were glucose and ribose along with trace amounts of mannose. The polar lipids were identified as phosphatidylglycerol, diphosphatidylglycerol, four unidentified lipids and five unidentified polar lipids. The predominant menaquinone was MK-9(H 4 ). The major cellular fatty acids were anteiso-C 15:0 and iso-C 16:0 . Polyphasic taxonomy properties confirm that strain FSN23 T represents a novel Kribbella taxon distinguished from closely related type strains. Hence, strain FSN23 T (=KCTC 29220 T  = DSM 27082 T ) is proposed as the type strain of a novel species with the name Kribbella sindirgiensis sp. nov.

  5. Campylobacter iguaniorum sp. nov., isolated from reptiles.

    Science.gov (United States)

    Gilbert, Maarten J; Kik, Marja; Miller, William G; Duim, Birgitta; Wagenaar, Jaap A

    2015-03-01

    During sampling of reptiles for members of the class Epsilonproteobacteria, strains representing a member of the genus Campylobacter not belonging to any of the established taxa were isolated from lizards and chelonians. Initial amplified fragment length polymorphism, PCR and 16S rRNA sequence analysis showed that these strains were most closely related to Campylobacter fetus and Campylobacter hyointestinalis. A polyphasic study was undertaken to determine the taxonomic position of five strains. The strains were characterized by 16S rRNA and atpA sequence analysis, matrix-assisted laser desorption ionization time-of-flight (MALDI-TOF) mass spectrometry and conventional phenotypic testing. Whole-genome sequences were determined for strains 1485E(T) and 2463D, and the average nucleotide and amino acid identities were determined for these strains. The strains formed a robust phylogenetic clade, divergent from all other species of the genus Campylobacter. In contrast to most currently known members of the genus Campylobacter, the strains showed growth at ambient temperatures, which might be an adaptation to their reptilian hosts. The results of this study clearly show that these strains isolated from reptiles represent a novel species within the genus Campylobacter, for which the name Campylobacter iguaniorum sp. nov. is proposed. The type strain is 1485E(T) ( = LMG 28143(T) = CCUG 66346(T)). © 2015 IUMS.

  6. Taxonomic study of bacteria isolated from plants: proposal of Sphingomonas rosa sp. nov., Sphingomonas pruni sp. nov., Sphingomonas asaccharolytica sp. nov., and Sphingomonas mali sp. nov.

    Science.gov (United States)

    Takeuchi, M; Sakane, T; Yanagi, M; Yamasato, K; Hamana, K; Yokota, A

    1995-04-01

    The taxonomic positions of 10 strains of 3-ketolactose-forming bacteria which were isolated from the roots of plants (Rosa sp., Psychotria nairobiensis, Ardisia crispa, Prunus persica, and apple trees) were investigated. The DNA base compositions of these strains ranged from 64.0 to 65.7 mol%, the isoprenoid quinone of each strain was ubiquinone 10, 3-hydroxy fatty acids were lacking in the cellular fatty acids of these organisms, and all of the strains contained a sphingolipid with the long-chain base dihydrosphingosin. These are characteristics of the genus Sphingomonas. On the basis of morphological, physiological, and chemotaxonomic characteristics, together with DNA-DNA hybridization and 16S ribosomal DNA sequence comparison data, we propose the following four new species of the genus Sphingomonas: Sphingomonas rosa (type strain, IFO 15208) for the strains isolated from rose plants and formerly named [Agrobacterium rhizogenes]; Sphingomonas pruni (type strain, IFO 15498) for the strains isolated from Prunus persica; and Sphingomonas asaccharolytica (type strain, IFO 15499) and Sphingomonas mali (type strain, IFO 15500) for the strains isolated from apple trees. Two strains which were isolated from Psychotria nairobiensis and formerly named [Chromobacterium lividum] were identified as Sphingomonas yanoikuyae strains.

  7. Chryseobacterium solincola sp. nov., isolated from soil.

    Science.gov (United States)

    Benmalek, Yam; Cayol, Jean-Luc; Bouanane, Nabila A; Hacene, Hocine; Fauque, Guy; Fardeau, Marie-Laure

    2010-08-01

    A Gram-staining-negative, yellow-pigmented, strictly aerobic bacterium, designated strain 1YB-R12T, was isolated from a soil sample in western Algeria. The novel isolate was heterotrophic, chemoorganotrophic, halotolerant and psychrotolerant. The temperature and pH optima for growth were 28-30 degrees C and pH 7.3-8. The bacterium tolerated up to 6% (w/v) NaCl. Cells were non-motile, non-gliding and non-spore-forming, and were characterized by a variable morphological cycle. Flexirubin-type pigments were not detected. 16S rRNA gene sequence analysis showed that strain 1YB-R12T occupied a distinct lineage within the genus Chryseobacterium and shared highest sequence similarity with Chryseobacterium haifense LMG 24029T (96.5%). The DNA G+C content of strain 1YB-R12T was 40.9 mol%. The predominant cellular fatty acids were anteiso-C15:0 (41.4%) and iso-C15:0 (14.4%). On the basis of phenotypic properties and phylogenetic distinctiveness, strain 1YB-R12T is considered to represent a novel species of the genus Chryseobacterium, for which the name Chryseobacterium solincola sp. nov. is proposed. The type strain is 1YB-R12T (=DSM 22468T=CCUG 55604T).

  8. Production of biodiesel from Coelastrella sp. microalgae

    Science.gov (United States)

    Mansur, Dieni; Fitriady, Muhammad Arifuddin; Susilaningsih, Dwi; Simanungkalit, Sabar Pangihutan

    2017-11-01

    Microalgae have a wide area of usage and one of them it can be used for biodiesel production. In biodiesel production, lipids containing triglyceride or free fatty acid are converted into methyl ester through trans/esterification reactions. Lipids from microalgae can be extracted by acetone and dimethyl carbonate using homogenizer. Esterification of the lipids was investigated using various catalysts and source of methyl group. Activity of homogeneous catalyst such as HCl and H2SO4 and heterogeneous catalysts such as montmorillonit K-10 and ledgestone was investigated. Moreover, methanol and dimethyl carbonate as source of methyl group were also studied. Among of catalysts with methanol as source of methyl group, it was found that yield of crude biodiesel derived from Choelestrella Sp. microalgae was high over H2SO4 catalyst. On the other hand, over H2SO4 catalyst using dimethyl carbonate as source of methyl group, yield of crude biodiesel significant increase. However, FAME composition of crude biodiesel was high over HCl catalyst.

  9. Mycorrhizal dependency of laurel (Ocotea sp.)

    International Nuclear Information System (INIS)

    Sierra-Escobar, Jorge A; Castro Restrepo, Dagoberto; Osorio Vega, Walter

    2009-01-01

    A greenhouse experiment was carried out to determine the mycorrhizal dependency of laurel (>Ocotea sp.). In order to do this, a completely randomized experimental design was used, with six treatments in a factorial array of 3 x 2 and five repetitions. The treatments involved a combination of three Phosphorus (P) levels in soil solution (0.002, 0.02 and 0.2 mg L-1) and two levels of mycorrhizal inoculation, either inoculated or non-inoculated with Glomus aggregatum Schenck and Smith. The leaf P content as a function of time was used as an output variable. Shoot dry matter, shoot P content, mycorrhizal colonization of roots, and mycorrhizal dependence were measured at harvest. The results indicated that the leaf P content increased significantly when using the mycorrhizal inoculation in laurel at P level 0.2 mg L -1, but not in the other P levels, on some of the sampling days. Shoot dry weight and total plant P content did not increase at all levels of soil available P. Mycorrhizal dependency of laurel reached 28%, which allows this species to be classified as moderately dependent on mycorrhiza.

  10. The Growth of Monoraphidium sp. and Scenedesmus sp. Cells in the Presence of Thorium

    Directory of Open Access Journals (Sweden)

    Juliana Cristina de Queiroz

    2012-01-01

    Full Text Available Toxicity of thorium by Monoraphidium sp. and Scenedesmus sp. was studied. Microalgal cultures were inoculated in ASM-1 medium in presence and absence of thorium. Its effect was monitored by direct counting on Fuchs-Rosenthal chamber and with software. The toxicity of thorium over the species was observed for concentrations over 50.0 mg/L. After 30 days, Monoraphidium cells decreased their concentration from 4.23×106 to 4.27×105 and 8.57×105 cells/mL, in the presence of 50.0 and 100.0 mg/L of thorium, respectively. Scenedesmus sp. cells were more resistant to thorium: for an initial cell concentration of 7.65×104 cells/mL it was observed a change to 5.25×105 and 5.12×105 cells/mL, in the presence of thorium at 50.0 and 100.0 mg/L, respectively. This is an indication that low concentrations of the radionuclide favored the growth, and that Scenedesmus cells are more resistant to thorium than Monoraphidium cells. The software used for comparison with direct count method proved to be useful for the improvement of accuracy of the results obtained, a decrease in the uncertainty and allowed recording of the data. The presence of thorium suggests that low concentrations have a positive effect on the growth, due to the presence of the nitrate, indicating its potential for ecotoxicological studies.

  11. Aborto eqüino por Leptospira sp. Leptospira sp. as a cause of equine abortion

    Directory of Open Access Journals (Sweden)

    Caroline Argenta Pescador

    2004-02-01

    Full Text Available Descreve-se um caso de aborto eqüino por Leptospira sp. em um feto de 6 meses proveniente de um estabelecimento localizado próximo a Porto Alegre/RS. As lesões macroscópicas se caracterizaram por icterícia e hemorragias distribuídas difusamente sobre a pele, mucosa oral, tecido subcutâneo, pulmão, coração e sistema gastrintestinal. O fígado estava aumentado de tamanho, friável e de coloração amarelada. Os rins apresentavam hemorragias petequiais na superfície capsular e na superfície de corte observaram-se palidez da região cortical e medular. Cortes de rim e sistema nervoso central, corados por Warthin-Starry, revelaram a presença de espiroquetas nos túbulos, glomérulos e substância branca do encéfalo. Cultivo aeróbio de amostras de fígado e pulmão não revelaram crescimento bacteriano significativo. O teste de imunofluorescência direta para Leptospira sp. foi positivo e a sorologia fetal resultou numa titulação de 80 para o sorovar copenhageni e 40 para os sorovares icterohaemorragiae e pomona.This report describes an abortion on 6-month-old equine aborted fetus that has been caused by Leptospira sp. Main lesions included jaundice and hemorrhages diffusely scattered throughout the skin, oral mucosa, subcutaneous tissues, lungs, heart and gastrointestinal system. The liver was enlarged, pliable and yellow colored. The cortical and medullar of the kidneys were pale and petechial hemorrhages were present on the capsular surface. Warthin-Starry stained slices of the kidneys and central nervous system revealed the presence of spirochaetes within the tubules, glomeruli and white matter of the encephalo. Aerobic cultivation from samples of the liver and lungs were negative. The direct immunofluorescence test for Leptospira sp. was positive and the fetus’s serological test resulted titers of 80 against sorotype copenhageni and 40 against the sorotypes icterohaemorragiae and pomona.

  12. Microfibril-associated Protein 4 Binds to Surfactant Protein A (SP-A) and Colocalizes with SP-A in the Extracellular Matrix of the Lung

    DEFF Research Database (Denmark)

    Schlosser, Anders; Thomsen, Theresa H.; Shipley, J. Michael

    2006-01-01

    Pulmonary surfactant protein A (SP-A) is an oligomeric collectin that recognizes lipid and carbohydrate moieties present on broad range of micro-organisms, and mediates microbial lysis and clearance. SP-A also modulates multiple immune-related functions including cytokine production and chemotaxis......-A composed of the neck region and carbohydrate recognition domain of SP-A indicating that the interaction between MFAP4 and SP-A is mediated via the collagen domain of SP-A. Monoclonal antibodies directed against MFAP4 and SP-A were used for immunohistochemical analysis, which demonstrates that the two...

  13. In vitro micropropagation of orchid, Oncidium sp. (Dancing Dolls ...

    African Journals Online (AJOL)

    Oncidium sp.). In vitro regeneration multiplication and rooting of plantlets were achieved from the immature seeds on Murashige and Skoog's medium supplemented with BAP (2.0 mg/l). Rooted plantlets were then transferred to perforated ...

  14. 4-Dehydroecdysterone, a new ecdysteroid from the zoanthid Parazoanthus sp.

    Science.gov (United States)

    Searle, P A; Molinski, T F

    1995-02-01

    A novel ecdysteroid, 4-dehydroecdysterone [3], has been isolated from the zoanthid Parazoanthus sp. collected from Port Phillip Bay, Australia. The known ecdysteroids ecdysterone [1] and ajugasterone C [2] were also isolated, together with the known alkaloid paragracine [4].

  15. Biomineralization of a calcifying ureolytic bacterium Microbacterium sp. GM-1

    Directory of Open Access Journals (Sweden)

    Guojing Xu

    2017-01-01

    Conclusions: The results of this research provide evidence that Microbacterium sp. GM-1 can biologically induce calcification and suggest that strain GM-1 may play a potential role in the synthesis of new biominerals and in bioremediation or biorecovery.

  16. Biotransformation of 6-deoxypseudoanisatin by Synechocystis sp. PCC6803

    Directory of Open Access Journals (Sweden)

    Zhi Wang

    2014-10-01

    Conclusion: Thus, the study appears to demonstrate that Synechocystis sp. PCC6803 can transform 6-deoxypseudoanisatin. The polarity of the converted product is less than that of 6-deoxypseudoanisatin.

  17. Volvatellin, caulerpenyne-related product fromt he sacoglossan Volvatella sp.

    Digital Repository Service at National Institute of Oceanography (India)

    Fontana, A; Ciavatta, M.L.; Mollo, E; Naik, C.G.; Wahidullah, S.; De; Cimino, G.

    Volvatellin (4) is a highly unstable terpene isolated from the extracts of the Indian opisthobranch mollusk Volvatella sp. The structure and the relative stereochemistry of 4 were determined by NMR methods. The paper also describes a hypothetical...

  18. Massarina armatispora sp. nov., a new intertidal ascomycete from mangroves

    Digital Repository Service at National Institute of Oceanography (India)

    Hyde, K.D.; Vrijmoed, L.L.P.; Chinnaraj, S.; Jones, E.B.G.

    Massarina armatispora sp. nov. is described from dead intertidal mangrove wood collected in India and Hong Kong. The new taxon is compared with other M. species, and its placement in the genus Massarina is discussed...

  19. Kinetic characterization of steroid 1,2-dehydrogenase from a new Mycobacterium sp mutant of industrial interest

    OpenAIRE

    Alina Falero; Nury Llanes; Celso Pérez; Blanca R. Hung; Belinda Aguila; Magdalena Fonseca; Emilia Hervé

    2004-01-01

    Se realizó un estudio cinético de la enzima esteroide 1,2-deshidrogenasa con células enteras de la cepa 6323, la cual fue aislada por mutagénesis-UV a partir de Ex4, mutante derivada de Mycobacterium NRRL-B3683, obtenida previamente por mutagénesis-UV a partir de un aislado del suelo. La esteroide 1,2-deshidrogenasa es una enzima clave para la biotransformación del sistema de anillos de estos compuestos, la cual es esencial en el metabolismo microbiano de los esteroides. Con anterioridad se h...

  20. Environmental interactions and the SP-100 power system

    International Nuclear Information System (INIS)

    Ferguson, D.C.

    1993-01-01

    The Civil Space Technology Initiative High-Capacity-Power Environmental Interactions Program has made great progress in defining and evaluating the interactions of the SP-100 power system with its expected ambient environments. The NASCAP/LEO and POLAR computer codes demonstrated that local electric fields at the user interface module are high. Therefore, particular attention must be paid to geometries and materials in this region to prevent arcing at conductor-insulator junctions in low Earth orbit. NASCAP/LEO and EPSAT computer models revealed that SP-100 payloads float about 100 V negative of the LEO plasma. In addition, ground tests and modeling done for the Space Station Freedom Electrical Grounding Tiger Team found that dielectric coatings often break down at such voltages in a plasma. Thus, surface coatings for SP-100 payloads should be carefully selected. Sputtering may also be a concern for long-duration missions in LEO at these voltages. Much work has been done on a sputtering model to evaluate surface material loss rates on SP-100 payloads. In ground plasma chamber tests of cables and cable insulators at SP-100 voltages, parasitic power losses due to the plasma current collected from possible pinholes or coating defects were quantified and shown to be small. Modeling revealed that the power loss from currents to other surfaces is also small. The atomic oxygen durability of SP-100 materials and coatings continues to be investigated in ground tests. In the upcoming Evaluation of Oxygen Interaction with Materials (EOIM-3) Shuttle flight experiment, a host of SP-100 materials will be evaluated for atomic oxygen durability in LEO. Finally, an evaluation of the interactions of the SP-100 power system with lunar and planetary environments has started. At a workshop on chemical and electrical interactions on Mars recently held at the NASA Lewis Research Center, many of primary interactions were identified

  1. Idiopathic granulomatous mastitis associated with corynebacterium sp. Infection.

    Science.gov (United States)

    Stary, Creed Michael; Lee, Yun Sun; Balfour, John

    2011-05-01

    Idiopathic granulomatous mastitis (IGM) is a rare inflammatory condition of the breast. The etiology and treatments options of IGM remain controversial. Previous case reports have suggested that Corynebacterium sp., a gram-positive bacillus endogenous to the skin, may be associated with IGM. In the present report, we describe the first case of IGM with a positive culture for Corynebacterium sp. reported in the United States.

  2. Pigment Production from Immobilized Monascus sp. Utilizing Polymeric Resin Adsorption

    OpenAIRE

    Evans, Patrick J.; Wang, Henry Y.

    1984-01-01

    Pigment production by the fungus Monascus sp. was studied to determine why Monascus sp. provides more pigment in solid culture than in submerged culture. Adding a sterilized nonionic polymeric adsorbent resin directly to the growing submerged culture did not enhance the pigment production, thus indicating that pigment extraction is probably not a factor. Monascus cells immobilized in hydrogel were studied and exhibited decreased pigment production as a result of immobilization. This result is...

  3. Three new anascosporic genera of the Saccharomycotina: Danielozyma gen. nov., Deakozyma gen. nov. and Middelhovenomyces gen. nov.

    Science.gov (United States)

    Kurtzman, Cletus P; Robnett, Christie J

    2014-05-01

    Three new non-ascosporic, ascomycetous yeast genera are proposed based on their isolation from currently described species and genera. Phylogenetic placement of the genera was determined from analysis of nuclear gene sequences for D1/D2 large subunit rRNA, small subunit rRNA, translation elongation factor-1α and RNA polymerase II, subunits B1 and B2. The new taxa are: Deakozyma gen. nov., type species Deakozyma indianensis sp. nov. (type strain NRRL YB-1937, CBS 12903); Danielozyma gen. nov., type species Danielozyma ontarioensis comb. nov. (type strain NRRL YB-1246, CBS 8502); D. litseae comb. nov. (type strain NRRL YB-3246, CBS 8799); Middelhovenomyces gen. nov., type species Middelhovenomyces tepae comb. nov. (type strain NRRL Y-17670, CBS 5115) and M. petrohuensis comb. nov. (type strain NRRL Y-17663, CBS 8173).

  4. Uranium and thorium uptake by live and dead cells of Pseudomonas Sp

    International Nuclear Information System (INIS)

    Siva Prasath, C.S.; Manikandan, N.; Prakash, S.

    2010-01-01

    This study presents uptake of uranium (U) and thorium (Th) by live and dead cells of Pseudomonas Sp. Increasing concentration of U and Tb showed decrease in absorption by Pseudomonas Sp. Dead cells of Pseudomonas Sp. exhibited same or more uptake of U and Th than living cells. Increasing temperature promotes uptake of U and Th by Pseudomonas Sp. (author)

  5. Verrucosispora andamanensis sp. nov., isolated from a marine sponge.

    Science.gov (United States)

    Supong, Khomsan; Suriyachadkun, Chanwit; Suwanborirux, Khanit; Pittayakhajonwut, Pattama; Thawai, Chitti

    2013-11-01

    An actinomycete strain, SP03-05(T), was isolated from a marine sponge sample (Xestospongia sp.) collected from Phuket Province of Thailand. The strain was aerobic, Gram-stain-positive and produced single spores at the tips of the substrate mycelium. Strain SP03-05(T) contained meso-diaminopimelic acid in the peptidoglycan; whole-cell sugars were arabinose, galactose, glucose, rhamnose, ribose and xylose. The polar lipid profile of strain SP03-05(T) consisted of phosphatidylethanolamine, diphosphatidylglycerol, phosphatidylinositol, phosphatidylinositol mannosides and unknown polar lipids. Morphological and chemotaxonomic characteristics of the strain identified it as a member of the family Micromonosporaceae. Phylogenetic analysis based on 16S rRNA gene sequences showed similarity of the strain to Verrucosispora lutea YIM 013(T) (96.90 %), Verrucosispora sediminis MS426(T) (96.90 %), Verrucosispora gifhornensis DSM 44337(T) (96.80 %), Verrucosispora maris AB-18-032(T) (96.80 %) and Verrucosispora qiuiae RtIII47(T) (95.40 %). The DNA G+C content was 72.4 mol%. The phenotypic, genotypic and DNA-DNA hybridization results supported the classification of this strain as a representative of a novel species in the genus Verrucosispora, for which the name Verrucosispora andamanensis sp. nov. is proposed. The type strain is SP03-05(T) ( = BCC 45620(T) = NBRC 109075(T)).

  6. Cellulomonas soli sp. nov. and Cellulomonas oligotrophica sp. nov., isolated from soil.

    Science.gov (United States)

    Hatayama, Kouta; Esaki, Kouji; Ide, Teruhiko

    2013-01-01

    Two novel bacterial strains, designated Kc1(T) and Kc5(T), were isolated from soil in Japan. Cells of the novel strains were Gram-reaction-positive, aerobic or facultatively anaerobic, motile rods. Phylogenetic analyses based on 16S rRNA gene sequences indicated that both strains belonged to the genus Cellulomonas. The 16S rRNA gene sequences of strains Kc1(T) and Kc5(T) showed closest similarity to that of Cellulomonas terrae DB5(T) (98.1 % and 98.4 % similarity, respectively), and the 16S rRNA gene similarity between the two novel strains was 97.8 %. In both strains, the major menaquinone was MK-9(H(4)), the predominant polar lipids were diphosphatidylglycerol and phosphatidylinositol mannosides, and the peptidoglycan contained ornithine and glutamic acid. Cell-wall sugars were identified as rhamnose, galactose and mannose in strain Kc1(T) and rhamnose and glucose in strain Kc5(T). The DNA G+C contents of strains Kc1(T) and Kc5(T) were 73.6 mol% and 75.8 mol%, respectively. Based on the chemotaxonomic and physiological data and the results of DNA-DNA hybridizations, the two strains represent two novel species within the genus Cellulomonas, for which the names Cellulomonas soli sp. nov. (type strain Kc1(T) =DSM 24484(T) =JCM 17535(T)) and Cellulomonas oligotrophica sp. nov. (type strain Kc5(T) =DSM 24482(T) =JCM 17534(T)) are proposed.

  7. Halotolerant laccases from Chaetomium sp., Xylogone sphaerospora, and Coprinopsis sp. isolated from a Mediterranean coastal area.

    Science.gov (United States)

    Qasemian, Leila; Billette, Christophe; Guiral, Daniel; Alazard, Emilie; Moinard, Magalie; Farnet, Anne-Marie

    2012-10-01

    Laccases (EC 1.10.3.2) are phenoloxidases involved in the transformation of the recalcitrant fraction of organic matter in soil. These enzymes are also able to transform certain aromatic pollutants such as polycyclic aromatic hydrocarbons (PAHs) and are known to be inhibited by chloride ions. This study aims to test the potential of some fungal strains newly isolated from natural environments subjected to high osmotic pressure such as coastal ecosystems, to produce chloride tolerant laccases. Three strains were identified as Chaetomium sp., Xylogone sphaerospora (two Ascomycota), and Coprinopsis sp. (a Basidiomycota) and the laccases produced by these fungi were weakly inhibited by chloride ions compared with previous data from literature. Moreover, we tested their reactivity towards various PAHs which are widespread anthropic pollutants. They were able to transform anthracene to 9,10-anthraquinone and we determine 7.5 eV as the threshold of ionization potential for PAH oxidation by these laccases. Copyright © 2012 The British Mycological Society. Published by Elsevier Ltd. All rights reserved.

  8. Description and phylogenetic relationships of Spumochlamys perforata n. sp. and Spumochlamys bryora n. sp. (Amoebozoa, Arcellinida).

    Science.gov (United States)

    Kudryavtsev, Alexander; Pawlowski, Jan; Hausmann, Klaus

    2009-01-01

    Spumochlamys perforata n. sp. and Spumochlamys bryora n. sp. were isolated and described from dry epiphytic moss. The morphology and ultrastructure of both species clearly demonstrate that they belong to the genus Spumochlamys (family Microchlamyiidae). They differ from its only described member, Spumochlamys iliensis (as well as from species of Microchlamys), in the relief of the dorsal surface of the test, revealed by scanning electron microscopy, which can represent a good characteristic for species identification. They also differ in the structure of the dorsal part of the test wall (especially S. perforata). Small subunit ribosomal DNA-based molecular phylogenetic analyses show that Spumochlamys is a deeply branching lineage of the Arcellinida, without any close affinities. Actin gene sequence analysis places this genus within the Tubulinea, close to two other arcellinid lineages but without forming a monophyletic group with them. These data together strongly suggest that the lack of resolution in the arcellinid molecular phylogenies is due to serious undersampling of taxa, a limited number of sequence data, and high divergence rates in most of the species.

  9. Potencial de antagonismo de isolados de Trichoderma sp. contra o isolados de Fusarium sp., in vitro

    Directory of Open Access Journals (Sweden)

    Charles Anthony Hoffmann

    2015-06-01

    Full Text Available Resumo – O uso discriminado de agrotóxicos acarreta em uma grande prejuízo a saúdes das pessoas e do meio ambiente. O uso de novos métodos de combate a pragas se faz necessário para o equilíbrio da cadeia produtiva. A utilização de microrganismos no combate a pragas se faz como uma boa alternativa. O trabalho objetivou-se em avaliar o potencial de antagonismo de isolados de Trichoderma sp. contra o patógeno Fusarium sp. in vitro. Para isso foi utilizado os métodos de confronto direto, pareamento de culturas e de metabólitos voláteis. Os experimentos foram realizados na incubadora de empresas da Universidade Federal do Tocantins – UFT Campus de Gurupi, seguiram com três repetições. Foram testados 15 isolados do antagonista em confronto direto com o patógeno e os mesmos isolados e patógeno foram testados em metabólitos voláteis ambos utilizando o meio de cultura BDA. Todos os isolados apresentaram antagonismo in vitro contra o patógeno.

  10. Identification and production of bioflocculants by Enterobacter sp. and Bacillus sp. and their characterization studies.

    Science.gov (United States)

    Muthulakshmi, L; Nellaiah, H; Kathiresan, T; Rajini, N; Christopher, Fenila

    2017-05-28

    In this work, two bioflocculants, namely, EB-EPS and B1-EPS, were derived from Enterobacter sp. and Bacillus sp., respectively, and analyzed with regard to their production and characterization. About 0.9 and 0.16 g of purified EB and B1 were obtained from I L of fermentation broth. Chemical analysis showed the contents of purified EB and B1 mainly as 88.7 and 92.8% (w/w) of carbohydrate, and 11.3 and 21.8% (w/w) protein, respectively. Fourier-transform infrared spectrometry analysis revealed the presence of hydroxyl, amide, and carboxyl groups in the identified bioflocculant. Thermogravimetric analysis (TGA) results exhibited enhanced thermal stability with a minimum mass loss of 50% while 25% were found to have occurred at higher temperatures (>400°C) for microbe-derived compounds EB and B1 leading to the possibility of using these compounds as fillers or for fabricating composite films for high-temperature applications. Further, the compounds from both the bacteria exhibited good antibacterial characteristics against pathogenic Escherichia coli. Degradability study of bioflocculant-embedded composite films shows the possibility of attaining eco-friendly bioremediation. Accordingly, experimental results revealed the suitability of developed composite films as a suitable alternative for food packaging and biomedical applications.

  11. Listeria booriae sp. nov. and Listeria newyorkensis sp. nov., from food processing environments in the USA.

    Science.gov (United States)

    Weller, Daniel; Andrus, Alexis; Wiedmann, Martin; den Bakker, Henk C

    2015-01-01

    Sampling of seafood and dairy processing facilities in the north-eastern USA produced 18 isolates of Listeria spp. that could not be identified at the species-level using traditional phenotypic and genotypic identification methods. Results of phenotypic and genotypic analyses suggested that the isolates represent two novel species with an average nucleotide blast identity of less than 92% with previously described species of the genus Listeria. Phylogenetic analyses based on whole genome sequences, 16S rRNA gene and sigB gene sequences confirmed that the isolates represented by type strain FSL M6-0635(T) and FSL A5-0209 cluster phylogenetically with Listeria cornellensis. Phylogenetic analyses also showed that the isolates represented by type strain FSL A5-0281(T) cluster phylogenetically with Listeria riparia. The name Listeria booriae sp. nov. is proposed for the species represented by type strain FSL A5-0281(T) ( =DSM 28860(T) =LMG 28311(T)), and the name Listeria newyorkensis sp. nov. is proposed for the species represented by type strain FSL M6-0635(T) ( =DSM 28861(T) =LMG 28310(T)). Phenotypic and genotypic analyses suggest that neither species is pathogenic. © 2015 IUMS.

  12. Watery rot of pseudo-stem (Dickeya sp. management in banana (Musa sp. under greenhouse conditions

    Directory of Open Access Journals (Sweden)

    Joaquín Guillermo Ramírez

    2014-12-01

    Full Text Available This crop has serious constraints with diseases, including those caused by bacteria, such as Dickeya sp. This research aimed to evaluate the effect of 4 resistance inductors and 3 doses in Chlorine Dioxide in handling watery rot of pseudo-stem (Dickeya sp. in banana. Resistance inducers and their doses were Potassium Phosphite: 1.5 cm 3 .l -1 ; 3-Aminobutanoic Acid: 1.0 g.l -1 ; Methyl Jasmonate: 0.2 g.l -1 ; S-Methyl-Acibenzolar: 0.3 ml.l -1 , all by foliar application, while Chlorine Dioxide was injected into the pseudo-stem, in doses of 10, 20 and 30 mg.l -1 . The evaluated variables were: development of the disease, total biomass and quantification of the bacterium in the inoculated pseudo-stems. Applications of Chlorine Dioxide achieved a reduction of disease by 65.4, 91.99 and 61.5%, in addition to an inhibition of 100% of the pathogen, using 30 and 50 mg.l -1 doses. Meanwhile, the use of resistance inductors reduced up to 60.6% of the disease, but this effect failed to improve plant growth.

  13. Lactobacillus saniviri sp. nov. and Lactobacillus senioris sp. nov., isolated from human faeces.

    Science.gov (United States)

    Oki, Kaihei; Kudo, Yuko; Watanabe, Koichi

    2012-03-01

    Two Gram-stain-positive strains, YIT 12363(T) and YIT 12364(T), were isolated from human faeces. They were rod-shaped, non-motile, asporogenous, facultatively anaerobic and did not exhibit catalase activity. Comparative analyses of 16S rRNA, pheS and rpoA gene sequences demonstrated that the novel strains were members of the genus Lactobacillus. On the basis of 16S rRNA gene sequence similarity, the type strains of Lactobacillus casei (95.3% similarity), Lactobacillus paracasei subsp. paracasei (95.6%), Lactobacillus paracasei subsp. tolerans (95.3%) and Lactobacillus rhamnosus (95.4%) were the closest neighbours to strain YIT 12363(T). For strain YIT 12364(T), the highest similarity values were observed with the type strains of Lactobacillus diolivorans, Lactobacillus parafarraginis and Lactobacillus rapi (95.8, 96.0 and 96.0%, respectively). Phenotypic and genotypic features demonstrated that these strains each represent a separate novel species of the genus Lactobacillus, and the names Lactobacillus saniviri sp. nov. (type strain YIT 12363(T)=JCM 17471(T)=DSM 24301(T)) and Lactobacillus senioris sp. nov. (type strain YIT 12364(T)=JCM 17472(T)=DSM 24302(T)), respectively, are proposed.

  14. Prevotella copri sp. nov. and Prevotella stercorea sp. nov., isolated from human faeces.

    Science.gov (United States)

    Hayashi, Hidenori; Shibata, Kensaku; Sakamoto, Mitsuo; Tomita, Shinichi; Benno, Yoshimi

    2007-05-01

    Six strains (CB7(T), CB18, CB23, CB26, CB28 and CB35(T)) were isolated from human faeces. Based on phylogenetic analysis, phenotypic characteristics, cellular fatty acid profiles and menaquinone profiles, these strains could be included within the genus Prevotella and made up two clusters. 16S rRNA gene sequence analysis indicated that five strains were most closely related to Prevotella veroralis, sharing about 92 % sequence similarity; the remaining strain was most closely related to Prevotella shahii, sharing about 90 % sequence similarity. All six strains were obligately anaerobic, non-pigmented, non-spore-forming, non-motile, Gram-negative rods. The cellular fatty acid compositions of the six strains differed significantly from those of other Prevotella species. Five strains (CB7(T), CB18, CB23, CB26 and CB28) contained dimethyl acetals and the major menaquinones of these strains were MK-11, MK-12 and MK-13. The major menaquinones of CB35(T) were MK-12 and MK-13. Based on phenotypic and phylogenetic findings, two novel species, Prevotella copri sp. nov. and Prevotella stercorea sp. nov., are proposed, representing the two different strain clusters. The DNA G+C contents of strains CB7(T) and CB35(T) were 45.3 and 48.2 mol%, respectively. The type strains of P. copri and P. stercorea are CB7(T) (=JCM 13464(T)=DSM 18205(T)) and CB35(T) (=JCM 13469(T)=DSM 18206(T)), respectively.

  15. Lactobacillus plajomi sp. nov. and Lactobacillus modestisalitolerans sp. nov., isolated from traditional fermented foods.

    Science.gov (United States)

    Miyashita, Mika; Yukphan, Pattaraporn; Chaipitakchonlatarn, Winai; Malimas, Taweesak; Sugimoto, Masako; Yoshino, Mayumi; Kamakura, Yuki; Potacharoen, Wanchern; Tanasupawat, Somboon; Tanaka, Naoto; Nakagawa, Yasuyoshi; Suzuki, Ken-ichiro

    2015-08-01

    Three Lactobacillus-like strains, NB53T, NB446T and NB702, were isolated from traditional fermented food in Thailand. Comparative 16S rRNA gene sequence analysis indicated that these strains belong to the Lactobacillus plantarum group. Phylogenetic analysis based on the dnaK, rpoA, pheS and recA gene sequences indicated that these three strains were distantly related to known species present in the L. plantarum group. DNA-DNA hybridization with closely related strains demonstrated that these strains represented two novel species; the novel strains could be differentiated based on chemotaxonomic and phenotypic characteristics. Therefore, two novel species of the genus Lactobacillus, Lactobacillus plajomi sp. nov. (NB53T) and Lactobacillus modestisalitolerans sp. nov. (NB446T and NB702), are proposed with the type strains NB53T ( = NBRC 107333T = BCC 38054T) and NB446T ( = NBRC 107235T = BCC 38191T), respectively.

  16. Streptococcus loxodontisalivarius sp. nov. and Streptococcus saliviloxodontae sp. nov., isolated from oral cavities of elephants.

    Science.gov (United States)

    Saito, Masanori; Shinozaki-Kuwahara, Noriko; Hirasawa, Masatomo; Takada, Kazuko

    2014-09-01

    Four Gram-stain-positive, catalase-negative, coccoid-shaped organisms were isolated from elephant oral cavities. The isolates were tentatively identified as streptococcal species based on the results of biochemical tests. Comparative 16S rRNA gene sequencing studies confirmed the organisms to be members of the genus Streptococcus. Two isolates (NUM 6304(T) and NUM 6312) were related most closely to Streptococcus salivarius with 96.8 % and 93.1 % similarity based on the 16S rRNA gene and the RNA polymerase β subunit encoding gene (rpoB), respectively, and to Streptococcus vestibularis with 83.7 % similarity based on the 60 kDa heat-shock protein gene (groEL). The other two isolates (NUM 6306(T) and NUM 6318) were related most closely to S. vestibularis with 97.0 % and 82.9 % similarity based on the 16S rRNA and groEL genes, respectively, and to S. salivarius with 93.5 % similarity based on the rpoB gene. Based on phylogenetic and phenotypic evidence, these isolates are suggested to represent novel species of the genus Streptococcus, for which the names Streptococcus loxodontisalivarius sp. nov. (type strain NUM 6304(T) = JCM 19287(T) = DSM 27382(T)) and Streptococcus saliviloxodontae sp. nov. (type strain NUM 6306(T) = JCM 19288(T) = DSM 27513(T)) are proposed. © 2014 IUMS.

  17. Streptococcus moroccensis sp. nov. and Streptococcus rifensis sp. nov., isolated from raw camel milk.

    Science.gov (United States)

    Kadri, Zaina; Amar, Mohamed; Ouadghiri, Mouna; Cnockaert, Margo; Aerts, Maarten; El Farricha, Omar; Vandamme, Peter

    2014-07-01

    Two catalase- and oxidase-negative Streptococcus-like strains, LMG 27682(T) and LMG 27684(T), were isolated from raw camel milk in Morocco. Comparative 16S rRNA gene sequencing assigned these bacteria to the genus Streptococcus with Streptococcus rupicaprae 2777-2-07(T) as their closest phylogenetic neighbour (95.9% and 95.7% similarity, respectively). 16S rRNA gene sequence similarity between the two strains was 96.7%. Although strains LMG 27682(T) and LMG 27684(T) shared a DNA-DNA hybridization value that corresponded to the threshold level for species delineation (68%), the two strains could be distinguished by multiple biochemical tests, sequence analysis of the phenylalanyl-tRNA synthase (pheS), RNA polymerase (rpoA) and ATP synthase (atpA) genes and by their MALDI-TOF MS profiles. On the basis of these considerable phenotypic and genotypic differences, we propose to classify both strains as novel species of the genus Streptococcus, for which the names Streptococcus moroccensis sp. nov. (type strain, LMG 27682(T)  = CCMM B831(T)) and Streptococcus rifensis sp. nov. (type strain, LMG 27684(T)  = CCMM B833(T)) are proposed. © 2014 IUMS.

  18. Optimization of Chlorella SP. Flour Fortification in the Processing of Nata

    OpenAIRE

    Zulistiara, Juanidia; ', Syahrul; ', Sumarto

    2017-01-01

    This research aimed to study the effect of Chlorella sp.different weight and to find out the optimum weigth of Chlorella sp. flour fortified into the nata. The method used was experimental, that was fortification of Chlorella sp. flour in the processing of nata. The design used was a non-factorial completely randomized design, consisted of 4 weigth levels, namely: no Chlorella sp. flour added (N1), added with 2 gs Chlorella sp. Flour (N2), 4 gs Chlorella sp. flour (N3) and 6 gs Chlorella sp. ...

  19. Benefit Analysis of SPC Panel SP-7 Projects and Evaluation of SPC Panel SP-7 Management and Administration

    National Research Council Canada - National Science Library

    Robinson, Rodney A

    1993-01-01

    .... Projects that have provided important reference information have also been beneficial. This Task has also assessed the opinion of the shipyard using community on the administration and management of Panel SP-7 itself...

  20. Benefit Analysis of SPC Panel SP-4 Projects and Evaluation of SPC Panel SP-4 Management and Administration

    National Research Council Canada - National Science Library

    Robinson, Rodney A

    1993-01-01

    This Task has investigated the benefits derived from the projects sponsored during the past 12 years by SNAME Ship Production Committee Panel SP-4 on Design/Production Integration under the National...

  1. Benefit Analysis of SPC Panel SP-3 Projects and Evaluation of SPC Panel SP-3 Management and Administration

    National Research Council Canada - National Science Library

    Robinson, Rodney A

    1993-01-01

    This Task has investigated the benefits derived from the projects sponsored during the past 4 years by SNAME Ship Production Committee Panel SP-3 on Surface Preparation and Coatings under the National...

  2. Rhopalophthalmus constrictus sp. nov. and Australomysis reubeni sp. nov. (Crustacea-Mysidacea) from south-west Australian waters

    Digital Repository Service at National Institute of Oceanography (India)

    Panampunnayil, S.U.

    Two new species of mysids are described, Rhopalophthalmus constrictus sp. nov. is in having a well-produced triangular rostral plate, pleural plates on the anterior five abdominal somites and prominent constriction at the distal end of the telson...

  3. Enhanced photocatalytic activity induced by sp 3 to sp 2 transition of carbon dopants in BiOCl crystals

    KAUST Repository

    Sun, Jianguo

    2017-09-19

    The insufficient light absorption and low quantum efficiency limit the photocatalytic performance of wide bandgap semiconductors. Here, we report a facile strategy to engineer the surface disordered defects of BiOCl nanosheets via carbon doping. The surface defects boost the light absorption and also the quantum yields, as the doped carbon atoms exhibit a transition from sp3 to sp2 hybridization at elevated temperature, corresponding to a change of assembly state from 3D cluster to 2D graphite-like structure. This transition results in an effective charge separation and thus one order of enhancement in photocatalytic activity toward phenol degradation under visible light. The current study opens an avenue to introduce sp3 to sp2 transition of carbon dopants for simultaneous increment of light absorption and quantum efficiency for application in photocatalysis and energy conversion.

  4. Growth kinetics and biodeterioration of polypropylene microplastics by Bacillus sp. and Rhodococcus sp. isolated from mangrove sediment.

    Science.gov (United States)

    Auta, H S; Emenike, C U; Jayanthi, B; Fauziah, S H

    2018-02-01

    Interest in the biodegradation of microplastics is due to their ubiquitous distribution, availability, high persistence in the environment and deleterious impact on marine biota. The present study evaluates the growth response and mechanism of polypropylene (PP) degradation by Bacillus sp. strain 27 and Rhodococcus sp. strain 36 isolated from mangrove sediments upon exposure to PP microplastics. Both bacteria strains were able to utilise PP microplastic for growth as confirmed by the reduction of the polymer mass. The weight loss was 6.4% by Rhodococcus sp. strain 36 and 4.0% by Bacillus sp. strain 27 after 40days of incubation. PP biodegradation was further confirmed using Fourier-transform infrared spectroscopy and scanning electron microscopy analyses, which revealed structural and morphological changes in the PP microplastics with microbial treatment. These analyses showed that the isolates can colonise, modify and utilise PP microplastics as carbon source. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Planomonospora corallina sp. nov., isolated from soil.

    Science.gov (United States)

    Suriyachadkun, Chanwit; Ngaemthao, Wipaporn; Chunhametha, Suwanee

    2016-08-01

    A novel actinomycete strain, A-T 11038T, was isolated from bamboo rhizospheric soil collected in Thailand. Based on a polyphasic approach, the novel strain was characterized as a member of the genus Planomonospora, which developed cylindrical to clavate sporangia containing a single motile spore on aerial mycelium. The 16S rRNA gene sequence and phylogenetic analysis indicated that strain A-T 11038T was closely related to Planomonospora sphaerica JCM 9374T (98.82 %), P.lanomonospora parontospora subsp. parontospora NBRC 13880T and P.parontospora subsp. antibiotica JCM 3094T (98.54 %), Planomonospora alba JCM 9373T (98.41 %) and Planomonospora venezuelensis JCM 3167T (97.51 %). The DNA-DNA relatedness values that distinguished strain A-T 11038T from the most closely related species were below 45 %. The novel strain contained meso-diaminopimelic acid in cell-wall hydrolysates, and rhamnose, ribose, madurose and glucose in whole-cell hydrolysates. The predominant menaquinone was MK-9(H2). The diagnostic phospholipids were diphosphatidylglycerol, phosphatidylmethylethanolamine, phosphatidylethanolamine, phosphatidylglycerol, phosphatidylinositol mannosides, phosphatidylinositol and aminophosphoglycolipids. The predominant cellular fatty acids were unsaturated fatty acids C17 : 1 and C16 : 1 and saturated fatty acid C16 : 0. The G+C content of the genomic DNA was 73.5 mol%. Following the evidence obtained using a polyphasic approach, the novel strain is proposed as a representative of a novel species to be named Planomonospora corallina sp. nov. The type strain is A-T 11038T (=BCC 67829T=TBRC 4489T=NBRC 110609T).

  6. Loktanella tamlensis sp. nov., isolated from seawater.

    Science.gov (United States)

    Lee, Soon Dong

    2012-03-01

    An aerobic, Gram-reaction-negative, chemo-organotrophic bacterium, designated strain SSW-35(T), was isolated from seawater in Jeju, Republic of Korea. Cells were motile, short rods; colonies were circular, smooth, convex, translucent and beige in colour. No diffusible pigment formed on any of the media tested. The bacterium grew at 4-30 °C and pH 7.1-10.1. Phylogenetic analysis based on 16S rRNA gene sequences showed that the organism was related to members of the genus Loktanella, its closest recognized relatives being Loktanella rosea Fg36(T) (98.1% sequence similarity) and Loktanella maricola DSW-18(T) (97.8%). Levels of 16S rRNA gene similarity between strain SSW-35(T) and other recognized species of the genus Loktanella were all <97%. Polar lipid analysis revealed the presence of diphosphatidylglycerol, phosphatidylcholine, phosphatidylethanolamine, phosphatidylglycerol and an unknown lipid as major components, as well as small amounts of two unknown phospholipids. The predominant ubiquinone was Q-10. The major cellular fatty acid was C(18:1) (summed feature 7), and the 3-hydroxy fatty acids detected were C(12:1) 3-OH and C(10:0) 3-OH. The genomic DNA G+C content was 55.0 mol%. In DNA-DNA hybridization experiments, the relatedness values between strain SSW-35(T) and the type strains of the phylogenetically closest recognized species were all <11%. On the basis of the phenotypic and genotypic characteristics, phylogenetic analysis and DNA-DNA relatedness, a novel species, Loktanella tamlensis sp. nov., is proposed. The type strain is SSW-35(T) (=KCTC 12722(T)=JCM 14020(T)).

  7. Morfologia da laringe de cutia (Dasyprocta sp.

    Directory of Open Access Journals (Sweden)

    Andrezza B.S. Silva

    2014-06-01

    Full Text Available A cutia (Dasyprocta sp. é um roedor silvestre com distribuição mundial. Atualmente, além de importante papel ecológico que exerce, está sendo utilizada como modelo em experimento animal. Estudos sobre a morfologia destes animais são importantes porque podem ser uma alternativa para o estudo de diversos processos patológicos, além de contribuirem para a preservação da espécie. A laringe é um órgão localizado entre a faringe e a traqueia, no qual está envolvido nas funções de respiração, deglutição e fonação. O presente estudo propôs realizar uma descrição morfológica macroscópica e microscópica da laringe da cutia. Para tanto, foram utilizadas quinze cutias pertencentes ao Centro de Ciências Agrárias da Universidade Federal do Piauí e provenientes do Núcleo de Estudos e Preservação de Animais Silvestres com licença do IBAMA (Nº 02/08-618, CTF Nº 474064. Todos os animais foram identificados, promovida a sexagem e, posteriormente, a laringe acessada e dissecada sendo os fragmentos cartilagíneos encaminhados para rotina histológica e corados pelo método de hematoxilina-eosina. As lâminas obtidas foram visualizadas em microscopia óptica de luz e foto documentadas. A laringe da cutia apresenta cinco cartilagens, com ausência da cartilagem cuneiforme e presença da incisura caudal na cartilagem tireoide. O tecido epitelial da laringe varia de epitélio estratificado pavimentoso queratinizado à não queratinizado e ciliado com células caliciformes.

  8. Phycicoccus soli sp. nov., isolated from soil.

    Science.gov (United States)

    Singh, Hina; Won, KyungHwa; Ngo, Hien T T; Du, Juan; Kook, MooChang; Yi, Tae-Hoo

    2015-08-01

    A Gram-stain-positive, non-motile, coccus-shaped bacterium, strain THG-a14T, was isolated from soil of Gyeyang mountain in Incheon, Republic of Korea. The isolate grew optimally at 28 °C, at pH 6.5-7.5 and with 0-3 % (w/v) NaCl. Based on 16S rRNA gene sequence comparisons, strain THG-a14T was closely related to Phycicoccus aerophilus 5516T-20T (97.7 %), P. ginsenosidimutans BXN5-13T (97.6 %), 'P. ochangensis' L1b-b9 (97.4 %) and P. bigeumensis MSL-03 (97.2 %). The DNA G+C content of strain THG-a14T was 71.6 mol%. In DNA-DNA hybridization, the DNA-DNA relatedness between strain THG-a14T and its closest phylogenetically neighbours was below 50.0 %. Strain THG-a14T was characterized chemotaxonomically as having meso-diaminopimelic acid in the cell-wall peptidoglycan. Strain THG-a14T contained glucose and ribose as whole-cell-wall sugars and menaquinone MK-8(H4) as the major isoprenoid quinone. Polar lipids in strain THG-a14T consisted of diphosphatidylglycerol, phosphatidylglycerol, phosphatidylinositol, phosphoaminoglycolipids, unidentified phospholipids and unidentified lipids. The major fatty acids were iso-C16:0, iso-C15:0 and C17:1ω8c. On the basis of our polyphasic taxonomy study, strain THG-a14T represents a novel species within the genus Phycicoccus, for which the name Phycicoccussoli sp. nov. is proposed. The type strain is THG-a14T ( = KACC 17892T = JCM 19837T).

  9. Tsukamurella soli sp. nov., isolated from soil.

    Science.gov (United States)

    Weon, Hang-Yeon; Yoo, Seung-Hee; Anandham, Rangasamy; Schumann, Peter; Kroppenstedt, Reiner M; Kwon, Soon-Wo; Stackebrandt, Erko

    2010-07-01

    A Gram-positive, rod-shaped, catalase-positive, oxidase-negative, white-coloured bacterium, designated strain JS18-1(T), was isolated from a soil sample collected from Halla mountain, Jeju island, Korea. 16S rRNA gene sequence analysis revealed that the strain was most closely related to members of the genus Tsukamurella with levels of sequence similarity of 95.4-96.5 %. Strain JS18-1(T) shared highest 16S rRNA gene sequence similarity with Tsukamurella strandjordii DSM 44573(T) (96.5 %), Tsukamurella carboxydivorans Y2(T) (96.4 %) and Tsukamurella tyrosinosolvens DSM 44234(T) (96.4 %). The G+C content of the total DNA of strain JS18-1(T) was 70 mol%. The cell-wall peptidoglycan type was A1gamma and mycolic acids were also detected. The predominant polar lipids were diphosphatidylglycerol, phosphatidylethanolamine and phosphatidylinositol. The major quinone was menaquinone-9 (MK-9) and major cell-wall sugars were arabinose, ribose and glucose. The major fatty acids (>10 % of the total fatty acids) were C(16 : 0), C(18 : 1)omega9c, C(18 : 0) 10-methyl and summed feature 3 (C(16 : 1)omega7c and/or iso-C(15 : 0) 2-OH). Phylogenetic analysis based on 16S rRNA gene sequences and chemotaxonomic, biochemical and physiological characteristics indicate that strain JS18-1(T) represents a novel species of the genus Tsukamurella, for which the name Tsukamurella soli sp. nov. is proposed. The type strain is JS18-1(T) (=KACC 20764(T)=DSM 45046(T)).

  10. Impact of serum SP-A and SP-D levels on comparison and prognosis of idiopathic pulmonary fibrosis

    Science.gov (United States)

    Wang, Kai; Ju, Qing; Cao, Jing; Tang, Wenze; Zhang, Jian

    2017-01-01

    Abstract Background and objective: Idiopathic pulmonary fibrosis (IPF) has a poor prognosis in general; however, it is heterogeneous to detect relative biomarkers for predicting the disease progression. Serum biomarkers can be conveniently collected to detect and help to differentially diagnose IPF and predict IPF prognosis. This meta-analysis aimed to evaluate the use of serum surfactant proteins A and D (SP-A and SP-D) for differential diagnosis and prognosis of IPF. Methods: Relevant articles were searched in PubMed, Embase, and Chinese National Knowledge Infrastructure databases and reviewed by 2 independent readers. Standard mean difference (SMD) and 95% confidence interval (CI) were calculated to assess the difference in serum levels of SP-A/D among patients with IPF, when compared to patients with non-IPF interstitial lung disease (ILD), pulmonary infection, and healthy control. Hazard ratio (HR) and 95% CI were used to compare the relative risk of mortality. Results: Twenty-one articles (totalling 1289 IPF patients) were included in final meta-analysis. Serum SP-A levels were significantly higher in patients with IPF than in patients with non-IPF ILD (SMD: 1.108 [0.584, 1.632], P infection (SMD: 1.320 [0.999, 1.640], P SMD: 2.802 [1.901, 3.702], P SMD: 0.459 [−0.000, 0.919], P = .050). Serum SP-D levels were significantly higher in patients with IPF than in patients with pulmonary infection (SMD: 1.308 [0.813, 1.803], P SMD: 2.235 [1.739, 2.731], P < .001). Risk of death in patients with IPF and elevated serum SP-A was increased 39% compared to patients with low SP-A groups. Elevated SP-D increased risk by 111% when compared to low SP-D. In acute exacerbation of IPF, serum SP-A/D were higher than those in stable stage. The comparisons and prognosis might be different in Asian and Caucasian patients. Conclusions: Serum SP-A/D detection might be useful for differential diagnosis and prediction of survival in patients with IPF. PMID:28591049

  11. Modular Stereoselective Synthesis of (1 -> 2)-C-Glycosides based on the sp(2)-sp(3) Suzuki-Miyaura Reaction

    Czech Academy of Sciences Publication Activity Database

    Oroszová, B.; Choutka, J.; Pohl, Radek; Parkan, K.

    2015-01-01

    Roč. 21, č. 19 (2015), s. 7043-7047 ISSN 0947-6539 Grant - others:GA ČR(CZ) GPP207/12/P713; GA ČR(CZ) GA15-17572S Institutional support: RVO:61388963 Keywords : C-disaccharides * C-glycosides * diastereoselectivity * Mitsunobu reaction * sp(2)-sp(3) coupling Subject RIV: CC - Organic Chemistry Impact factor: 5.771, year: 2015

  12. Impact of serum SP-A and SP-D levels on comparison and prognosis of idiopathic pulmonary fibrosis

    OpenAIRE

    Wang, Kai; Ju, Qing; Cao, Jing; Tang, Wenze; Zhang, Jian

    2017-01-01

    Abstract Background and objective: Idiopathic pulmonary fibrosis (IPF) has a poor prognosis in general; however, it is heterogeneous to detect relative biomarkers for predicting the disease progression. Serum biomarkers can be conveniently collected to detect and help to differentially diagnose IPF and predict IPF prognosis. This meta-analysis aimed to evaluate the use of serum surfactant proteins A and D (SP-A and SP-D) for differential diagnosis and prognosis of IPF. Methods: Relevant artic...

  13. Ion irradiation-induced, localized sp2 to sp3 hybridized carbon transformation in walls of multiwalled carbon nanotubes

    Science.gov (United States)

    Kumari, Reetu; Singh, Fouran; Yadav, Brajesh S.; Kotnala, Ravinder K.; Peta, Koteswara Rao; Tyagi, Pawan K.; Kumar, Sanjeev; Puri, Nitin K.

    2017-12-01

    In this report, ion irradiation-induced localized sp2 to sp3 hybridized carbon transformation in multiwalled carbon nanotubes (MWCNTs) was observed after irradiating MWCNTs with high-energy Au+8 ions (100 MeV). The used MWCNTs were grown using cobaltocene and benzene as catalyst and carbon source, respectively by the thermal CVD technique and consist of both unfilled and Co-filled tubes. Prior to irradiation, the MWCNT sample was characterized using scanning electron microscope and micro-Raman and photoluminescence spectrometers. The effect of ion fluence on MWCNT walls and transformation of sp2 to sp3 sites was analyzed by Raman spectroscopy, X-ray photoelectron spectroscopy, and high-resolution transmission electron microscopy. We found that as the fluence increased, the localized transformation from sp2 to sp3 sites occurred in the walls of MWCNTs, which was evident by the emergence of peak at approximately 1543 cm-1 associated with the G peak in tetrahedral amorphous carbon (ta-C) and the vanishing of 2D band (2700 cm-1). Furthermore, we observed broadening in D and G, with slight shift in their positions and consistent decrease in 2D band intensity, as fluence increased.

  14. Botanical pesticides effect from shells of bean’s cashew nut on biological agents of trichoderma sp. and gliocladium sp.

    Science.gov (United States)

    Bande, L. O. S.; Mariadi; Gusnawaty, HS; Nuriadi; Trisulpa, L.; Rahmania

    2018-02-01

    A shell of cashew nut (Anacardium occidentanle) has contained Cashew Nut Shell Liquid (CNSL) that is used as botanical pesticides. CNSL oil consists of active substance such as anacardat acid, cardol and cardanol. Utilization of the pesticides from shells of cashew nut to control pests and diseases of plants would be affected on biological agents. The objective of this research was to investigate pesticides inhibition on the increase of mycelium Trichoderma sp. and Gliocladium sp. by in vitro method. The tested concentration sample consisted of 0.0% (control), 2.5%, 7.5% and 10.0% in PDA media. The results of this research showed that 2.5% botanical pesticides concentration could minimize mycelium of Trichoderma sp. and Gliocladium sp. 22.73% and 21.04% respectively and also the increase shells of cashew extract could be affected the increase of mycelium inhibition. The extract with 2.5% concentration was the recommended concentration to control of fruit rot diseases and if concentration was 10.0% then its inhibition become 54.98% and 49.35%, respectively. The results proved that uncontrolled utilization of the pesticides could be affected on decrease of Trichoderma sp. and Gliocladium sp. growth.

  15. Characterization of Ethanolic Extract of Streptomyces sp. as a Pancreatic Lipase Inhibitors Produced by Endophytic Streptomyces sp. AEBg12

    Directory of Open Access Journals (Sweden)

    Lenni Fitri

    2017-07-01

    Full Text Available Endophytic Streptomyces sp. AEBg12 isolated from Zingiber cassumunar (Bangle is known to produce pancreatic lipase inhibitory compound. However, the characteristics of this active compound has not been reported yet. This study aimed to determine the characteristics of pancreatics inhibitory compound produced by Streptomyces sp. AEBg12 and to assess the role of endophytic actinobacteria in producing pancreatic lipase inhibitor using endophytic-free bangle tissue culture, wild bangle and compared with the activity of Streptomyces sp. AEBg12 endophytes. Supernatant of Streptomyces sp. AEBg12 was extracted using ethanol, ethyl acetate, and n-hexane solvents. Toxicity test was performed using larvae of shrimp Artemia salina. The results showed that the best solvent to obtain pancreatic lipase inhibitor compounds was ethanol. Phytochemical analysis showed that ethanolic extract of endophytic Streptomyces sp. AEBg12 contained flavonoids. IC50 value of ethanol extract was 180.83 µg/ml. The result of TLC showed that ethanolic extract of Streptomyces AEBg12 had a blue luminescence band indicated that there were either flavone, flavanones, flavonols or isoflavones. Inhibitory activity of Streptomyces sp. AEBg12 was higher than wild bangle and bangle tissue culture. The information from this study can be be used as a basic data for further characterization of the active compound, which might be developed as an antiobesity agent through its pancreatic lipase inhibitory activity.

  16. Using SP and SF to Lower Cement Content

    Directory of Open Access Journals (Sweden)

    Yassen A. Saleh

    2013-05-01

    Full Text Available In the present research, using different percents of superplasticizer (SP and silica fume (SF to improve the characteristics of concrete is performed. SP and SF are added to two types of  normal concrete, the first is of mixing ratio (1:2:4 and the second is of mixing ratio (1:1.5:3.28The results show that adding SF lead to increase compressive strength for first mix by about 45.3% and 47.7% while adding SP lead to increase the compressive strength by about 43% and 41%  compared to reference mix at 7 and 28 day respectively. The corresponding values for second mix are 46.7% , 49%, 44% and 43% respectively.The maximum compressive strength when SP and SF used together can be attained when the percents of SF and SP are 5% and 3% respectively. The increase in compressive strength is about 49.3% and 48.4%  for first mix, while the corresponding values for second mix are 52.4% and 51.2% as they compared to reference mix at 7 and 28 day respectively.For Tensile strength, adding SP lead to increase it by about 29.2% and 31.6% for first and second mix respectively, while the corresponding values when adding SF are 38.1% and 40.3%. The effect of using SP and SF together on increase tensile strength is more than the effect of using each one separately. The maximum tensile strength can be attained when the percents of SF and SP are 5% and 3% respectively as they increase the tensile strength by about 38.9% and 40.7% for first and second mix.The effect of using admixtures on cement content can be noted clearly as the maximum reduction percents are about 8.7% and 9.35% for first and second mix respectively when the percent of SP is 3%. The corresponding values are 9.4% and 11.26% when the percent of SF is 5%. Using SP and SF together at percents 3% and 5% respectively lead to reduce cement content by about 10.15% and 13.54% for first and second mix respectively.

  17. UJI POTENSI Gliocladium sp TERHADAP PERTUMBUHAN DAN PRODUKSI TANAMAN TOMAT

    Directory of Open Access Journals (Sweden)

    Lina Herlina

    2013-09-01

    Full Text Available AbstrakMikroorganisme tanah seperti Gliocladium sp dapat bertindak sebagai dekomposer dan juga sebagai agen pengendali hayati patogen tanaman hal ini memberikan harapan untuk mengurangi penggunaan pupuk dan fungisida sintetik. Tujuan penelitian untuk menguji potensi biofertililzer Gliocladium sp terhadap pertumbuhan dan produksi buah tomat. Variabel bebas yaitu bioferlizer Gliocladium sp  dengan dosis (g/tanaman 0,50, 100, 150, dan 200 .Variabel tergantung adalah pertumbuhan dan produksi tanaman tomat. Parameter pertumbuhan yang diukur adalah  tinggi tanaman, kandungan klorofil a dan b. Parameter hasil tanaman yang diukur adalah berat buah setelah panen. Hasil uji Anava satu jalan menunjukkan bahwa pemberian Gliocladium sp perpengaruh terhadap tinggi tanaman, kandungan klorofil a dan klorofil b, berat tomat  . Hasil uji lanjut Duncan menunjukkan bahwa dosis 100, g 150 g dan 200 g tidak berbeda signifikan terhadap tinggi tanaman, dosis 150g dan 200 g tidak berbedan nyata dalam pembentukan klorofil a dan klorofil b. Pemberian Gliocladium dosis 150g paling tinggi terhadap berat buah. Simpulan dalam penelitian ini bahwa pemberian Gliokompos sp berpengaruh terhadap pertumbuhan dan produksi buah tomat. AbstractSoil microorganisms such as Gliocladium sp. can play role in the decomposition and can also become the biological control of pathogenic plants. The animal is potentially reduce the use of fertilizers and synthetic fungidid. The aim of the study was to test the potential effect of biofertililzer Gliocladium sp. on the growth and production of tomatoes. The independent variables was biofertilizer Gliocladium sp. at various dosages (g/plant of 0, 50, 100, 150, dan 200. The dependent variables were the growth and the production of tomatoes. The growth parameter measured were plant height, as well as a and b chlorophyl contents.  The crop parameter was the fruit weight post-harvest.  A one-way anova showed that Gliocladium sp. affected the

  18. On the fourth Diadema species (Diadema-sp from Japan.

    Directory of Open Access Journals (Sweden)

    Seinen Chow

    Full Text Available Four long-spined sea urchin species in the genus Diadema are known to occur around the Japanese Archipelago. Three species (D. savignyi, D. setosum, and D. paucispinum are widely distributed in the Indo-Pacific Ocean. The fourth species was detected by DNA analysis among samples originally collected as D. savignyi or D. setosum in Japan and the Marshall Islands and tentatively designated as Diadema-sp, remaining an undescribed species. We analyzed nucleotide sequences of the cytochrome oxidase I (COI gene in the "D. savignyi-like" samples, and found all 17 individuals collected in the mainland of Japan (Sagami Bay and Kyushu to be Diadema-sp, but all nine in the Ryukyu Archipelago (Okinawa and Ishigaki Islands to be D. savignyi, with large nucleotide sequence difference between them (11.0%±1.7 SE. Diadema-sp and D. savignyi shared Y-shaped blue lines of iridophores along the interambulacrals, but individuals of Diadema-sp typically exhibited a conspicuous white streak at the fork of the Y-shaped blue iridophore lines, while this feature was absent in D. savignyi. Also, the central axis of the Y-shaped blue lines of iridophores was approximately twice as long as the V-component in D. savignyi whereas it was of similar length in Diadema-sp. Two parallel lines were observed to constitute the central axis of the Y-shaped blue lines in both species, but these were considerably narrower in Diadema-sp. Despite marked morphological and genetic differences, it appears that Diadema-sp has been mis-identified as D. savignyi for more than half a century.

  19. Development of Streptomyces sp. FR-008 as an emerging chassis

    Directory of Open Access Journals (Sweden)

    Qian Liu

    2016-09-01

    Full Text Available Microbial-derived natural products are important in both the pharmaceutical industry and academic research. As the metabolic potential of original producer especially Streptomyces is often limited by slow growth rate, complicated cultivation profile, and unfeasible genetic manipulation, so exploring a Streptomyces as a super industrial chassis is valuable and urgent. Streptomyces sp. FR-008 is a fast-growing microorganism and can also produce a considerable amount of macrolide candicidin via modular polyketide synthase. In this study, we evaluated Streptomyces sp. FR-008 as a potential industrial-production chassis. First, PacBio sequencing and transcriptome analyses indicated that the Streptomyces sp. FR-008 genome size is 7.26 Mb, which represents one of the smallest of currently sequenced Streptomyces genomes. In addition, we simplified the conjugation procedure without heat-shock and pre-germination treatments but with high conjugation efficiency, suggesting it is inherently capable of accepting heterologous DNA. In addition, a series of promoters selected from literatures was assessed based on GusA activity in Streptomyces sp. FR-008. Compared with the common used promoter ermE*-p, the strength of these promoters comprise a library with a constitutive range of 60–860%, thus providing the useful regulatory elements for future genetic engineering purpose. In order to minimum the genome, we also target deleted three endogenous polyketide synthase (PKS gene clusters to generate a mutant LQ3. LQ3 is thus an “updated” version of Streptomyces sp. FR-008, producing fewer secondary metabolites profiles than Streptomyces sp. FR-008. We believe this work could facilitate further development of Streptomyces sp. FR-008 for use in biotechnological applications.

  20. Actinophytocola timorensis sp. nov. and Actinophytocola corallina sp. nov., isolated from soil.

    Science.gov (United States)

    Otoguro, Misa; Yamamura, Hideki; Tamura, Tomohiko; Irzaldi, Rohmatussolihat; Ratnakomala, Shanti; Ridwan, Roni; Kartina, Gina; Triana, Evi; Nurkanto, Arif; Lestari, Yulin; Lisdiyanti, Puspita; Widyastuti, Yantyati; Ando, Katsuhiko

    2011-04-01

    Two actinomycete strains, ID05-A0653(T) and ID06-A0464(T), were isolated from soils of West Timor and Lombok island, respectively, in Indonesia. 16S rRNA gene sequence analysis clearly demonstrated that the isolates belonged to the family Pseudonocardiaceae and were closely related to the genus Actinophytocola. Strains ID05-A0653(T) and ID06-A0464(T) exhibited 98.1 and 98.2 % 16S rRNA gene sequence similarity, respectively, with Actinophytocola oryzae GMKU 367(T). The isolates grew well on ISP media and produced white aerial mycelium. Short spore chains were formed directly on the substrate mycelium. The isolates contained meso-diaminopimelic acid, arabinose and galactose as cell-wall components, MK-9(H(4)) as the sole isoprenoid quinone, iso-C(16 : 0) as the major cellular fatty acid and phosphatidylethanolamine as the diagnostic polar lipid. The DNA G+C contents of strains ID05-A0653(T) and ID06-A0464(T) were 69.7 and 71.2 mol%, respectively. On the basis of phenotypic characteristics, DNA-DNA relatedness and 16S rRNA gene sequence comparisons, strains ID05-A0653(T) and ID06-A0464(T) each represent a novel species of the genus Actinophytocola, for which the names Actinophytocola timorensis sp. nov. (type strain ID05-A0653(T)  = BTCC B-673(T)  = NBRC 105524(T)) and Actinophytocola corallina sp. nov. (type strain ID06-A0464(T)  = BTCC B-674(T)  = NBRC 105525(T)) are proposed.

  1. Two novel species of rapidly growing mycobacteria: Mycobacterium lehmannii sp. nov. and Mycobacterium neumannii sp. nov.

    Science.gov (United States)

    Nouioui, Imen; Sangal, Vartul; Carro, Lorena; Teramoto, Kanae; Jando, Marlen; Montero-Calasanz, Maria Del Carmen; Igual, José Mariano; Sutcliffe, Iain; Goodfellow, Michael; Klenk, Hans-Peter

    2017-12-01

    Two rapidly growing mycobacteria with identical 16S rRNA gene sequences were the subject of a polyphasic taxonomic study. The strains formed a well-supported subclade in the mycobacterial 16S rRNA gene tree and were most closely associated with the type strain of Mycobacterium novocastrense. Single and multilocus sequence analyses based on hsp65, rpoB and 16S rRNA gene sequences showed that strains SN 1900 T and SN 1904 T are phylogenetically distinct but share several chemotaxonomic and phenotypic features that are are consistent with their classification in the genus Mycobacterium. The two strains were distinguished by their different fatty acid and mycolic acid profiles, and by a combination of phenotypic features. The digital DNA-DNA hybridization (dDDH) and average nucleotide identity (ANI) values for strains SN 1900 T and SN 1904 T were 61.0 % and 94.7 %, respectively; in turn, the corresponding dDDH and ANI values with M. novocastrense DSM 44203 T were 41.4 % and 42.8 % and 89.3 % and 89.5 %, respectively. These results show that strains SN1900 T and SN 1904 T form new centres of taxonomic variation within the genus Mycobacterium. Consequently, strains SN 1900 T (40 T =CECT 8763 T =DSM 43219 T ) and SN 1904 T (2409 T =CECT 8766 T =DSM 43532 T ) are considered to represent novel species, for which the names Mycobacteriumlehmannii sp. nov. and Mycobacteriumneumannii sp. nov. are proposed. A strain designated as 'Mycobacteriumacapulsensis' was shown to be a bona fide member of the putative novel species, M. lehmannii.

  2. Mycobacterium sarraceniae sp. nov. and Mycobacterium helvum sp. nov., isolated from the pitcher plant Sarracenia purpurea.

    Science.gov (United States)

    Tran, Phuong M; Dahl, John L

    2016-11-01

    Several fast- to intermediate-growing, acid-fast, scotochromogenic bacteria were isolated from Sarracenia purpurea pitcher waters in Minnesota sphagnum peat bogs. Two strains (DL734T and DL739T) were among these isolates. On the basis of 16S rRNA gene sequences, the phylogenetic positions of both strains is in the genus Mycobacterium with no obvious relation to any characterized type strains of mycobacteria. Phenotypic characterization revealed that neither strain was similar to the type strains of known species of the genus Mycobacterium in the collective properties of growth, pigmentation or fatty acid composition. Strain DL734T grew at temperatures between 28 and 32 °C, was positive for 3-day arylsulfatase production, and was negative for Tween 80 hydrolysis, urease and nitrate reduction. Strain DL739T grew at temperatures between 28 and 37 °C, and was positive for Tween 80 hydrolysis, urea, nitrate reduction and 3-day arylsulfatase production. Both strains were catalase-negative while only DL739T grew with 5 % NaCl. Fatty acid methyl ester profiles were unique for each strain. DL739T showed an ability to survive at 8 °C with little to no cellular replication and is thus considered to be psychrotolerant. Therefore, strains DL734T and DL739T represent two novel species of the genus Mycobacterium with the proposed names Mycobacterium sarraceniae sp. nov. and Mycobacterium helvum sp. nov., respectively. The type strains are DL734T (=JCM 30395T=NCCB 100519T) and DL739T (=JCM 30396T=NCCB 100520T), respectively.

  3. Serratia myotis sp. nov. and Serratia vespertilionis sp. nov., isolated from bats hibernating in caves.

    Science.gov (United States)

    García-Fraile, P; Chudíčková, M; Benada, O; Pikula, J; Kolařík, M

    2015-01-01

    During the study of bacteria associated with bats affected by white-nose syndrome hibernating in caves in the Czech Republic, we isolated two facultatively anaerobic, Gram-stain-negative bacteria, designated strains 12(T) and 52(T). Strains 12(T) and 52(T) were motile, rod-like bacteria (0.5-0.6 µm in diameter; 1-1.3 µm long), with optimal growth at 20-35 °C and pH 6-8. On the basis of the almost complete sequence of their 16S rRNA genes they should be classified within the genus Serratia; the closest relatives to strains 12(T) and 52(T) were Serratia quinivorans DSM 4597(T) (99.5 % similarity in 16S rRNA gene sequences) and Serratia ficaria DSM 4569(T) (99.5% similarity in 16S rRNA gene sequences), respectively. DNA-DNA relatedness between strain 12(T) and S. quinivorans DSM 4597(T) was only 37.1% and between strain 52(T) and S. ficaria DSM 4569(T) was only 56.2%. Both values are far below the 70% threshold value for species delineation. In view of these data, we propose the inclusion of the two isolates in the genus Serratia as representatives of Serratia myotis sp. nov. (type strain 12(T) =CECT 8594(T) =DSM 28726(T)) and Serratia vespertilionis sp. nov. (type strain 52(T) =CECT 8595(T) =DSM 28727(T)). © 2015 IUMS.

  4. Loktanella agnita sp. nov. and Loktanella rosea sp. nov., from the north-west Pacific Ocean.

    Science.gov (United States)

    Ivanova, Elena P; Zhukova, Natalia V; Lysenko, Anatoly M; Gorshkova, Nataliya M; Sergeev, Alexander F; Mikhailov, Valery V; Bowman, John P

    2005-09-01

    One whitish and four pinkish strains of Gram-negative, non-motile, aerobic bacteria were isolated from sea-water and sediment samples collected in Chazhma Bay (Sea of Japan, Pacific Ocean). Analysis of 16S rRNA gene sequences revealed that these strains belonged to the 'Alphaproteobacteria', having highest sequence similarity of about 94-97% with species of the genus Loktanella. None of the strains degraded gelatin, casein, chitin, agar, DNA or starch and they had limited ability to utilize carbon sources. The four pinkish strains, Fg36(T), Fg1, Fg116 and Fg117, degraded Tween 80. Sea-water strain R10SW5(T) grew at 3-6% NaCl and a temperature range of 8-35 degrees C, whilst strains Fg36(T), Fg1, Fg116 and Fg117 grew at NaCl concentrations of 1-12% and a temperature range of 4-35 degrees C. Phosphatidylglycerol (58/79%), diphosphatidylglycerol (11/6%) and phosphatidylcholine (28/22%) were the major phospholipids. The predominant fatty acids were 16:0 (12.2/8.6%) and 18:1omega7 (76.6/68.4%). The DNA G+C content of strain R10SW5(T) was 59.1 mol% and those of the four pinkish strains ranged from 60.5 to 61.8 mol%. Based on the results of phenotypic, genotypic, chemotaxonomic and phylogenetic investigation, two novel species, Loktanella agnita sp. nov. and Loktanella rosea sp. nov., are proposed. The type strains are R10SW5(T) (=KMM 3788(T)=CIP 107883(T)) and Fg36(T) (=KMM 6003(T)=CIP 107851(T)=LMG 22534(T)), respectively.

  5. Vibrio variabilis sp. nov. and Vibrio maritimus sp. nov., isolated from Palythoa caribaeorum.

    Science.gov (United States)

    Chimetto, Luciane A; Cleenwerck, Ilse; Moreira, Ana Paula B; Brocchi, Marcelo; Willems, Anne; De Vos, Paul; Thompson, Fabiano L

    2011-12-01

    Two novel vibrio isolates (R-40492(T) and R-40493(T)) originating from the zoanthid Palythoa caribaeorum in Brazil in 2005 were taxonomically characterized by means of a polyphasic approach comprising multilocus sequence analysis (MLSA), DNA-DNA hybridization (DDH), ΔT(m) analysis and phenotypic characterization. Phylogenetic analysis based on 16S rRNA gene sequences showed that R-40492(T) and R-40493(T) fell within the genus Vibrio and were most closely related to each other with 99% similarity; similarities of these two novel isolates towards Vibrio neptunius LMG 20536(T), Vibrio coralliilyticus LMG 20984(T), Vibrio nigripulchritudo LMG 3896(T), Vibrio sinaloensis LMG 25238(T) and Vibrio brasiliensis LMG 20546(T) varied between 97.1 and 98.5%. DDH experiments showed that the two isolates had less than 15% relatedness to the phylogenetically most closely related Vibrio species. R-40492(T) and R-40493(T) had 55-57% relatedness to each other. The ΔT(m) between R-40492(T) and R-40493(T) was 6.12 °C. In addition, MLSA of concatenated sequences (16S rRNA, ftsZ, gyrB, recA, rpoA, topA, pyrH and mreB; 6035 bp in length) showed that the two novel isolates formed a separate branch with less than 92% concatenated gene sequence similarity towards known species of vibrios. Two novel species are proposed to accommodate these novel isolates, namely Vibrio variabilis sp. nov. (type strain, R-40492(T)=LMG 25438(T)=CAIM 1454(T)) and Vibrio maritimus sp. nov. (type strain, R-40493(T)=LMG 25439(T)=CAIM 1455(T)).

  6. Analysis of polyhydroxyalkanoates granuales in bacillus Sp. MFD11 and enterobacter Sp. SEL2

    International Nuclear Information System (INIS)

    Naheed, N.; Jamil, N.

    2016-01-01

    Bacillus sp. MFD11 (JF901809) and Enterobacter sp. SEL2 (JF901810) were isolated from agriculture waste contaminated sites. When fed with 2% glucose as a carbon source, these bacteria produced 75.26±0.45% and 76.61±0.28% PHA of their wet weight respectively. The accumulated PHA was extracted by direct addition of sodium dodysyl sulphate in the culture medium, which yielded 52.3±0.56 micro g/l and 136.21±0.45 micro g/l PHA respectively when assayed with Crotonic acid. The PHA detection medium (PDM) provided nutrient limitation condition which favored accumulation of PHA granules. A tremendous increase in cell size was observed when strain MFD11 was grown in PDM. The size of the granules as revealed by TEM micrographs spanned from 0.1 to 1.5 micro m which is quite large as compared to the size reported in the literature 0.2 to 0.5 micro m 18). (PHA polymer was analyzed by FTIR, GC/MS and proton Nuclear magnetic resonance. The intense absorption band in the spectrum at 1724-1740 cm -1 and 1215 cm -1 to 1280 corresponding to C=O and C-O stretching group, respectively, indicated that the both strains were PHA producers. GC/MS analysis indicated that the polymer produced were copolymers of PHB-co-PHV. NMR also suggested that the extracted PHA was not a homopolymer but was the blend of copolymers with 3HV in lower abundance. Differential calorimetric thermal analysis showed melting temperature of 163 and 169 degree C for PHA produced by both strains, respectively. However, the observed melting temperature was found to be lower than the standard PHB (Signa-aldrich). (author)

  7. Acidovorax lacteus sp. nov., isolated from a culture of a bloom-forming cyanobacterium (Microcystis sp.).

    Science.gov (United States)

    Chun, Seong-Jun; Cui, Yingshun; Ko, So-Ra; Lee, Hyung-Gwan; Srivastava, Ankita; Oh, Hee-Mock; Ahn, Chi-Yong

    2017-09-01

    A novel Gram-negative, rod-shaped and motile bacterial strain, designated strain M36 T , was isolated from a culture of a bloom-forming cyanobacterium, Microcystis sp., collected from a eutrophic lake in Korea. Its taxonomic position was investigated by using a polyphasic taxonomic approach. The isolate was found to grow aerobically at 15-42 °C (optimum 25 °C), pH 7.0-11.0 (optimum pH 8.0) and in the presence of 0-1.0% (w/v) NaCl (optimum 0% NaCl) on R2A medium. The phylogenetic analysis based on 16S rRNA gene sequences revealed that the strain M36 T is closely related to Acidovorax anthurii DSM 16745 T (98.1%), Acidovorax konjaci DSM 7481 T (97.7%) and Acidovorax avenae DSM 7227 T (97.0%) and also formed a clear phylogenetic lineage with other Acidovorax species. DNA-DNA relatedness between strain M36 T and the closely related species of the genus Acidovorax was <30%. The major fatty acid components identified included summed feature 3 (C 16:1 ω7c and/or C 16:1 ω6c), C 16:0 and summed feature 8 (C 18:0 ω7c and/or C 18:0 ω6c). The DNA G+C content of strain M36 T was determined to be 66.8 mol%. Based on above polyphasic evidence, strain M36 T is concluded to represent a new species of genus Acidovorax, for which the name Acidovorax lacteus sp. nov. is proposed. The type strain is M36 T (=KCTC 52220 T  = JCM 31890 T ).

  8. Description of Bacillus kexueae sp. nov. and Bacillus manusensis sp. nov., isolated from hydrothermal sediments.

    Science.gov (United States)

    Sun, Qing-Lei; Yu, Chao; Luan, Zhen-Dong; Lian, Chao; Hu, Yong-Hua; Sun, Li

    2018-03-01

    Two Gram-staining-positive, strictly aerobic bacilli, designated as strains Ma50-5 T and Ma50-6 T , were isolated from the hydrothermal sediments of Manus Basin in the western Pacific Ocean. Based on 16S rRNA gene sequence, strains Ma50-5 T and Ma50-6 T were most closely related to Bacillus alveayuensis (97.0 and 97.2 % identity, respectively). The 16S rRNA gene sequence identity between strains Ma50-5 T and Ma50-6 T was 97.4 %. The identities between strains Ma50-5 T and Ma50-6 T and other closely related organisms were below 97.0 %. The G+C contents of the genomic DNA of strains Ma50-5 T and Ma50-6 T were 43.4 and 47.6 mol%, respectively. The major fatty acids (>10 %) of both strains were iso-C15 : 0 and iso-C17 : 0. The predominant isoprenoid quinone detected in both strains was menaquinone-7. Phylogenetic, physiological, biochemical and morphological analyses suggested that strains Ma50-5 T and Ma50-6 T represent two novel species of the genus Bacillus, for which the names Bacillus kexueae sp. nov. (type strain Ma50-5 T =KCTC 33881 T =CCTCC AB 2017020 T ) and Bacillus manusensis sp. nov. (type strain Ma50-6 T =KCTC 33882 T =CCTCC AB 2017019 T ), respectively, are proposed.

  9. Rhodococcus cerastii sp. nov. and Rhodococcus trifolii sp. nov., two novel species isolated from leaf surfaces.

    Science.gov (United States)

    Kämpfer, P; Wellner, S; Lohse, K; Lodders, N; Martin, K

    2013-03-01

    Two Gram-positive, non-endospore-forming rods, strains C5(T) and T8(T), were isolated from the phyllospheres of Cerastium holosteoides and Trifolium repens, respectively, and were studied in detail for their taxonomic position. 16S rRNA gene sequence analysis allocated both isolates clearly to the genus Rhodococcus. Isolate C5(T) was most closely related to Rhodococcus fascians and Rhodococcus yunnanensis, showing 99.2 % gene sequence similarity to both species. Strain T8(T) revealed the highest 16S rRNA gene sequence similarity to Rhodococcus corynebacterioides (98.8 %) and Rhodococcus kroppenstedtii (98.6 %). The quinone system of both strains was composed of dihydrogenated menaquinones with eight (major amount) as well as nine, seven and six isoprenoid units (MK-8H2, MK-9H2 MK-7H2 MK-6H2).The polar lipid profiles of strains C5(T) and T8(T) consisted of diphosphatidylglycerol, phosphatidylethanolamine, phosphatidylglycerol, phosphatidylinositol, phosphatidylinositol mannoside and one unknown phospholipid. Additionally, strain C5(T) contained one unknown glycolipid, and strain T8(T) three unknown aminolipids. The fatty acid profiles contained major amounts of C16 : 0, C18 : 1ω9c and 10-methyl C18 : 0, which supported the grouping of the two isolates in the genus Rhodococcus. Physiological/biochemical characterization and DNA-DNA hybridizations with the type strains of the most closely related species allowed a clear phenotypic and genotypic differentiation of both strains. For this reason, we propose strain C5(T) ( = LMG 26203(T)  = CCM 7906(T)) as the type strain of a novel species with the name Rhodococcus cerastii sp. nov., and strain T8(T) ( = LMG 26204(T)  = CCM 7905(T)) as the type strain of a second novel species with the name Rhodococcus trifolii sp. nov.

  10. CULTIVO EXPERIMENTAL DEL CLADOCERO Moina sp ALIMENTADO CON Ankistrodesmus sp y Saccharomyces cereviseae

    Directory of Open Access Journals (Sweden)

    Martha Prieto

    2006-05-01

    Full Text Available Saccharomyces cereviseae. Materiales y métodos. Fueron realizados cultivos experimentales de la cepade cladóceros Moina sp en el laboratorio de Alimento Vivo de la Universidad de Córdoba, bajo condicionescontroladas de temperatura (22oC, pH (7.6, intensidad lumínica (2000 lux y aireación. Se emplearondos dietas de alimento como tratamiento (Ankistrodesmus y Ankistrodesmus mas Saccharomyces cereviseaeen concentración de 40 x 105 cel.ml-1 cada uno, para determinar su efecto sobre el desempeño de lapoblación. Diariamente se registró la densidad poblacional y celular. Resultados. Se obtuvieron diferenciassignificativas para el efecto de las dietas sobre el crecimiento poblacional de los cladóceros, los individuosalimentados con Ankistrodesmus sp + Saccharomyces cereviseae alcanzaron una densidad de 12.3a±0.30 org/ml-1 presentando mayor tasa instantánea de crecimiento (K 0.36 ± 0.002, el menor tiempode duplicación (td 1.94 ± 0.012 y el mayor rendimiento (r 1,1 ± 0.07 clad.ml-1.día-1. Conclusión. Loscladóceros por sus características de crecimiento en cultivo, presentan adaptación favorable a lascondiciones de manejo para la producción de biomasas potencialmente útiles como partícula nutritivacon fines acuícolas.

  11. Pseudomonas helleri sp. nov. and Pseudomonas weihenstephanensis sp. nov., isolated from raw cow's milk.

    Science.gov (United States)

    von Neubeck, M; Huptas, C; Glück, C; Krewinkel, M; Stoeckel, M; Stressler, T; Fischer, L; Hinrichs, J; Scherer, S; Wenning, M

    2016-03-01

    Analysis of the microbiota of raw cow's milk and semi-finished milk products yielded seven isolates assigned to the genus Pseudomonas that formed two individual groups in a phylogenetic analysis based on partial rpoD and 16S rRNA gene sequences. The two groups could be differentiated from each other and also from their closest relatives as well as from the type species Pseudomonas aeruginosa by phenotypic and chemotaxonomic characterization and average nucleotide identity (ANIb) values calculated from draft genome assemblies. ANIb values within the groups were higher than 97.3 %, whereas similarity values to the closest relatives were 85 % or less. The major cellular lipids of strains WS4917T and WS4993T were phosphatidylethanolamine, phosphatidylglycerol and diphosphatidylglycerol; the major quinone was Q-9 in both strains, with small amounts of Q-8 in strain WS4917T. The DNA G+C contents of strains WS4917T and WS4993T were 58.08 and 57.30 mol%, respectively. Based on these data, strains WS4917T, WS4995 ( = DSM 29141 = LMG 28434), WS4999, WS5001 and WS5002 should be considered as representatives of a novel species of the genus Pseudomonas, for which the name Pseudomonas helleri sp. nov. is proposed. The type strain of Pseudomonas helleri is strain WS4917T ( = DSM 29165T = LMG 28433T). Strains WS4993T and WS4994 ( = DSM 29140 = LMG 28438) should be recognized as representing a second novel species of the genus Pseudomonas, for which the name Pseudomonas weihenstephanensis sp. nov. is proposed. The type strain of Pseudomonas weihenstephanensis is strain WS4993T ( = DSM 29166T = LMG 28437T).

  12. Pseudomonas lactis sp. nov. and Pseudomonas paralactis sp. nov., isolated from bovine raw milk.

    Science.gov (United States)

    von Neubeck, Mario; Huptas, Christopher; Glück, Claudia; Krewinkel, Manuel; Stoeckel, Marina; Stressler, Timo; Fischer, Lutz; Hinrichs, Jörg; Scherer, Siegfried; Wenning, Mareike

    2017-06-01

    Five strains, designated WS 4672T, WS 4998, WS 4992T, WS 4997 and WS 5000, isolated from bovine raw milk formed two individual groups in a phylogenetic analysis. The most similar species on the basis of 16S rRNA gene sequences were Pseudomonas azotoformans IAM 1603T, Pseudomonas gessardii CIP 105469T and Pseudomonas libanensis CIP 105460T showing 99.7-99.6 % similarity. Using rpoD gene sequences Pseudomonas veronii LMG 17761T (93.3 %) was most closely related to strain WS 4672T and Pseudomonas libanensis CIP 105460T to strain WS 4992T (93.3 %). The five strains could be differentiated from their closest relatives and from each other by phenotypic and chemotaxonomic characterization and ANIb values calculated from draft genome assemblies. ANIb values of strains WS 4992T and WS4671T to the closest relatives are lower than 90 %. The major cellular polar lipids of both strains are phosphatidylethanolamine, phosphatidylglycerol, a phospholipid and diphosphatidylglycerol, and their major quinone is Q-9. The DNA G+C content of strains WS 4992T and WS 4672T were 60.0  and 59.7  mol%, respectively. Based on these genotypic and phenotypic traits two novel species of the genus Pseudomonas are proposed: Pseudomonas lactis sp. nov. [with type strain WS 4992T (=DSM 29167T=LMG 28435T) and the additional strains WS 4997 and WS 5000], and Pseudomonasparalactis sp. nov. [with type strain WS 4672T (=DSM 29164T=LMG 28439T) and additional strain WS 4998].

  13. CAPACIDAD ANTAGONISTA DE HONGOS CELULOLÍTICOS FRENTE A Fusarium sp. Y Macrophomina sp.

    Directory of Open Access Journals (Sweden)

    Néstor Leopoldo Tarazona Meza

    2014-12-01

    Full Text Available El objetivo de esta investigación fue evaluar la capacidad antagónica de ocho hongos celulolíticos nativos frente a los hongos fitopatógenos Fusarium sp. y Macrophomina sp. En primera instancia se determinó la cepa promisoria del hongo celulolítico, para lo cual, en caja Petri se colocó un disco de agar de 4 mm de diámetro con micelio de una cepa antagonista y en el extremo opuesto, a una distancia de cinco centímetros aproximadamente, otro disco de 4 mm con micelio de un patógeno. La capacidad antagónica se determinó por el grado de micoparasitismo y la competencia por nutrientes y espacios, registrando el porcentaje de inhibición del crecimiento radial. Con la cepa del hongo celulolítico que tuvo el mejor comportamiento antagonista se realizó un cocultivo independiente con cada patógeno, aquí se evalúo las UFC, crecidas en medio PDA. También se inoculó junto a las cepas fitopatógenas en plantas de pimiento para conocer el nivel de antagonismo en macetas. En la evaluación cualitativa, la cepa A.O-5 mostró una invasión y esporulación total en la superficie en ambos patógenos; mientras que en el cocultivo inhibe el crecimiento de los patógenos a las 96 h. Igualmente demostró su acción antagonista frente a Fusarium y Macrophomina en las plántulas de pimiento. Por lo encontrado, se estima que la cepa A.O-5 es un potencial agente antagonista de los fitopatógenos evaluados.

  14. Alistipes inops sp. nov. and Coprobacter secundus sp. nov., isolated from human faeces.

    Science.gov (United States)

    Shkoporov, Andrei N; Chaplin, Andrei V; Khokhlova, Ekaterina V; Shcherbakova, Victoria A; Motuzova, Oksana V; Bozhenko, Vladimir K; Kafarskaia, Lyudmila I; Efimov, Boris A

    2015-12-01

    Culture-based study of the faecal microbiome in two adult female subjects revealed the presence of two obligately anaerobic, non-spore-forming, rod-shaped, non-motile, Gram-negative bacterial strains that represent novel species. The first strain, designated 627T, was a fastidious, slow-growing, indole-positive bacterium with a non-fermentative type of metabolism.The strain was characterized by the production of acetic and succinic acids as metabolic end products, the prevalence of iso-C15 : 0 fatty acid and the presence of menaquinones MK-10 and MK-11. The DNA G+C content was found to be 56.6 mol%. The second strain, designated 177T, was capable of fermenting a rich collection of carbohydrate substrates, producing acetic acid as a terminal product. The strain was indole-negative and resistant to bile. The major cellular fatty acids were iso-C15 : 0 and anteiso-C15 : 0 (in a 1 : 1 ratio) and the predominant menaquinone was MK-11.The DNA G+C content was 37.8 mol%. A phylogenomic analysis of the draft genomes of strains 627T and 177T placed these bacteria in the genera Alistipes(family Rikenellaceae) and Coprobacter (family Porphyromonadaceae), respectively.On the basis of the phenotypic and genotypic properties of strains 627T and 177T, we conclude that these strains from human faeces represent two novel bacterial species, for which the names Alistipes inops sp. nov. (type strain 627T5DSM 28863T5VKM B-2859T) and Coprobacter secundus sp. nov. (type strain 177T=DSM 28864T=VKM B-2857T) are proposed.

  15. Methylobacterium haplocladii sp. nov. and Methylobacterium brachythecii sp. nov., isolated from bryophytes.

    Science.gov (United States)

    Tani, Akio; Sahin, Nurettin

    2013-09-01

    Pink-pigmented, facultatively methylotrophic bacteria, strains 87e(T) and 99b(T), were isolated from the bryophytes Haplocladium microphyllum and Brachythecium plumosum, respectively. The cells of both strains were Gram-reaction-negative, motile, non-spore-forming rods. On the basis of 16S rRNA gene sequence similarity, strains 87e(T) and 99b(T) were found to be related to Methylobacterium organophilum ATCC 27886(T) (97.1% and 97.7%, respectively). Strains 87e(T) and 99b(T) showed highest 16S rRNA gene similarity to Methylobacterium gnaphalii 23e(T) (98.3 and 99.0%, respectively). The phylogenetic similarities to all other species of the genus Methylobacterium with validly published names were less than 97%. Major cellular fatty acids of both strains were C(18:1)ω7c and C(18:0). The results of DNA-DNA hybridization, phylogenetic analyses based on 16S rRNA and cpn60 gene sequences, fatty acid profiles, whole-cell matrix-assisted, laser-desorption/ionization time-of-flight mass spectrometry (MALDI-TOF/MS) analysis, and physiological and biochemical tests allowed genotypic and phenotypic differentiation of strains 87e(T) and 99b(T) from their phylogenetically closest relatives. We propose that strains 87e(T) and 99b(T) represent novel species within the genus Methylobacterium, for which the names Methylobacterium haplocladii sp. nov. (type strain 87e(T) =DSM 24195(T) =NBRC 107714(T)) and Methylobacterium brachythecii sp. nov. (type strain 99b(T) =DSM 24105(T) =NBRC 107710(T)) are proposed.

  16. Occurrence of Pyemotes sp. on Tuta absoluta (Meyrick

    Directory of Open Access Journals (Sweden)

    Carlos Romero Ferreira de Oliveira

    2007-11-01

    Full Text Available The aim of this work was to study the population reduction of the tomato leafminer moth, Tuta absoluta (Meyrick, by Pyemotes sp. in the laboratory. The mite became greenish when fed on caterpillars, pupae, and adults of T. absoluta. The caterpillars and adults of T. absoluta were quickly paralyzed by the mite venom. A single T. absoluta could host many Pyemotes sp, physogastric females, which were allowed to grow on the moth. Pyemotes sp. can be a new alternative for the biological control of T. absoluta. However, this possibility must be better understood before it could be recommended, because Pyemotes sp. could also cause dermatitis in the humans.O ácaro Pyemotes sp. (Acari: Pyemotidae é um parasita de várias espécies de insetos e exibe o processo de fisogastria na reprodução. É registrada a ocorrência de Pyemotes sp. sobre a traça-do-tomateiro, Tuta absoluta (Meyrick, que sofreu redução considerável de suas populações em condições de laboratório. Este ácaro foi observado parasitando larvas, pupas e adultos de T. absoluta e suas fêmeas fisogástricas apresentaram coloração esverdeada. As larvas e adultos de T. absoluta atacados por Pyemotes sp. exibiram paralisia em poucos minutos, devido à injeção de toxinas por parte do ácaro. Observou-se que um único indivíduo de T. absoluta pode suportar muitas fêmeas fisogástricas de Pyemotes sp., permitindo que outra geração do ácaro continuasse a se reproduzir. O ácaro Pyemotes sp. surge como uma possibilidade para o controle biológico de T. absoluta, mas sua utilização deve ser melhor avaliada já que é uma espécie causadora de dermatites em humanos.

  17. Biodegradation of organophosphate pesticide quinalphos by Ochrobactrum sp. strain HZM.

    Science.gov (United States)

    Talwar, M P; Mulla, S I; Ninnekar, H Z

    2014-11-01

    Isolation and identification of bacteria capable of degrading organophosphate pesticide quinalphos and elucidation of its biodegradative pathway. A bacterium capable of degrading organophosphate pesticides was isolated from the pesticide-contaminated soil samples by selective enrichment on quinalphos (QP) as a sole source of carbon and energy. The bacterial strain was identified as Ochrobactrum sp. strain HZM on the basis of its morphological and biochemical characteristics and by phylogenetic analysis based on 16S rRNA gene sequences. The organism utilized various organophosphate pesticides such as quinalphos, profenofos, parathion-methyl and chlorpyrifos as growth substrates. Response surface methodology (RSM) showed optimum conditions for quinalphos degradation at pH 7 and 27°C. 2-Hydroxyquinoxaline and diethyl phosphate were identified as metabolites of quinalphos degradation by HPLC and GC-MS analysis. Cell-free extract of Ochrobactrum sp. strain HZM grown on quinalphos contained the quinalphos hydrolase activity. A bacterial strain capable of degrading quinalphos was isolated and identified as Ochrobactrum sp. strain HZM. The organism utilized organophosphate pesticides quinalphos, profenofos, parathion-methyl and chlorpyrifos as carbon sources. The organism degraded quinalphos by hydrolysis to yield 2-hydroxyquinoxaline and diethyl phosphate which were further utilized as carbon sources. The isolated bacterium Ochrobactrum sp. strain HZM was versatile in degrading various organophosphate pesticides. There was complete mineralization of quinalphos by Ochrobactrum sp. This strain could potentially be useful in the bioremediation of soil and water contaminated with toxic organophosphate pesticides. © 2014 The Society for Applied Microbiology.

  18. The SP Theory of Intelligence: Benefits and Applications

    Directory of Open Access Journals (Sweden)

    J. Gerard Wolff

    2013-12-01

    Full Text Available This article describes existing and expected benefits of the SP theory ofintelligence, and some potential applications. The theory aims to simplify and integrate ideasacross artificial intelligence, mainstream computing, and human perception and cognition,with information compression as a unifying theme. It combines conceptual simplicitywith descriptive and explanatory power across several areas of computing and cognition.In the SP machine—an expression of the SP theory which is currently realized in theform of a computer model—there is potential for an overall simplification of computingsystems, including software. The SP theory promises deeper insights and better solutions inseveral areas of application including, most notably, unsupervised learning, natural languageprocessing, autonomous robots, computer vision, intelligent databases, software engineering,information compression, medical diagnosis and big data. There is also potential inareas such as the semantic web, bioinformatics, structuring of documents, the detection ofcomputer viruses, data fusion, new kinds of computer, and the development of scientifictheories. The theory promises seamless integration of structures and functions within andbetween different areas of application. The potential value, worldwide, of these benefits andapplications is at least $190 billion each year. Further development would be facilitatedby the creation of a high-parallel, open-source version of the SP machine, available toresearchers everywhere.

  19. MANFAAT Indigofera Sp. DALAM BIDANG PERTANIAN DAN INDUSTRI

    Directory of Open Access Journals (Sweden)

    - Suharlina

    2014-06-01

    Full Text Available Indigofera    sp. is a leguminous plant which has varoius species, wide spread in tropical regions and adapted to a wide range of environmental condition. Indigofera sp. has many benefits in agricultural and industrial sector. It is widely used in agriculture as forage because its  high protein content, easily cultivated, high adaptability, and high biomass production (I. zollingeriana, I. hirsuta, I. pilosa, I. schimperi Syn,    I.    oblongifolia,    I.    spicata,    I. subulata Syn, and I. trita. Over the last 5 years Indigofera sp has been explored as forage feed for the goats. As cover crops, Indigofera is used to prevent erosion and nutrient leaching in the soil surface (I. hirsuta and I. Trita and it is also used as green manure, mulch, erosion control and ornamental plants (I. australis. In industrial sector, Indigofera sp. widely used as dyes and traditional medicine. Indigofera is used as a natural dye (I. tinctoria because it contains an excellent pigment called ‘indigo’ to dye silk material. Indigofera sp is also used as traditional medicine because it contains phytochemical substance which roles as antipyretic, laxative, diuretic, and useful against snakes attack, bees and insect bites. Using Indigofera    spp. as traditional medicine should be considered to avoid causing poisoning.

  20. Surfactant proteins SP-B and SP-C and their precursors in bronchoalveolar lavages from children with acute and chronic inflammatory airway disease

    Directory of Open Access Journals (Sweden)

    Winter Tobias

    2008-04-01

    Full Text Available Abstract Background The surfactant proteins B (SP-B and C (SP-C are important for the stability and function of the alveolar surfactant film. Their involvement and down-regulation in inflammatory processes has recently been proposed, but their level during neutrophilic human airway diseases are not yet known. Methods We used 1D-electrophoresis and Western blotting to determine the concentrations and molecular forms of SP-B and SP-C in bronchoalveolar lavage (BAL fluid of children with different inflammatory airway diseases. 21 children with cystic fibrosis, 15 with chronic bronchitis and 14 with pneumonia were included and compared to 14 healthy control children. Results SP-B was detected in BAL of all 64 patients, whereas SP-C was found in BAL of all but 3 children; those three BAL fluids had more than 80% neutrophils, and in two patients, who were re-lavaged later, SP-C was then present and the neutrophil count was lower. SP-B was mainly present as a dimer, SP-C as a monomer. For both qualitative and quantitative measures of SP-C and SP-B, no significant differences were observed between the four evaluated patient groups. Conclusion Concentration or molecular form of SP-B and SP-C is not altered in BAL of children with different acute and chronic inflammatory lung diseases. We conclude that there is no down-regulation of SP-B and SP-C at the protein level in inflammatory processes of neutrophilic airway disease.

  1. Surfactant proteins SP-B and SP-C and their precursors in bronchoalveolar lavages from children with acute and chronic inflammatory airway disease.

    Science.gov (United States)

    Tafel, Oliver; Latzin, Philipp; Paul, Karl; Winter, Tobias; Woischnik, Markus; Griese, Matthias

    2008-04-11

    The surfactant proteins B (SP-B) and C (SP-C) are important for the stability and function of the alveolar surfactant film. Their involvement and down-regulation in inflammatory processes has recently been proposed, but their level during neutrophilic human airway diseases are not yet known. We used 1D-electrophoresis and Western blotting to determine the concentrations and molecular forms of SP-B and SP-C in bronchoalveolar lavage (BAL) fluid of children with different inflammatory airway diseases. 21 children with cystic fibrosis, 15 with chronic bronchitis and 14 with pneumonia were included and compared to 14 healthy control children. SP-B was detected in BAL of all 64 patients, whereas SP-C was found in BAL of all but 3 children; those three BAL fluids had more than 80% neutrophils, and in two patients, who were re-lavaged later, SP-C was then present and the neutrophil count was lower. SP-B was mainly present as a dimer, SP-C as a monomer. For both qualitative and quantitative measures of SP-C and SP-B, no significant differences were observed between the four evaluated patient groups. Concentration or molecular form of SP-B and SP-C is not altered in BAL of children with different acute and chronic inflammatory lung diseases. We conclude that there is no down-regulation of SP-B and SP-C at the protein level in inflammatory processes of neutrophilic airway disease.

  2. Molecular prevalence of Bartonella, Babesia, and hemotropic Mycoplasma sp. in dogs with splenic disease.

    Science.gov (United States)

    Varanat, M; Maggi, R G; Linder, K E; Breitschwerdt, E B

    2011-01-01

    Among diseases that cause splenomegaly in dogs, lymphoid nodular hyperplasia (LNH), splenic hemangiosarcoma (HSA), and fibrohistiocytic nodules (FHN) are common diagnoses. The spleen plays an important role in the immunologic control or elimination of vector-transmitted, blood-borne pathogens, including Bartonella sp., Babesia sp., and hemotropic Mycoplasma sp. To compare the prevalence of Bartonella sp., Babesia sp., and hemotropic Mycoplasma sp. DNA in spleens from dogs with LNH, HSA, and FHN. Paraffin-embedded, surgically obtained biopsy tissues from LNH (N = 50), HSA (N = 50), and FHN (N = 37) were collected from the anatomic pathology archives. Spleens from specific pathogen-free (SPF) dogs (N = 8) were used as controls. Bartonella sp., Babesia sp., and Mycoplasma sp. DNA was amplified by PCR, followed by DNA sequencing. Bartonella sp. DNA was more prevalent in FHN (29.7%) and HSA (26%) as compared to LNH (10%) (P = .019, .0373, respectively) or control spleens (0.0%). The prevalence of Babesia sp. and hemotropic Mycoplasma sp. DNA was significantly lower than Bartonella sp. DNA in HSA (P = .0005, .006, respectively) and FHN (P = .003, .0004, respectively). There was no statistically significant difference in DNA prevalence among the 3 genera in the LNH group. The higher prevalence of Bartonella sp. in FHN and HSA warrants future investigations to determine if this bacterium plays a role in the development of these splenic diseases. Copyright © 2011 by the American College of Veterinary Internal Medicine.

  3. SP-R210 (Myo18A Isoforms as Intrinsic Modulators of Macrophage Priming and Activation.

    Directory of Open Access Journals (Sweden)

    Linlin Yang

    Full Text Available The surfactant protein (SP-A receptor SP-R210 has been shown to increase phagocytosis of SP-A-bound pathogens and to modulate cytokine secretion by immune cells. SP-A plays an important role in pulmonary immunity by enhancing opsonization and clearance of pathogens and by modulating macrophage inflammatory responses. Alternative splicing of the Myo18A gene results in two isoforms: SP-R210S and SP-R210L, with the latter predominantly expressed in alveolar macrophages. In this study we show that SP-A is required for optimal expression of SP-R210L on alveolar macrophages. Interestingly, pre-treatment with SP-A prepared by different methods either enhances or suppresses responsiveness to LPS, possibly due to differential co-isolation of SP-B or other proteins. We also report that dominant negative disruption of SP-R210L augments expression of receptors including SR-A, CD14, and CD36, and enhances macrophages' inflammatory response to TLR stimulation. Finally, because SP-A is known to modulate CD14, we used a variety of techniques to investigate how SP-R210 mediates the effect of SP-A on CD14. These studies revealed a novel physical association between SP-R210S, CD14, and SR-A leading to an enhanced response to LPS, and found that SP-R210L and SP-R210S regulate internalization of CD14 via distinct macropinocytosis-like mechanisms. Together, our findings support a model in which SP-R210 isoforms differentially regulate trafficking, expression, and activation of innate immune receptors on macrophages.

  4. Streptomyces sp. 173, an insecticidal micro-organism from marine.

    Science.gov (United States)

    Xiong, L; Li, J; Kong, F

    2004-01-01

    To find new insecticidal antibiotics from marine micro-organisms. Strains isolated from seawater and sea sediments from Beidiahe and Dagang of the east coast of China were screened for their insecticidal qualities. The screening was carried out using bioassay of brine shrimp and the insect pest Helicoverpa armigera. The fermentation, preliminary extraction and isolation of Streptomyces sp.173 were carried out. In total 331 isolates were examined through bioassay of brine shrimp and 40 isolates (12.08%) showed potential insecticidal activities. Of the 40 isolates, one isolate, designated Streptomyces sp.173, was found to have strong insecticidal activity against both brine shrimp and H. armigera, similar to that of avermectin B1. The isolated Streptomyces sp.173 has great insecticidal potency. This work indicated that marine micro-organisms could be an important source of insecticidal antibiotics and the improved anti-brine shrimp bioassay is suitable for primary screening.

  5. Micetoma pulmonar por Scedosporium sp, reporte de dos casos

    Directory of Open Access Journals (Sweden)

    José G. Somocurcio

    2009-07-01

    Full Text Available Se reporta los dos primeros casos de micetoma pulmonar por Scedosporium sp, en el Perú, tratados quirúrgicamente en el Hospital Nacional Hipólito Unanue. Se practicó resección pulmonar debido a micetoma pulmonar de donde se tomó muestras que fueron enviadas a microbiología y anatomía patológica para cultivo y estudio histopatológico. Se identificó el moho Scedosporium sp en dos pacientes con secuelas cavitarias por tuberculosis, quienes presentaron tos y hemoptisis de dos meses y tres años de evolución, respectivamente. Radiológicamente las cavidades estaban ocupadas por una "bola fúngica". La histopatología indicó presencia de abundantes hifas, indistinguibles de las de Aspergillus sp, mientras que la inmunodifusión para Aspergillus fue negativa.

  6. Vitreoscilla hemoglobin promotes Salecan production by Agrobacterium sp. ZX09.

    Science.gov (United States)

    Chen, Yun-mei; Xu, Hai-yang; Wang, Yang; Zhang, Jian-fa; Wang, Shi-ming

    2014-11-01

    Salecan is a novel exopolysaccharide produced by the strain Agrobacterium sp. ZX09, and it is composed of only glucose monomers. The unique chemical composition and excellent physicochemical properties make Salecan a promising material for applications in coagulation, lubrication, protection against acute liver injury, and alleviating constipation. In this study, we cloned the Vitreoscilla hemoglobin gene into a broad-host-range plasmid pCM158. Without antibiotic selection, there was negligible loss of the plasmid in the host Agrobacterium sp. ZX09 after one passage of cultivation. The expression of Vitreoscilla hemoglobin was demonstrated by carbon monoxide (CO) difference spectrum. The engineered strain Agrobacterium sp. ZX09 increased Salecan yield by 30%. The other physiological changes included its elevated respiration rate and cellular invertase activity.

  7. Symbiotic properties of Bradyrhizobium sp. (Lupinus assayed on serradella plants

    Directory of Open Access Journals (Sweden)

    Mieczysława Deryło

    2014-01-01

    Full Text Available Physiological and symbiotic properties of Bradyrhizobium sp. (Lupinus nodule isolates were compared to the standard slow-growing Bradyrhizobium sp. (Lupinus strain USDA 3045. Lupine nodules isolates showed typical characteristics for bradyrhizobial strains and nodulated small seed legume, serradella (Ornithopus sativus, in tube test. We observed a permanent physiological segregation of the effective (Fix' and ineffective (Fix- symbiotic phenotype for all tested bradyrhizobial strains during the growth of serradella in plant tube test. The ultrastructural differences between Fix* and Fix serradella nodules were observed. Rapid and visible nodulation as well as easy assay of the reduction of acetylene make serradella a convenient system for studies of Bradyrhizobium sp. (Lupinus strains in laboratory conditions.

  8. Ballastfritt spår : Förslag till dimensioneringsmetoder

    OpenAIRE

    Hagman, Olle; Berhane, Henok

    2015-01-01

    Ballastfria spår har på senare tid börjat byggas i allt större utsträckning. En anledning till detta är höjda krav på järnvägstransporter. Ett ballastfritt spår är ofta utformat som en långsträckt betongplatta på mark som för ned lasten från rälerna till underbyggnaden. I nuläget saknar Sverige dimensioneringsprinciper för ballastfria spår. Principerna är redan etablerade i andra länder men behöver inordnas för svenska förhållanden. År 2012 gjorde regeringen bedömningen att en ny stambana för...

  9. Microbial succession during thermophilic digestion: the potential of Methanosarcina sp.

    Directory of Open Access Journals (Sweden)

    Paul Illmer

    Full Text Available A distinct succession from a hydrolytic to a hydrogeno- and acetotrophic community was well documented by DGGE (denaturing gradient gel electrophoresis and dHPLC (denaturing high performance liquid chromatography, and confirmed by qPCR (quantitative PCR measurements and DNA sequence analyses. We could prove that Methanosarcina thermophila has been the most important key player during the investigated anaerobic digestion process. This organism was able to terminate a stagnation phase, most probable caused by a decreased pH and accumulated acetic acid following an initial hydrolytic stage. The lack in Methanosarcina sp. could not be compensated by high numbers of Methanothermobacter sp. or Methanoculleus sp., which were predominant during the initial or during the stagnation phase of the fermentation, respectively.

  10. Green Decision Making: Sustainable Transport and Systemic Planning (SP)

    DEFF Research Database (Denmark)

    Leleur, Steen

    interests as regards the outcome represented by different group members. The process is guided by a facilitator and is assisted by an analyst, with the analyst providing ongoing, interactive modelling. This collective (man/machine) learning aims to lead to a final decision (or decision recommendation) about......) and soft (qualitative) operations research (OR) methods; especially the latter have a function as regards knowledge generation that relates to obtaining systemic insights. Furthermore, SP applies a process that drives group-based learning forward. The group should be formed with the different stakeholder...... the best alternative or course of action for the actual strategic planning problem. The flexibility of SP makes it adaptable to different problem types. The paper is disposed as follows: After the Introduction about green decision making, Section 2 presents five SP-perspectives, where each perspective...

  11. Effectivity of the Earthworms Pheretima hupiensis, Eudrellus sp. and Lumbricus sp. on the Organic Matter Decomposition Process

    Directory of Open Access Journals (Sweden)

    Ea Kosman Anwar

    2009-05-01

    Full Text Available The earthworms are the one of soil fauna component in soil ecosystem have an important role in organic matter decomposition procces. The earthworm feed plant leaf and plant matter up to apart and dissolved. Earthworm metabolisms produce like faeces that mixed with decomposed organic matter mean vermicompost. The vermicompost fertility varies because of some kind of earthworm differ in “niche” and attitude. The experiment was to study the effectivity of earthworm on organic matter decomposition which has been conducted in Soil Biological and Healthy Laboratory and Green House of Soil Research Institute Bogor, during 2006 Budget Year. The three kind of earthworms i.e Pheretima hupiensis, Lumbricus sp. and Eudrellus sp. combined with three kind of organic matter sources i.e rice straw, trash and palm oil plant waste (compost heap. The result shows that the Lumbricus sp. are the most effective decomposer compared to Pheretima hupiensis and Eudrellus sp. and the organic matter decomposed by Lumbricus sp. as followed: market waste was decomposed of 100%, palm oil empty fruit bunch (compost heap 95.8 % and rice straw 84.9%, respectively. Earthworm effectively decreased Fe, Al, Mn, Cu dan Zn.

  12. A comprehensive survey of Aeromonas sp. and Vibrio sp. in seabirds from southeastern Brazil: outcomes for public health.

    Science.gov (United States)

    Cardoso, M D; Lemos, L S; Roges, E M; de Moura, J F; Tavares, D C; Matias, C A R; Rodrigues, D P; Siciliano, S

    2018-05-01

    To perform a microbiological survey regarding the presence, prevalence and characterization of Aeromonas sp. and Vibrio sp. in debilitated wrecked marine birds recovered from the centre-north coast of the state of Rio de Janeiro, Brazil. Swabs obtained from 116 alive and debilitated wrecked marine birds, comprising 19 species, from the study area were evaluated by biochemical methods. Antimicrobial susceptibility tests and pathogenicity gene screening were performed for bacterial strains of public health importance. Vibrio sp. and Aeromonas sp. were identified, as well as certain pathogenic genes and resistance to selected antimicrobials. This study demonstrates that the identified bacteria, mainly Vibrio sp., are fairly prevalent and widespread among several species of seabirds and highlights the importance of migratory birds in bacterial dispersion. In addition, it demonstrates the importance of the bacterial strains regarding their pathogenic potential. Therefore, seabirds can act as bacterial reservoirs, and their monitoring is of the utmost importance in a public health context. The study comprehensively evaluates the importance of seabirds as bacteria of public health importance reservoirs, since birds comprising several pathogenic bacterial species were evaluated. © 2018 The Society for Applied Microbiology.

  13. sp sup 2 and sp sup 3 bonding configurations in low nitrogen content a-CN sub x thin films

    CERN Document Server

    Mezzasalma, A M; Neri, F; Trusso, S

    2003-01-01

    The results of an electron spectroscopy study carried out on a set of pulsed laser deposited CN sub x films are reported. A progressive degree of graphitization, deduced from the continuous increase in the sp sup 2 bond fraction, has been found for x values up to 25%. The mass density values, deduced by a proper treating of both the x-ray photoelectron spectroscopy and reflection electron energy loss spectroscopy data, are consistent with a material made up by two phases, namely a sp sup 2 threefold (graphite-like) and a sp sup 3 fourfold (diamond-like) coordinated one. The behaviour of the density of the samples as a function of the N content does not show any abrupt change in going from lower to higher nitrogen concentrations as found by other authors, this certainly being due to differences in the starting sp sup 3 /sp sup 2 ratio of the films at zero N concentration and to their different preparation parameters.

  14. Ozone Technology for Pathogenic Bacteria of Shrimp (Vibrio sp.) Disinfection

    Science.gov (United States)

    Wulansarie, Ria; Dyah Pita Rengga, Wara; Rustamadji

    2018-03-01

    One of important marine commodities in Indonesia, shrimps are susceptible with Vibrio sp bacteria infection. That infection must be cleared. One of the technologies for disinfecting Vibrio sp. is ozone technology. In this research, Vibrio sp. is a pathogenic bacterium which infects Penaeus vannamei. Ozone technology is applied for threatening Vibrio sp. In this research, ozonation was performed in different pH. Those are neutral, acid (pH=4), and base (pH=9). The sample was water from shrimp embankment from Balai Besar Perikanan Budidaya Air Payau (BBPBAP) located in Jepara. That water was the habitat of Penaeus vannamei shrimp. The brand of ozonator used in this research was “AQUATIC”. The used ozonator in this research had 0,0325 g/hour concentration. The flow rate of sample used in this research was 2 L/minute. The ozonation process was performed in continuous system. A tank, pipe, pump, which was connected with microfilter, flowmeter and ozone generator were the main tools in this research. It used flowmeter and valve to set the flow rate scalable as desired. The first step was the insert of 5 L sample into the receptacle. Then, by using a pump, a sample supplied to the microfilter to be filtered and passed into the flow meter. The flow rate was set to 2 LPM. Furthermore, gas from ozonator passed to the flow for the disinfection of bacteria and then was recycled to the tank and the process run continuously. Samples of the results of ozonation were taken periodically from time 0, 3, 7, 12, 18, 24 to 30 minutes. The samples of the research were analyzed using Total Plate Count (TPC) test in BBPBAP Jepara to determine the number of Vibrio sp. bacteria. The result of this research was the optimal condition for pathogenic bacteria of shrimp (Vibrio sp.) ozonation was in neutral condition.

  15. Multimeric and trimeric subunit SP-D are interconvertible structures with distinct ligand interaction

    DEFF Research Database (Denmark)

    Sørensen, Grith Lykke; Hoegh, Silje V; Leth-Larsen, Rikke

    2009-01-01

    -D compared to Met11 SP-D. Multimerization has proven important for enhancement of microbial phagocytosis. In the present study defined multimeric forms of Met11Thr SP-D were isolated from human amniotic fluid. Implementation of ManNAc-affinity chromatography allowed high recovery of natural trimeric SP......-D multimers. Trimeric SP-D subunits also showed greater binding to endogenous lipoproteins: LDL, oxLDL, and HDL, than multimeric SP-D. In conclusion, purified trimeric and multimeric SP-D represent separate and only partly interconvertible molecular populations with distinct biochemical properties....

  16. Azospirillum sp. strain B510 enhances rice growth and yield.

    Science.gov (United States)

    Isawa, Tsuyoshi; Yasuda, Michiko; Awazaki, Hirotoshi; Minamisawa, Kiwamu; Shinozaki, Satoshi; Nakashita, Hideo

    2010-01-01

    Inoculation experiments with the endophytic bacterium Azospirillum sp. strain B510, an isolate from surface-sterilized stems of field-grown rice, were conducted in pots in a greenhouse, and in paddy fields in Hokkaido, Japan. B510 significantly enhanced the growth of newly generated leaves and shoot biomass under greenhouse conditions. When rice seedlings were treated with 1×10(8) CFU ml(-1), then transplanted to paddy fields, tiller numbers and seed yield significantly increased. Azospirillum sp. strain B510 is a promising bacterial inoculant for plant growth promotion and agricultural practices.

  17. Profil des examens radiographiques spéciaux conventionnels dans ...

    African Journals Online (AJOL)

    But : Montrer l'apport des examens spéciaux dans la démarche diagnostique Méthodologie : Il s'agit d'une étude rétrospective qui a porté sur les résultats de 249 examens spéciaux colligés dans le service de radiologie du CHU- Tokoin de Lomé du 1er mars 2003 au 1er mars 2004. Résultats : L'âge de nos patients varie ...

  18. Induced adaptation of Bacillus sp. to antimicrobial nanosilver.

    Science.gov (United States)

    Gunawan, Cindy; Teoh, Wey Yang; Marquis, Christopher P; Amal, Rose

    2013-11-11

    The natural ability of Bacillus sp. to adapt to nanosilver cytotoxicity upon prolonged exposure is reported for the first time. The combined adaptive effects of nanosilver resistance and enhanced growth are induced under various intensities of nanosilver-stimulated cellular oxidative stress, ranging from only minimal cellular redox imbalance to the lethal levels of cellular ROS stimulation. An important implication of the present work is that such adaptive effects lead to the ultimate domination of nanosilver-resistant Bacillus sp. in the microbiota, to which nanosilver cytotoxicity is continuously applied. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. PRODUCCIÓN DE BIOFERTILIZANTES UTILIZANDO Pseudomonas sp.

    OpenAIRE

    Santillana-Villanueva, Nery; Universidad Nacional Agraria La Molina (Perú).

    2006-01-01

    Con el objetivo de producir biofertilizantes utilizando 3 cepas de Pseudomonas sp., se realizaron tres experimentos: el primero, para encontrar un medio de cultivo apropiado para la multiplicación de las bacterias; el segundo, para determinar la sobrevivencia de las cepas de Pseudomonas sp en los biofertilizantes y el tercero para determinar la dosis eficiente de aplicación del biofertilizante en frijol, maíz, papa y tomate, en condiciones de invernadero. Al evaluar los resultados, se determi...

  20. Sistema de gerencia de pavimentos do DER/SP

    OpenAIRE

    Luiz Antonio da Silva

    2008-01-01

    Resumo: Este trabalho versa sobre métodos de levantamento de defeitos e avaliação das condições estruturais, funcionais e de segurança dos pavimentos asfálticos nas estradas estaduais sob a jurisdição do Departamento de Estradas de Rodagem do Estado de São Paulo - DER/SP. Aborda também alguns aspectos administrativos da Autarquia Estadual, aonde atuo como engenheiro de carreira na área de planejamento e de projeto. O DER/SP tem como missão administrar o sistema rodoviário estadual, sua integr...

  1. SP-100 advanced radiator designs for thermoelectric and Stirling applications

    International Nuclear Information System (INIS)

    Moriarty, M.P.; Determan, W.R.

    1989-01-01

    The authors advanced radiator designs employing carbon-carbon liquid metal heat pipe technology which can significantly reduce the mass of the heat rejection subsystem for high temperature space technology systems such as the SP-100. This technology is being developed to address the need for lightweight heat transfer components and structures for space applications. Heat pipe and subsystem designs were optimized for thermoelectric and Stirling engine bases SP-100 system designs. A multiple, deployed petal radiator concept was selected for the heat rejection subsystem design based upon minimum mass. Radiator stowage in the Space Transportation System cargo bay and deployment schemes were investigated for each of these optimized designs

  2. Mycelium characterization of the Amauroderma sp collected from Royal Belum

    International Nuclear Information System (INIS)

    Hassan Hamdani Mutaat; Mat Rasol Awang; Fauzi Daud; Rosnani Rashid; Meswan Maskom; Arfah Sumeri

    2010-01-01

    Etnobotanical study carried on the native community in the Royal Belum Forest areas had identified many potentially valuable spices that could be further explored for its medicinal and health purposes. The mushrooms, Amauroderma sp. was one of the resources that had been screened and collected for further investigation. In this works, the mycelium characterization of the mushroom was carried out in order to develop suitable seed or spawn for cultivation. The Amauroderma sp. mycelium, cultured from the fruit body tissue was found to grow well on the PDA plate. While on the potato extract liquid medium the mushroom could grow and produce stalk like fruit body. (author)

  3. A comparative study on phyllosphere nitrogen fixation by newly isolated Corynebacterium sp. & Flavobacterium sp. and their potentialities as biofertilizer.

    Science.gov (United States)

    Giri, S; Pati, B R

    2004-01-01

    A number of nitrogen fixing bacteria has been isolated from forest phyllosphere on the basis of nitrogenase activity. Among them two best isolates are selected and identified as Corynebacterium sp. AN1 & Flavobacterium sp. TK2 able to reduce 88 and 132 n mol of acetylene (10(8)cells(-1)h(-1)) respectively. They were grown in large amount and sprayed on the phyllosphere of maize plants as a substitute for nitrogenous fertilizer. Marked improvements in growth and total nitrogen content of the plant have been observed by the application of these nitrogen-fixing bacteria. An average 30-37% increase in yield was obtained, which is nearer to chemical fertilizer treatment. Comparatively better effect was obtained by application of Flavobacterium sp.

  4. Halobacillus dabanensis sp. nov. and Halobacillus aidingensis sp. nov., isolated from salt lakes in Xinjiang, China.

    Science.gov (United States)

    Liu, W Y; Zeng, J; Wang, L; Dou, Y T; Yang, S S

    2005-09-01

    Two moderately halophilic spore-forming bacteria were isolated from salt lakes in the Xinjiang region of China. The two strains, designated AD-6(T) and D-8(T), were aerobic, Gram-positive, rod-shaped and motile by means of peritrichous flagella. Strains AD-6(T) and D-8(T) grew in the presence of 0.5-20% and 0.5-25% (w/v) NaCl in complex medium, respectively. Their cell-wall peptidoglycan was of the L-Orn-D-Asp type. The major menaquinone found in both strains was menaquinone-7 (MK-7). The fatty acid profile contained a large amount of branched fatty acids; the main fatty acids were anteiso-C(15:0), anteiso-C(17:0), iso-C(15:0) and iso-C(16:0). The DNA G+C content of strains D-8(T) and AD-6(T) was 41.4 and 42.2 mol%, respectively. Phylogenetic analysis based on 16S rRNA gene sequences revealed that strains D-8(T) and AD-6(T) were located in the genus Halobacillus. Levels of 16S rRNA gene sequence similarity between the isolated strains and the type strains of Halobacillus species were in the range 96.2-99.5%. DNA-DNA relatedness values of 17.0-52.2% were found between the two strains and other Halobacillus species. The DNA-DNA relatedness value between D-8(T) and AD-6(T) was 50.6%. On the basis of phenotypic and chemotaxonomic properties, phylogenetic analysis and genomic distinctiveness, strains D-8(T) and AD-6(T) should be placed in the genus Halobacillus as two novel species, for which the names Halobacillus dabanensis sp. nov. (type strain=JCM 12772(T)=CGMCC 1.3704(T)) and Halobacillus aidingensis sp. nov. (type strain=JCM 12771(T)=CGMCC 1.3703(T)) are proposed, respectively.

  5. Lysobacter fragariae sp. nov. and Lysobacter rhizosphaerae sp. nov. isolated from rhizosphere of strawberry plant.

    Science.gov (United States)

    Singh, Hina; Du, Juan; Ngo, Hien T T; Won, KyungHwa; Yang, Jung-Eun; Kim, Ki-Young; Yi, Tae-Hoo

    2015-06-01

    Two bacterial strains, designated THG-DN8.7(T) and THG-DN8.3(T), were isolated from the rhizosphere of a strawberry plant in Gyeryong Mountain, South Korea. Cells of both isolates were observed to be Gram-negative, yellow-coloured and rod-shaped. Comparative 16S rRNA gene sequence analysis showed that strain THG-DN8.7(T) had highest sequence similarities to Lysobacter yangpyeongensis KACC 11407(T) (97.2 %), Lysobacter niabensis KACC 11587(T) (97.0 %) and Lysobacter oryzae KCTC 22249(T) (96.9 %), while strain THG-DN8.3(T) had closely similarity with L. niabensis KACC 11587(T) (98.1 %), L. oryzae KCTC 22249(T) (97.1 %) and L. yangpyeongensis KACC 11407(T) (96.1 %). DNA-DNA relatedness values between strains THG-DN8.7(T) and THG-DN8.3(T) and their closest phylogenetically neighbours were below 30.0 %, which indicates that strains THG-DN8.7(T) and THG-DN8.3(T) represent distinct species within the genus Lysobacter. Both strains were found to contain iso-C15:0, iso-C16:0 and iso-C17:1 ω9c as predominant fatty acids and ubiquinone-8 as major isoprenoid quinone. The major polar lipids were identified as phosphatidylethanolamine, phosphatidyl-N-methylethanolamine, phosphatidylglycerol and diphosphatidylglycerol. The DNA G+C content of strains THG-DN8.7(T) and THG-DN8.3(T) were determined to be 66.9 and 67.8 mol%, respectively. These data are consistent with the affiliation of the two new species represented by THG-DN8.7(T) and THG-DN8.3(T) to the genus Lysobacter. The names Lysobacter fragariae sp. nov. and Lysobacter rhizosphaerae sp. nov. are proposed for these species with the type strains THG-DN8.7(T) (=KCTC 42236(T) = JCM 30322(T)) and THG-DN8.3(T) (=KCTC 42237(T) = JCM 30321(T)), respectively.

  6. Lactobacillus silagincola sp. nov. and Lactobacillus pentosiphilus sp. nov., isolated from silage.

    Science.gov (United States)

    Tohno, Masanori; Tanizawa, Yasuhiro; Irisawa, Tomohiro; Masuda, Takaharu; Sakamoto, Mitsuo; Arita, Masanori; Ohkuma, Moriya; Kobayashi, Hisami

    2017-09-01

    Three Gram-stain positive, non-motile, non-spore-forming, catalase-negative and rod-shaped bacterial strains (IWT5T, IWT25T and IWT140), isolated from silage, were investigated by using a polyphasic taxonomic approach. Strains IWT5T and IWT25T grew at 10-37 °C and 30-37 °C, and at pH 4.0-7.5 and 4.0-7.0, respectively. The G+C contents of genomic DNA of strains IWT5T and IWT25T were 43.2 and 44.4 mol%, respectively. Strains IWT5T and IWT25T contained C16 : 0, C18 : 1 ω9c and summed feature 7 (unknown 18.846/C19 : 1 ω6c/C19 : 0cyclo ω10c) as the major fatty acids. Strain IWT5T was most closely related to the type strains of Lactobacillus mixtipabuli (99.9 % 16S rRNA gene sequence similarity) and Lactobacillus silagei (99.5 %). For IWT25T, the 16S rRNA gene sequence similarities with the closely related neighbour type strains L. mixtipabuli and L. silagei were 99.5 and 99.5 %, respectively. The 16S rRNA gene sequence similarities among the three novel isolates were 99.5-99.9 %. The average nucleotide identities of strains IWT5T and IWT25T to other neighbours of the genus Lactobacillus were less than 82 % and the genomes of IWT25T and IWT140 shared 97.3 % average nucleotide identity, demonstrating that the three strains were allocated to two different novel species of the genus Lactobacillus. Together with multilocus sequence analysis, phenotypic and chemotaxonomic characteristics, strains IWT5T (=JCM 31144T=DSM 102973T) and IWT25T (=JCM 31145T=DSM 102974T) are proposed as the type strains of novel species of the genus Lactobacillus, with the names Lactobacillus silagincola sp. nov. and Lactobacillus pentosiphilus sp. nov., respectively.

  7. Growth performance and proximate composition of mixed cultures of marine microalgae (Nannochloropsis sp. & Tetraselmis sp. with monocultures

    Directory of Open Access Journals (Sweden)

    Wasana Arkronrat

    2016-02-01

    Full Text Available The growth performance and proximate composition of two marine microalgae, Nannochloropsis sp. and Tetraselmis sp., in monoculture and mixed culture of both species under laboratory conditions were compared. Microalgae were cultured in enriched seawater (28 ppt in 8 L plastic bottles using Conway medium. Microalgae were grown in a temperature-controlled room (25°C under continuous illumination at a light intensity of about 3,000 Lux for 240 hours (10 days. Results showed that maximum cell density and growth rate of both species (45.06±2.67×105 cells ml-1 and 0.43±0.02 day-1, reps. in mixed culture had a significantly higher than Tetraselmis sp. (5.09±0.99×105 cells ml-1 and 0.16±0.03 day-1, reps., but not significantly different with Nannochloropsis sp. (29.25±22.70×105 cells ml-1 and 0.37±0.14 day-1, reps. in monoculture. For proximate composition, protein content of both species in mixed culture and Nannochloropsis sp. in monoculture was significantly higher than for Tetraselmis sp. in monoculture after 120 and 240 hours of cultivation. Carbohydrate and lipid contents of each treatment were found to be significantly different after 120 hours of cultivation but not significantly different after 240 hours of cultivation. Therefore, this study indicates that an alternative option for commercial microalgal production is to use a mixed culture to obtain higher production.

  8. Fusarium euwallaceae sp. nov.--a symbiotic fungus of Euwallacea sp., an invasive ambrosia beetle in Israel and California.

    Science.gov (United States)

    Freeman, S; Sharon, M; Maymon, M; Mendel, Z; Protasov, A; Aoki, T; Eskalen, A; O'Donnell, K

    2013-01-01

    The invasive Asian ambrosia beetle Euwallacea sp. (Coleoptera, Scolytinae, Xyleborini) and a novel Fusarium sp. that it farms in its galleries as a source of nutrition causes serious damage to more than 20 species of live trees and pose a serious threat to avocado production (Persea americana) in Israel and California. Adult female beetles are equipped with mandibular mycangia in which its fungal symbiont is transported within and from the natal galleries. Damage caused to the xylem is associated with disease symptoms that include sugar or gum exudates, dieback, wilt and ultimately host tree mortality. In 2012 the beetle was recorded on more than 200 and 20 different urban landscape species in southern California and Israel respectively. Euwallacea sp. and its symbiont are closely related to the tea shot-hole borer (E. fornicatus) and its obligate symbiont, F. ambrosium occurring in Sri Lanka and India. To distinguish these beetles, hereafter the unnamed xyleborine in Israel and California will be referred to as Euwallacea sp. IS/CA. Both fusaria exhibit distinctive ecologies and produce clavate macroconidia, which we think might represent an adaption to the species-specific beetle partner. Both fusaria comprise a genealogically exclusive lineage within Clade 3 of the Fusarium solani species complex (FSSC) that can be differentiated with arbitrarily primed PCR. Currently these fusaria can be distinguished only phenotypically by the abundant production of blue to brownish macroconidia in the symbiont of Euwallacea sp. IS/CA and their rarity or absence in F. ambrosium. We speculate that obligate symbiosis of Euwallacea and Fusarium, might have driven ecological speciation in these mutualists. Thus, the purpose of this paper is to describe and illustrate the novel, economically destructive avocado pathogen as Fusarium euwallaceae sp. nov. S. Freeman et al.

  9. PROTOZOÁRIOS GASTRINTESTINAIS EM BUGIOS (Alouatta sp. MANTIDOS EM CATIVEIRO GASTROINTESTINAL PROTOZOA IN CAPTIVE HOWLER MONKEYS (Alouatta sp.

    Directory of Open Access Journals (Sweden)

    Adriano Bonfim Carregaro

    2009-07-01

    Full Text Available Este estudo avaliou o parasitismo gastrintestinal por protozoários em bugios (Alouatta sp. mantidos em cativeiro no município de Santa Maria, RS. Foram analisadas amostras de fezes de oito macacos das espécies Alouatta caraya e Alouatta guariba, pelo método de centrífugo-flutuação com sulfato de zinco. Observaram-se oocistos de Cryptosporidium spp. nas fezes de todos os animais pesquisados, sendo que em três deles havia infecção mista com cistos de Giardia spp. Analisando a água oferecida aos primatas detectou-se a presença elevada de oocistos de Cryptosporidium sp. e raros oocistos de outro coccidio. Conclui-se que os macacos A. caraya e A. guariba, mantidos em cativeiro, são hospedeiros dos gêneros Giardia e Cryptosporidium.

    PALAVRAS-CHAVES: Alouatta sp., bugio, Cryptosporidium spp., Giardia spp.

    This study evaluated the gastrointestinal parasitism by protozoa in captive howler monkeys (Alouatta sp. in the city of Santa Maria, RS. Fecal samples from eight monkeys of the Alouatta caraya and Alouatta guariba species were analyzed by the zinc sulfate centrifugal flotation method. Cryptosporidium spp. oocysts were observed in the feces of all the studied animals, three of which having mixed infection with Giardia spp. cysts. Analyzing the water offered to the primates it was detected elevated presence of Cryptosporidium sp. oocysts and rare oocysts of other coccidium. In conclusion, A. caraya and A. guariba monkeys, kept in captivity, are hosts for Giardia and Cryptosporidium genus.

    KEY WORDS:  Alouatta sp., Cryptosporidium spp., Giardia spp., howler monkey.

  10. [Study on the Visualization of the Biomass of Chlorella sp., Isochrysis galbana, and Spirulina sp. Based on Hyperspectral Imaging Technique].

    Science.gov (United States)

    Jiang, Lu-lu; Wet, Xuan; Zhao, Yan-ru; Shao, Yong-ni; Qiu, Zheng-jun; He, Yong

    2016-03-01

    Effective cultivation of the microalgae is the key issue for microalgal bio-energy utilization. In nutrient rich culture conditions, the microalge have a fast growth rate, but they are more susceptible to environmental pollution and influence. So to monitor the the growth process of microalgae is significant during cultivating. Hyperspectral imaging has the advantages of both spectra and image analysis. The spectra contain abundant material quality signal and the image contains abundant spatial information of the material about the chemical distribution. It can achieve the rapid information acquisition and access a large amount of data. In this paper, the authors collected the hyperspectral images of forty-five samples of Chlorella sp., Isochrysis galbana, and Spirulina sp., respectively. The average spectra of the region of interest (ROI) were extracted. After applying successive projection algorithm (SPA), the authors established the multiple linear regression (MLR) model with the spectra and corresponding biomass of 30 samples, 15 samples were used as the prediction set. For Chlorella sp., Isochrysis galbana, and Spirulina sp., the correlation coefficient of prediction (r(pre)) are 0.950, 0.969 and 0.961, the root mean square error of prediction (RMSEP) for 0.010 2, 0.010 7 and 0.007 1, respectively. Finally, the authors used the MLR model to predict biomass for each pixel in the images of prediction set; images displayed in different colors for visualization based on pseudo-color images with the help of a Matlab program. The results show that using hyperspectral imaging technique to predict the biomass of Chlorella sp. and Spirulina sp. were better, but for the Isochrysis galbana visualization needs to be further improved. This research set the basis for rapidly detecting the growth of microalgae and using the microalgae as the bio-energy.

  11. Low SP1 expression differentially affects intestinal-type compared with diffuse-type gastric adenocarcinoma.

    Directory of Open Access Journals (Sweden)

    Hun Seok Lee

    Full Text Available Specificity protein 1 (SP1 is an essential transcription factor that regulates multiple cancer-related genes. Because aberrant expression of SP1 is related to cancer development and progression, we focused on SP1 expression in gastric carcinoma and its correlation with disease outcomes. Although patient survival decreased as SP1 expression increased (P<0.05 in diffuse-type gastric cancer, the lack of SP1 expression in intestinal-type gastric cancer was significantly correlated with poor survival (P<0.05. The knockdown of SP1 in a high SP1-expressing intestinal-type gastric cell line, MKN28, increased migration and invasion but decreased proliferation. Microarray data in SP1 siRNA-transfected MKN28 revealed that the genes inhibiting migration were downregulated, whereas the genes negatively facilitating proliferation were increased. However, both migration and invasion were decreased by forced SP1 expression in a low SP1-expressing intestinal-type gastric cell line, AGS. Unlike the intestinal-type, in a high SP1-expressing diffuse-type gastric cell line, SNU484, migration and invasion were decreased by SP1 siRNA. In contrast to previous studies that did not identify differences between the 2 histological types, our results reveal that low expression of SP1 is involved in cancer progression and metastasis and differentially affects intestinal-type compared with diffuse-type gastric adenocarcinoma.

  12. Re-examination of the genus Acetobacter, with descriptions of Acetobacter cerevisiae sp. nov. and Acetobacter malorum sp. nov.

    Science.gov (United States)

    Cleenwerck, I; Vandemeulebroecke, K; Janssens, D; Swings, J

    2002-09-01

    Thirty-four Acetobacter strains, representing Acetobacter aceti, Acetobacter pasteurianus, Acetobacter pomorum, Acetobacter peroxydans, Acetobacter lovaniensis, Acetobacter estunensis, Acetobacter orleanensis, Acetobacter indonesiensis and Acetobacter tropicalis, were subjected to a polyphasic study that included DNA-DNA hybridizations, DNA base ratio determinations, 16S rDNA sequence analysis and phenotypic characterization. Two novel species are proposed, Acetobacter cerevisiae sp. nov. and Acetobacter malorum sp. nov. The type strains of these species are respectively LMG 1625T (= DSM 14362T = NCIB 8894T = ATCC 23765T) and LMG 1746T (= DSM 14337T).

  13. Helicotylenchus oleae n. sp. and H. neopaxilli n. sp. (Hoplolaimidae), Two New Spiral Nematodes Parasitic on Olive Trees in Italy.

    Science.gov (United States)

    Inserra, R N; Vovlas, N; Golden, A M

    1979-01-01

    Helicotylenchus oleae n. sp. and H. neopaxilli n. sp., from olive roots and soil in Italy, are described and illustrated. Helicotylenchus oleae can be distinguished from the related species H. canadensis and H. tunisiensis especially by the smaller styler, its distinctive tail shape, and a tail longer than one anal body width. Helicotylenchus neopaxilli differs from the close species H. paxilli by having a conical, anteriorly truncated labial region, shorter stylet, and phasmids always anterior to level of anus. Also illustrated and discussed are histopathological changes within feeder roots of olive caused by the feeding activity of the semi-endoparasitic H. oleae.

  14. Ocorrência de Babesia sp em pequenos roedores no Brasil Occurrence of Babesia sp in small rodents in Brazil

    OpenAIRE

    G.S. Gazeta; R.W. Carvalho; R.F. Avelar; M. Amorim; A.E. Aboud-Dutra

    2004-01-01

    Foi analisada a ocorrência de babesiose em pequenos roedores nos municípios de Silva Jardim e Nova lguaçu, Estado do Rio de Janeiro. Foram capturados 44 roedores de seis espécies diferentes e entre eles a prevalência da infecção foi de 27,3%. Rattus norvegicus foi considerado o principal reservatório (50,0%) e Oligoryzomys nigripes como novo hospedeiro para Babesia sp. Este foi o primeiro relato de Babesia sp. em roedores no Brasil. A freqüência de roedores positivos e o risco de infecção dos...

  15. Rhizobium calliandrae sp. nov., Rhizobium mayense sp. nov. and Rhizobium jaguaris sp. nov., rhizobial species nodulating the medicinal legume Calliandra grandiflora.

    Science.gov (United States)

    Rincón-Rosales, Reiner; Villalobos-Escobedo, José M; Rogel, Marco A; Martinez, Julio; Ormeño-Orrillo, Ernesto; Martínez-Romero, Esperanza

    2013-09-01

    Calliandra grandiflora has been used as a medicinal plant for thousands of years in Mexico. Rhizobial strains were obtained from root nodules of C. grandiflora collected from different geographical regions in Chiapas and characterized by BOX-PCR, amplified rDNA restriction analysis (ARDRA) and 16S rRNA gene sequence analysis. Most isolates corresponded to members of the genus Rhizobium and those not related to species with validly published names were further characterized by recA, atpD, rpoB and nifH gene phylogenies, phenotypic and DNA-DNA hybridization analyses. Three novel related species of the genus Rhizobium within the 'Rhizobium tropici group' share the same symbiovar that may be named sv. calliandrae. The names proposed for the three novel species are Rhizobium calliandrae sp. nov. (type strain, CCGE524(T) =ATCC BAA-2435(T) =CIP 110456(T) =LBP2-1(T)), Rhizobium mayense sp. nov. (type strain, CCGE526(T) =ATCC BAA-2446(T) = CIP 110454(T) =NSJP1-1(T)) and Rhizobium jaguaris sp. nov. (type strain, CCGE525(T) =ATCC BAA-2445(T) =CIP 110453(T) =SJP1-2(T)).

  16. Elevation of three subspecies of Lonsdalea quercina to species level: Lonsdalea britannica sp. nov., Lonsdalea iberica sp. nov. and Lonsdalea populi sp. nov.

    Science.gov (United States)

    Li, Yong; Xue, Han; Guo, Li-Min; Koltay, András; Palacio-Bielsa, Ana; Chang, Jupu; Xie, Shoujiang; Yang, Xuqi

    2017-11-01

    Four subspecies of Lonsdalea quercina (L. quercina subsp. quercina, L. quercina subsp. britannica, L. quercina subsp. iberica and L. quercina subsp. populi) were studied by genome sequence-derived average nucleotide identity (ANI), phylogenetic analysis based on 16S rRNA gene sequences, multilocus sequence analysis (MLSA) and phenotypic characteristics. In phylogenetic trees, based on 16S rRNA gene sequences, and in MLSA data, the four subspecies were divided into four subclusters in the Lonsdalea clade with high boot strap support. The ANI values between the four subspecies were 88.71-93.38 %, respectively, lower than the proposed species boundary ANI cut-off (95-96 %) that is considered the most important criterion to reclassify these subspecies at the species level. It is proposed that three subspecies be elevated to the species level as Lonsdalea britannica sp. nov. (type strain R-43280 T =LMG 26267 T =NCPPB 4481 T =CFCC 10822 T ), Lonsdalea iberica sp. nov. (type strain R-44166 T =LMG 26264 T =NCPPB 4490 T =CFCC 10824 T ) and Lonsdalea populi sp. nov. (type strain NY060 T =DSM 25466 T =NCAIM B 02483 T =LMG 27349 T =CFCC 13125 T ).

  17. Halomonas saccharevitans sp. nov., Halomonas arcis sp. nov. and Halomonas subterranea sp. nov., halophilic bacteria isolated from hypersaline environments of China.

    Science.gov (United States)

    Xu, Xue-Wei; Wu, Yue-Hong; Zhou, Zhen; Wang, Chun-Sheng; Zhou, Yu-Guang; Zhang, Hui-Bin; Wang, Yong; Wu, Min

    2007-07-01

    Three strains of Gram-negative, aerobic, neutrophilic and halophilic bacteria were isolated from samples of a salt lake on the Qinghai-Tibet Plateau and a subterranean saline well in the Si-Chuan Basin of China. These isolates, designated AJ275(T), AJ282(T) and ZG16(T), were investigated using a polyphasic approach. Based on 16S rRNA gene sequence analysis, the isolates could be affiliated to the genus Halomonas. Genomic DNA G+C contents were 65.9 mol% for AJ275(T), 56.7 mol% for AJ282(T) and 57.6 mol% for ZG16(T). The results of DNA-DNA hybridizations, fatty acid analysis and physiological and biochemical tests allowed the isolates to be differentiated genotypically and phenotypically from closely related species. It is proposed that strains AJ275(T) (=CGMCC 1.6493(T)=JCM 14606(T)=LMG 23976(T)), AJ282(T) (=CGMCC 1.6494(T)=JCM 14607(T)=LMG 23978(T)) and ZG16(T) (=CGMCC 1.6495(T)=JCM 14608(T)=LMG 23977(T)) represent the type strains of three novel species in the genus Halomonas: Halomonas saccharevitans sp. nov., Halomonas arcis sp. nov. and Halomonas subterranea sp. nov., respectively.

  18. Synthetic surfactant based on analogues of SP-B and SP-C is superior to single-peptide surfactants in ventilated premature rabbits.

    Science.gov (United States)

    Almlén, Andreas; Walther, Frans J; Waring, Alan J; Robertson, Bengt; Johansson, Jan; Curstedt, Tore

    2010-06-01

    Respiratory distress syndrome (RDS) is currently treated with surfactant preparations obtained from natural sources and attempts to develop equally active synthetic surfactants have been unsuccessful. One difference in composition is that naturally derived surfactants contain the two hydrophobic proteins SP-B and SP-C while synthetic preparations contain analogues of either SP-B or SP-C. It was recently shown that both SP-B and SP-C (or SP-C33, an SP-C analogue) are necessary to establish alveolar stability at end-expiration in a rabbit RDS model, as reflected by high lung gas volumes without application of positive end-expiratory pressure. To study the efficacy of fully synthetic surfactants containing analogues of both SP-B and SP-C compared to surfactants with only one protein analogue. Premature newborn rabbits, treated with synthetic surfactants, were ventilated for 30 min without positive end-expiratory pressure. Tidal volumes as well as lung gas volumes at end-expiration were determined. Treatment with 2% Mini-B (a short-cut version of SP-B) and 2% SP-C33, or its C-terminally truncated form SP-C30, in 1,2-dipalmitoyl-sn-glycero-3-phosphocholine/1-palmitoyl-2-oleoyl-sn-glycero-3-phosphoglycerol, 68:31 (w/w) resulted in median lung gas volumes of 8-9 ml/kg body weight, while animals treated with 2% Mini-B surfactant or 2% SP-C33/SP-C30 surfactant had lung gas volumes of 3-4 ml/kg, and those treated with Curosurf, a porcine surfactant, 15-17 ml/kg. In contrast, mixing SP-C33 with peptides with different distributions of positively charged and hydrophobic residues did not improve lung gas volumes. The data indicate that synthetic surfactants containing analogues of both SP-B and SP-C might be superior to single-peptide surfactants in the treatment of RDS.

  19. Cytosporones O, P and Q from an endophytic Cytospora sp

    DEFF Research Database (Denmark)

    Abreu, L.M.; Phipps, Richard Kerry; Pfenning, L.H.

    2010-01-01

    Cytosporones O, P and Q, together with the known compounds cytosporones B, C, D, E and dothiorelones A, 13, C. and H were isolated from the ascomycete fungus Cytospora sp. during a chemotaxonomic study Of fungal endophytes belonging to the related genera Cytospora and Phomopsis from Brazil...

  20. Effects of oxygen concentration on the growth of Nannochloropsis sp.

    NARCIS (Netherlands)

    Raso, S.

    2013-01-01

    ANannochloropsissp. is a promising microalgal resource for production of food, feed and bio-based commodities, as it can grow relatively fast and combines high lipid content with high content of poly-unsaturated fatty acids. High productivity with constant product quality can be

  1. Genome sequencing and annotation of Cellulomonas sp. HZM

    OpenAIRE

    Chua, Patric; Har, Zi Mei; Austin, Christopher M.; Yule, Catherine M.; Dykes, Gary A.; Lee, Sui Mae

    2015-01-01

    We report the draft genome sequence of Cellulomonas sp. HZM, isolated from a tropical peat swamp forest. The draft genome size is 3,559,280 bp with a G + C content of 73% and contains 3 rRNA sequences (single copies of 5S, 16S and 23S rRNA).

  2. Genome sequencing and annotation of Cellulomonas sp. HZM.

    Science.gov (United States)

    Chua, Patric; Har, Zi Mei; Austin, Christopher M; Yule, Catherine M; Dykes, Gary A; Lee, Sui Mae

    2015-09-01

    We report the draft genome sequence of Cellulomonas sp. HZM, isolated from a tropical peat swamp forest. The draft genome size is 3,559,280 bp with a G + C content of 73% and contains 3 rRNA sequences (single copies of 5S, 16S and 23S rRNA).

  3. Genome sequencing and annotation of Cellulomonas sp. HZM

    Directory of Open Access Journals (Sweden)

    Patric Chua

    2015-09-01

    Full Text Available We report the draft genome sequence of Cellulomonas sp. HZM, isolated from a tropical peat swamp forest. The draft genome size is 3,559,280 bp with a G + C content of 73% and contains 3 rRNA sequences (single copies of 5S, 16S and 23S rRNA.

  4. Report of the first human case of Caulobacter sp. infection

    DEFF Research Database (Denmark)

    Justesen, Ulrik S; Holt, Hanne M; Thiesson, Helle

    2007-01-01

    A Caulobacter sp. isolate was recovered from the dialysis fluid of a patient undergoing peritoneal dialysis. Bacterial identification included electron microscopy and 16S rDNA sequencing. To our knowledge, this is the first report of human Caulobacter infection. Special growth requirements sugges...

  5. Cellulase production by Trichoderma sp . on apple pomace under ...

    African Journals Online (AJOL)

    The feasibility of using apple pomace for cellulase production by Trichoderma sp. under solid state fermentation was evaluated in this study. Our results indicated that initial moisture level of the medium, incubation temperature and inoculum size influenced the cellulase production greatly. The optimum initial moisture level ...

  6. ERRATUM Electron field emission from sp -induced insulating to ...

    Indian Academy of Sciences (India)

    Administrator

    Electron field emission from sp. 2. -induced insulating to metallic behaviour of amorphous carbon (a-C) films. Pitamber Mahanandia, P N Viswakarma, Prasad Vishnu Bhotla, S V Subramanyam and Karuna Kar Nanda. 2010 Bull. Mater. Sci. 33 pp 215–220. The MS received date should be read as “MS received 20 October ...

  7. Characterization of Fusarium oxysporum F. sp. elaeidis (Fofse ...

    African Journals Online (AJOL)

    Characterization of Fusarium oxysporum F. sp. elaeidis (Fofse) causal agent of vascular wilt disease of oil palm. SMA Tagoe, PNL Lamptey, KA Oduro. Abstract. No Abstract. Ghana Journal of Agricultural Science No. 1, 2005: 181-185. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD ...

  8. Beta-Glucan Synthase Gene Expression in Pleurotus sp

    International Nuclear Information System (INIS)

    Azhar Mohamad; Nie, H.J.

    2016-01-01

    Pleurotus sp. is a popular edible mushroom, containing various functional component, in particular, Beta-glucan. Beta-glucans is a part of glucan family of polysaccharides and supposedly contribute to medicinal and nutritional value of Pleurotus.sp. In order to understand the distribution of Beta-glucan in Pleurotus.sp, the Beta-glucan synthase gene expression was determined and compared in different part of Pleurotus, namely mycelium, stripe and cap. The Pleurotus.sp RNA was extracted using commercial kit, employing Tissuelyser ll (Qiagen, USA) to disrupt the cell walls. Then the RNA was quantified by Nano drop (Thermo Fisher, USA) and visualized using denaturing agarose gel. RNA with good OD 260.280 reading (∼2.0) was chosen and converted to cDNA. Using Laccase synthase gene as home keeping gene, Beta-glucan synthase gene expression was quantified using CFX 96 Real Time PCR detection system (Biorad, USA). Preliminary result shows that Beta-glucan synthase was relatively expressed the most in stripe, followed by mycelium and barely in cap. (author)

  9. Enhancement of clavulanic acid production by Streptomyces sp MU ...

    African Journals Online (AJOL)

    Purpose: To enhance clavulanic acid production using UV-mutagenesis on Streptomyces sp. NRC77. Methods: UV-mutagenesis was used .... Maxima® Hot Start PCR Master Mix (2X) in a. 50μL reaction mixture as follows: activation of ..... Planning toward the application of large scale production of CA in a bioreactor by the ...

  10. Degradation of morpholine by Mycobacterium sp. isolated from ...

    African Journals Online (AJOL)

    The biodegradation of morpholine has attracted much interest because morpholine causes environmental pollution. Ten species belonging to nine genera were tested for their abilities to degrade morpholine in mineral salts medium containing morpholine (1 g/l). Mycobacterium sp. isolated from polluted water sample ...

  11. Acanthamoeba Sp. S-11 phagocytotic activity on Mycobacterium ...

    African Journals Online (AJOL)

    Background: Mycobacterium leprae (M. leprae) is a pathogenic bacterium that causes leprosy. The presence of M. leprae in the environment is supported by microorganisms that act as the new host for M. leprae. Acanthamoeba's potential to be a host of M. leprae in the environment. Acanthamoeba sp. is Free Living ...

  12. Phellinus artemisiae sp. nov. (Basidiomycota, Hymenochaetaceae), from western USA

    Czech Academy of Sciences Publication Activity Database

    Vlasák, Josef; Vlasák, J.

    2017-01-01

    Roč. 303, č. 1 (2017), s. 93-96 ISSN 1179-3155 Institutional support: RVO:60077344 Keywords : chaparral Fungi * Phellinus artemisiae sp. nov. * molecular taxonomy * Fungi Subject RIV: EF - Botanics OBOR OECD: Plant sciences, botany Impact factor: 1.240, year: 2016

  13. Papposphaera heldalii sp nov (Haptophyta, Papposphaeraceae) from Svalbard

    DEFF Research Database (Denmark)

    Thomsen, Helge Abildhauge; Egge, Jorun Karin

    2016-01-01

    In an attempt to establish a taxonomy for the polar contingent of lightly calcified coccolithophores, we are currently dealing with species of Papposphaera. Here we describe a new species, Papposphaera heldalii sp. nov., based on material from Svalbard. The species is unique in terms of calyx...

  14. Characteristics of DMSP-lyase in Phaeocystis sp (Prymnesiophyceae)

    NARCIS (Netherlands)

    Stefels, J.; Dijkhuizen, L.

    The marine phytoplankton species Phaeocystis sp, is one of the few microalgae known to be able to convert dimethylsulfoniopropionate (DMSP) enzymatically into dimethyl sulfide (DMS) and acrylic acid. The function of this enzymatic process for the organism is not known. From experiments with crude

  15. THE SAGA OF A MALE FERTILITY PROTEIN (SP22)

    Science.gov (United States)

    Toxicologic studies designed to identify chemical-induced alterations in the structure and function of the epididymis, particularly the acquisition of fertility by proximal cauda epididymal sperm, have lead to the discovery of a novel sperm protein (SP22) that is well correlated ...

  16. Isozyme-based genetic fingerprinting of Manihot sp

    African Journals Online (AJOL)

    Prof. Ogunji

    1973-06-22

    Jun 22, 1973 ... Isozyme-based genetic fingerprinting of Manihot sp. Efisue, A. A.. Development of Crop & Soil Science, University of Port Harcourt P.M.B. 5323 Choba, Port Harcourt,. Rivers State, Nigeria. (Received 29:10:13, Accepted 20:12:13). Abstract. Many cassava varieties have been released into farmers' fields in ...

  17. Aspects of the biology of Platorchestia fayetta sp. nov. (Crustacea ...

    African Journals Online (AJOL)

    Amphipods form an important component of coastal fauna and this study is focused on the biology of semi-terres- trial Platorchestia fayetta sp. nov. inhabiting sand and wave-cast algae on the north-eastern coast at Poste La Fayette, Mauritius. The population structure, size class variation, sex ratio and female reproductive ...

  18. Formation water resistivity (R w )determination: The SP method ...

    African Journals Online (AJOL)

    uncontaminated by drilling mud) that saturates the porous formation. It is also referred to as connate water or interstitial water. Its resistivity can be determined by a number of methods, one of which is by the SP curve discussed in this work. Analysis of ...

  19. Tannin Acyl Hydrolase Production by Citrobacter sp. isolated from ...

    African Journals Online (AJOL)

    Bacterial isolate, Citrobacter sp., from tannery effluent loaded sites has proved as a potent producer of tannase. Production of tannase was compared in solid-state and submerged fermentation using tamarind seed as sole carbon source. Two times increase in tannase activity was seen in solid-state fermentation (90 U) than ...

  20. Optimization of cholesterol oxidase production by Brevibacterium sp ...

    African Journals Online (AJOL)

    An ultrasound-assisted emulsification as a pretreatment for cholesterol oxidase production by submerge fermentation using Brevibacterium sp. in a batch system was studied. Medium improvement for the production employing response surface methodology (RSM) was optimized in this paper. The concentration of ...

  1. Molecular characterization of Fusarium oxysporum f. sp. ciceri ...

    African Journals Online (AJOL)

    Thirty isolates of Fusarium oxysporum f. sp. ciceri were isolated from rhizosphere soil of chickpea from different locations in Northern India. The amount of genetic variation was evaluated by polymerase chain reaction (PCR) amplification with a set of 40 RAPD primers and 2 IGS primers. Less than 10% of the amplified ...

  2. The astaxanthin dideoxyglycoside biosynthesis pathway in Sphingomonas sp. PB304

    DEFF Research Database (Denmark)

    Kim, Se Hyeuk; Kim, Jin Ho; Lee, Bun Yeol

    2014-01-01

    libraries using degenerate probes that harbor highly conserved sequences from the Sphigomonas elodea-derived crtI and Nostoc sp. PCC 7120-dervied crtW genes. Selected positive gene clusters were fully sequenced and annotated, revealing genes encoding six putative carotenogenic enzymes: phytoene synthase...

  3. Biochemical characterization of Fusarium oxysporum f. sp. cubense ...

    African Journals Online (AJOL)

    PRECIOUS

    2010-01-25

    Jan 25, 2010 ... The characteristics of F. oxyspoum f. sp. cubense isolates were investigated using ... use in evolutionary and population studies of phyto- .... SDS-PAGE. The protein profile of different isolates showed common protein band of 53 kDa in all Foc isolates except isolate 6 and also it could be differentiated by ...

  4. Anaerobic Co-Digestion of the Microalgae Scenedesmus Sp.

    Energy Technology Data Exchange (ETDEWEB)

    Ramos-Suarez, J. L.; Carreras, N.

    2011-06-07

    Microalgae biomass has been widely studied for biogas production over the last years and results show that anaerobic digestion is often limited by the low C/N ratio of this type of biomass. Therefore, codigestion with substrates of high C/N ratio is necessary. The objectives of this study are to set up an experimental method that ease reproducibility and control of anaerobic digestion processes in laboratory conditions and to determine the biodegradability and biogas production potential of the co-digestion process of microalgae Scenedesmus sp. and energy crop Opuntia ficus indica (L.) Miller. Results obtained showed that higher C/N ratios are preferred in order to maximize methane production. Highest methane yield obtained was 0.252m3CH4/Kg VS and degradability expressed as percentage COD reduced is around 30% for the ideal mixture found, made up of 75% O. ficus-indica and 25% Scenedesmus sp. in VS basis. A laboratory setup using MicroOxymax respirometer, after its adaptation to work under anaerobic conditions, can be used for the monitoring of anaerobic digestion processes. Scenedesmus sp. as sole substrate for anaerobic digestion does not give good results due to low C/N ratio. However, when codigesting it with O. ficus-indica methane production is satisfactory. Best mixture was made up of 75% O. ficus-indica and 25% Scenedesmus sp. in VS basis. (Author)

  5. Archaeperidinium saanichi sp. nov

    DEFF Research Database (Denmark)

    Mertens, Kenneth Neil; Yamaguchi, Aika; Kawami, Hisae

    2012-01-01

    In this paper we describe a new species, Archaeperidinium saanichi sp. nov. within the Archaeperidinium minutum Jörgensen 1912 species complex. We examined the morphological variation of the cyst and motile stage by incubation experiments from sediment samples collected in coastal British Columbia...

  6. Production and optimization of L-asparaginase by Bacillus sp ...

    African Journals Online (AJOL)

    L-Asparaginase (L-asparagine amido hydrolase, E.C.3.5.1.1) is an important enzyme which has antitumor properties. This paper describes the production and optimization of L-asparaginase by Bacillus sp. KK2S4 utilization of ground corn cob waste as substrate to reduce and manage the waste in our environment.

  7. Medium optimization for acarbose production by Actinoplanes sp ...

    African Journals Online (AJOL)

    In order to improve the production of acarbose, the fermentation medium of acarbose-producing strain Actinoplanes sp. A56 was optimized in this paper. Firstly, fractional factorial design was employed to investigate the influences of glucose, maltose, corn steep liquor, soy bean flour and monosodium glutamate on ...

  8. Nematoproctus kubani sp. nov. (Insecta, Diptera, Dolichopodidae) from Laos

    Czech Academy of Sciences Publication Activity Database

    Olejníček, Jiří

    2002-01-01

    Roč. 87, - (2002), s. 67-70 ISSN 1211-8788 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6022909 Keywords : Dolichopodidae * Nematoproctus kubani sp.nov. * Oriental region Subject RIV: EG - Zoology

  9. Culture characteristics of Candida sp in waste conversion ...

    African Journals Online (AJOL)

    A strain of Candida sp. was isolated from ripe banana pulp during the preliminary phase of a process for the production of a protein-enriched feed supplement. Morphological and biochemical tests demonstrated that the strain, which was bipolar and elongated, was not capable of growth at 37ºC but grew at room ...

  10. Biological characterisation of Haliclona (?gellius) sp.: sponge and associated microorganisms.

    NARCIS (Netherlands)

    Sipkema, D.; Holmes, B.; Nichols, S.A.; Blanch, H.W.

    2009-01-01

    We have characterised the northern Pacific undescribed sponge Haliclona (?gellius) sp. based on rDNA of the sponge and its associated microorganisms. The sponge is closely related to Amphimedon queenslandica from the Great Barrier Reef as the near-complete 18S rDNA sequences of both sponges were

  11. Single-Particle Soot Photometer (SP2) Instrument Handbook

    Energy Technology Data Exchange (ETDEWEB)

    Sedlacek, Arthur [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2017-02-01

    The SP2 is an instrument that measures, in situ, the time-dependent scattering and incandescence signals produced by individual BC-containing particles as they travel through a continuous-wave laser beam. Any particle traversing the laser beam will scatter light, and the BC component of a BC-containing particle will absorb some of the laser energy until its temperature is raised to the point at which it incandesces (hereafter we adopt the standard terminology of the SP2 community and denote any substance determined by the SP2 to be BC as refractory black carbon (rBC)). The amplitude of the rBC incandescence signal is related to the amount of refractory material contained in the illuminated particle. By binning the individual incandescence signals per unit sample volume, the mass concentration [ng/m3] of rBC can be derived. By binning the individual signals by volume equivalent diameter the size distribution (dN/dlogDVED) per unit time can be derived. The rBC mass loading per unit time and the rBC size distribution unit time are the core data products produced by the SP2. Additionally, the scattering channel can be used to provide information on the rBC particle population-based mixing states within ambient aerosols. However, this data product is produced on a requested-basis since additional detailed analysis and QC/QA must be conducted.

  12. Calibration of PIXE-SP system of elementary analysis

    International Nuclear Information System (INIS)

    Tabacniks, M.H.

    1983-04-01

    The set-up and calibration of the PIXE-SP System of Elementary Analysis located at the Institute of Physics of the University of Sao Paulo is described. The PIXE-SP, that operates with 8 MeV alpha beam, has been calibrated for elements with Z >= 11, by means of homemade evaporated standard targets of Al, Si, Bacl 2 , K 2 CrO 4 , Ti, Cr, Mn, Fe, Cu, Ge, Ag, Sn, and Au. Those targets are thin, homogeneous, and have been calbrated on a microbalance within an average precision of 6%. The overall precision of the PIXE-SP System is estimated in 10% for elements with 16 2 thick, irradiated with a 10 μC electric charge, shows a minimum of about 0,1 ng (approximated 4 ppm) for Mn. The PIXE-SP System has also been intercalibrated with the PIXE located at University of Gent, Belgium, by means of 12 atmospheric aerosol targets collected on two Batelle Cascade Impactors. The analyzed masses of elements with 16 [pt

  13. Comparative study of Aspergillus niger and Penicillium sp. in the ...

    African Journals Online (AJOL)

    STORAGESEVER

    2010-06-14

    Jun 14, 2010 ... The comparative study of Aspergillus niger and Penicillium sp. in the biodegradation of automotive gas oil (AGO) and premium motor spirit (PMS) was carried out to ascertain the effectiveness of using these microorganisms in cleaning and restoring the ecosystem when polluted by petroleum products.

  14. Comparative study of Aspergillus niger and Penicillium sp. in the ...

    African Journals Online (AJOL)

    The comparative study of Aspergillus niger and Penicillium sp. in the biodegradation of automotive gas oil (AGO) and premium motor spirit (PMS) was carried out to ascertain the effectiveness of using these microorganisms in cleaning and restoring the ecosystem when polluted by petroleum products. These fungi were ...

  15. Optimization of lipase production by Staphylococcus sp. Lp12 ...

    African Journals Online (AJOL)

    A bacterial strain isolated from an oil contaminated soil, identified as Staphylococcus sp. Lp12 was screened for lipase activity on tributyrin agar and spirit blue agar medium. Maximum lipase production was observed at 48 h of growth (3.5 Eu/ml). Peptone was found to be as an ideal nitrogen source for production at a ...

  16. Biscalitheca suzanneana, N. Sp., from the uppermost Pennsylvanian of Texas

    Science.gov (United States)

    Mamay, S.H.

    1972-01-01

    Biscalitheca suzanneana, n. sp., is described from specimens found in an uppermost Pennsylvanian deposit in north-central Texas. The genus was identified primarily on the basis of impressions of the unique sporangial annuli. The occurrence establishes for Biscalitheca a stratigraphic range equivalent to nearly the entire Upper Pennsylvanian Series. ?? 1972.

  17. Paraconcinnum leirsi n.sp. (Trematoda: Dicrocoeliidae) from rodents ...

    African Journals Online (AJOL)

    The trematode Paraconcinnum leirsi n.sp. (Dicrocoeliidae) is described from two rodent species, the African gerbil, Gerbilliscus vicinus, and the spiny mouse, Acomys spinosissimus, from Tanzania. It differs from the description of P. hylomisci found in the Stella wood mouse, Hylomyscus stella, in the Democratic Republic of ...

  18. Telosticta fugispinosa sp. nov. from Sabah (Odonata: Zygoptera: Platystictidae).

    Science.gov (United States)

    Dow, Rory A; Afendy, Aqilah; Rahman, Homathevi

    2016-04-14

    Telosticta fugispinosa sp. nov. (holotype male, from Borneo, Sabah, West Coast division, Crocker Range National Park, Inobong, Kimamabang waterfall stream system, 21 ix 2012, deposited in RMNH) is described from Kinabalu National Park and Crocker Range National Park in Sabah, Malaysian Borneo. It is distinguished from all other species of Telosticta by the form of the male anal appendages.

  19. Bioaccumulation of platinum group metals in dolphins, Stenella sp ...

    African Journals Online (AJOL)

    Platinum group metals (PGMs) concentrations were measured in the tissues= of dolphins (Stenella sp.) caught along the Ghanaian coastline. Tissues from specimens caught by fishermen from Dixcove, western Ghana, were analysed in 2006 for palladium (Pd), platinum (Pt) and rhodium (Rh) using the Neutron Activation ...

  20. Reproductive status of opisthoteuthis sp . Over an annual cycle ...

    African Journals Online (AJOL)

    The reproductive biology of deepwater cephalopods has received relatively little attention. The cirrate octopus Opisthoteuthis sp. is a regular bycatch in deep benthic trawls from 800 to 1 200 m deep west of Scotland. Specimens were sampled throughout the seasonal cycle. Mature females occurred over a broad size range ...

  1. Occurrence of Anatrichosoma sp. in a Nigerian feral cat | Ohiolei ...

    African Journals Online (AJOL)

    This is a report of the presence of an embryonated egg with distinct morphological features consistent with those of Anatrichosoma sp., in cat faeces from Ibadan, Nigeria. This is important because detailed information about this parasite's clinical pattern, epidemiology and host range is just being gradually unravelled.

  2. Complete genome sequence of Paenibacillus sp. strain JDR-2

    Science.gov (United States)

    Virginia Chow; Guang Nong; Franz J. St. John; John D. Rice; Ellen Dickstein; Olga Chertkov; David Bruce; Chris Detter; Thomas Brettin; James Han; Tanja Woyke; Sam Pitluck; Matt Nolan; Amrita Pati; Joel Martin; Alex Copeland; Miriam L. Land; Lynne Goodwin; Jeffrey B. Jones; Lonnie O. Ingram; Keelnathan T. Shanmugam; James F. Preston

    2012-01-01

    Paenibacillus sp. strain JDR-2, an aggressively xylanolytic bacterium isolated from sweetgum (Liquidambar styraciflua) wood, is able to efficiently depolymerize, assimilate and metabolize 4-O-methylglucuronoxylan, the predominant structural component of hardwood hemicelluloses. A basis for this capability was first supported by...

  3. Electron field emission from sp -induced insulating to metallic ...

    Indian Academy of Sciences (India)

    Administrator

    possible applications as semiconductor materials (Silva et al 1998) and as potential field emission cathode ... Though post treatment and annealing results in higher sp. 2 content cluster sizes, graphitization of the ... The samples were prepared by a simple pyrolysis method at different temperatures (700, 800 and 900°C) ...

  4. Antibacterial secondary metabolites from the cave sponge Xestospongia sp.

    Science.gov (United States)

    Ankisetty, Sridevi; Slattery, Marc

    2012-05-01

    Chemical investigation of the cave sponge Xestospongia sp. resulted in the isolation of three new polyacetylenic long chain compounds along with two known metabolites. The structures of the new metabolites were established by NMR and MS analyses. The antibacterial activity of the new metabolites was also evaluated.

  5. Antibacterial Secondary Metabolites from the Cave Sponge Xestospongia sp

    OpenAIRE

    Ankisetty, Sridevi; Slattery, Marc

    2012-01-01

    Chemical investigation of the cave sponge Xestospongia sp. resulted in the isolation of three new polyacetylenic long chain compounds along with two known metabolites. The structures of the new metabolites were established by NMR and MS analyses. The antibacterial activity of the new metabolites was also evaluated.

  6. Two new alkaloids from Xestospongia sp., a New Caledonian sponge.

    Science.gov (United States)

    Quirion, J C; Sevenet, T; Husson, H P; Weniger, B; Debitus, C

    1992-10-01

    Five alkaloids have been isolated from a New Caledonian sponge Xestospongia sp. These include three known xestospongin derivatives, the new demethylxestospongin B (1) and a tetrahydrocarboline derivative 5. The structures of the new compounds 1 and 5 have been established by nmr studies and comparison with previously described products.

  7. Amplified Fragment Length Polymorphism of Puccinia graminis f. sp ...

    African Journals Online (AJOL)

    in its continued effort to minimize the impact of stem rust on wheat in Ethiopia. Keywords: AFLP, wheat, stem rust, ... as the main causes of crop losses in wheat. Of these, stem rust caused by Puccinia graminis f. sp. tritici (Pgt) is the main ..... estimated losses in major food and cash crops. Amsterdam: Elsevier, 808 p. Ordonez ...

  8. Radiotoxicological analysis at IPEN-CNEN/SP-Brazil

    International Nuclear Information System (INIS)

    Duarte, C.L.; Gaburo, J.; Bellintani, S.A.

    1987-01-01

    The methodology of control of internal contamination of handlers of radioactive materials is briefly described. The aim of IPEN-CNEN/SP-Brazil is the evaluation of occupational exposure of compounds of uranium, tritium, iodine-131, lead and fluorine among other ones. (M.A.C.) [pt

  9. Procamacolaimus Dorylaimus Sp. Nov. (Nematoda: Leptolaimidae) from the southern atlantic

    NARCIS (Netherlands)

    Holovachov, O.V.

    2003-01-01

    Procamacolaimus dorylaimus sp. nov. is described from the Southern Atlantic (South Shetland Islands, Antarctica). The species is characterised by 3.4-3.5 mm long body; coarsely annulated cuticle without lateral field, epidermal glands and body pores absent, somatic setae present; labial sensilla

  10. Identification and antifungal activity of Streptomyces sp. S72 isolated ...

    African Journals Online (AJOL)

    The test of antifungal activity for several pathogens fungi causing invasive aspergillosis and systemic candidiasis revealed that the Streptomyces sp. S72 was a good moderate antifungal compound producer against Aspergillus fumigatus and Candida albicans, and had no activity against Aspergillus flavus, Aspergillus ...

  11. Phenotyping and molecular characterization of Lysinibacillus sp. P ...

    African Journals Online (AJOL)

    The bacterial strain Lysinibacillus sp. (P-011) was isolated from the midgut of the Drosophila melanogaster larvae. The bacteria were gram positive, spore forming, rod shaped ranging from 1.86 to 2.5µm in length and 0.50 to 0.67 µm in diameter, positive for catalase, indole, oxidase, nitrate reduction, starch and gelatin ...

  12. Polydactyly in the central pacific gecko, Lepidodactylus sp. (Squamata: Gekkonidae)

    Science.gov (United States)

    Bauer, A.M.; Hathaway, S.A.; Fisher, R.N.

    2009-01-01

    We report the first known case of naturally occurring polydactyly in a gekkotan lizard. A single individual from Palmyra Atoll exhibited a triplication of digit III of the m hand. No obvious teratogenic sources are present on the atoll and the causal factors of polydactyly in Lepidodactylus sp. remain unknown.

  13. Isolation and identification of Staphylococcus sp. in powdered infant milk

    Science.gov (United States)

    Palilu, Prayolga Toban; Budiarso, Tri Yahya

    2017-05-01

    Staphylococcus sp. is one of the most dangerous bacteria that could cause food poisoning. It is a pathogenic bacterium which is able to produce enterotoxin in foods. Milk is an ideal growth medium for Staphylococcus sp., that may cause problem if it is to be consumed, especially by infant. It is the objective of this research to detect the presence of Staphylococcus sp. in powdered infant milk. As many as 14 samples obtained from market were used as samples for bacterial isolation. The isolation were done by employing enrichment step on BHI-broth, continued with Baird-Parker Agar which will produce a typical colony. It is then picked and grown on Mannitol Salt Agar, and gram staining, coagulase assay, and fermentation tests. The confirmation step was done by using API-Staph which gives the identification of Staphylococcus hemoliticus, Staphylococcus aureus and Staphylococcus epidermidis, with a percentage of identity ranging from 65.9-97.7%. Two isolates with the highest identification similarity values were then picked for molecular detection. A PCR primer pair targeting gene coding for enterotoxin A was used, and it gives positive result for the two isolates being tested. It is then concluded that the two isolates belong to Staphylococcus sp., and further research need to be done to correctly identify these isolates.

  14. Mucilaginibacter terrae sp nov., isolated from Antarctic soil

    Czech Academy of Sciences Publication Activity Database

    Sedláček, I.; Pantůček, R.; Králová, S.; Mašlaňová, I.; Holochová, P.; Staňková, E.; Sobotka, Roman; Barták, M.; Busse, H.-J.; Švec, P.

    2017-01-01

    Roč. 67, č. 10 (2017), s. 4002-4007 ISSN 1466-5026 R&D Projects: GA MŠk(CZ) LO1416 Institutional support: RVO:61388971 Keywords : Mucilaginibacter terrae sp nov. * James ross island * Antarctic Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 2.134, year: 2016

  15. Biodegradation of Polyethylene by Bacillus sp. Indigenous to the ...

    African Journals Online (AJOL)

    Prof. Ogunji

    Available online at www.biotechsocietynigeria.org. Biodegradation of Polyethylene by Bacillus sp. Indigenous to the. Niger Delta Mangrove Swamp. Ibiene, A. A., Stanley, H. O., Immanuel, O. M.. Department of Microbiology, Faculty of Biological Sciences, College of Applied and Natural Sciences,. University of Port Harcourt, ...

  16. Evaluation of xylanases from Aspergillus niger and Trichoderma sp ...

    African Journals Online (AJOL)

    Despite being present in relatively low amounts, pentosans and hemicelluloses play an important role in dough rheology and bread properties. The aim of this work is to understand how the xylanases from Aspergillus niger and Trichoderma sp. influence dough rheology, such as elasticity, extensibility, strength and stability.

  17. An Acetylenic Alkaloid from the Calcareous Sponge Leucetta sp.

    Directory of Open Access Journals (Sweden)

    Nicole J. de Voogd

    2011-03-01

    Full Text Available A new acetylenic alkaloid was isolated from the sponge Leucetta sp. The structure was established by analyzing spectroscopic data. The alkaloid showed cytotoxicity IC50 2.5 mg/mL against NBT-T2 cells.

  18. Micropropagation of some Malaysian banana and plantain (Musa sp ...

    African Journals Online (AJOL)

    USER

    2010-04-19

    Apr 19, 2010 ... 1Department of Biochemistry, Universiti Putra Malaysia, 43400 UPM Serdang, Selangor Darul Ehsan, Malaysia. 2Department of Cell ... of people, especially in South East Asia (FAOstat, 2005). As one of the origins of ... After emergence at 10 weeks old, male flower bunches were collected from Musa sp. cv.

  19. Drepanosticta rahmani sp. nov., from Kedah, Malaysia (Odonata: Zygoptera: Platystictidae).

    Science.gov (United States)

    Dow, Rory A; Choong, Chee Yen; Ng, Yong Foo

    2017-10-24

    Drepanosticta rahmani sp. nov. (holotype ♂, steep tributary to stream in hills between Baling and Gulai, north west Kedah, Malaysia, 15 xi 2016, leg. R.A. Dow, to be deposited in the Natural History Museum, London) is described from both sexes.

  20. ε-Caprolactam Utilization by Proteus sp. and Bordetella sp. Isolated From Solid Waste Dumpsites in Lagos State, Nigeria, First Report.

    Science.gov (United States)

    Sanuth, Hassan Adeyemi; Yadav, Amit; Fagade, Obasola Ezekiel; Shouche, Yogesh

    2013-06-01

    The ε-caprolactam is the monomer of the synthetic non-degradable nylon-6 and often found as nonreactive component of nylon-6 manufacturing waste effluent. Environmental consequences of its toxicity to natural habitats and humans pose a global public concern. Soil samples were collected from three designated solid waste dumpsites, namely, Abule-Egba, Olusosun and Isheri-Igando in Lagos State, Nigeria. Sixteen bacteria isolated from these samples were found to utilize the ε-caprolactam as a sole source of carbon and nitrogen at concentration of ≤20 g l(-1). The isolates were characterized using their 16S rRNA gene sequence and showed similarity with Pseudomonas sp., Proteus sp., Providencia sp., Corynebacterium sp., Lysinibacillus sp., Leucobacter sp., Alcaligenes sp. and Bordetella sp. Their optimal growth conditions were found to be at temperature range of 30 to 35 °C and pH range of 7.0-7.5. High Performance liquid chromatography analysis of the ε-caprolactam from supernatant of growth medium revealed that these isolates have potential to remove 31.6-95.7 % of ε-caprolactam. To the best of our knowledge, this study is first to report the ability of Proteus sp. and Bordetella sp. for ε-caprolactam utilization.

  1. Revaluation of the film test as a screening test for' Eurytrema sp infection in cattle

    OpenAIRE

    Pacífico Antonio Diniz Belém; Mauro Rodrigues de Oliveira; Carlos Roberto Padovani

    1992-01-01

    Film test was performed in fecal samples of Eurytrema sp infected and non infected cattle but both groups showed similar results. So, it was concluded that film test is an unreliable one for screening Eurytrema sp infection in cattle.

  2. STUDYING THE FEATURES OF CULTIVATION AND OPTIMIZATION OF COMPOSITION CULTURE MEDIA FOR LACTOBACILLUS SP.

    OpenAIRE

    Aniskina M. V.; Volobueva E. S.; Petenko A. I.; Volkova S. A.

    2015-01-01

    The article presents the materials of the study of the features of cultivation of Lactobacillus sp. on different culture medium. We have made a comparison of standard culture medium for cultivation Lactobacillus sp. and determined the most optimal culture medium

  3. Babesia peircei sp. nov. from the jackass penguin | Earlé | African ...

    African Journals Online (AJOL)

    An avian piroplasm, Babesia peircei sp. nov. is described from the jackass penguin Spheniscus demersus. Morphological differences between Babesia peircei sp. nov. and the other valid Babesia spp. are discussed together with the possible vectors.

  4. Multitasking Immune Sp185/333 Protein, rSpTransformer-E1, and Its Recombinant Fragments Undergo Secondary Structural Transformation upon Binding Targets.

    Science.gov (United States)

    Lun, Cheng Man; Bishop, Barney M; Smith, L Courtney

    2017-04-01

    The purple sea urchin, Strongylocentrotus purpuratus , expresses a diverse immune response protein family called Sp185/333. A recombinant Sp185/333 protein, previously called rSp0032, shows multitasking antipathogen binding ability, suggesting that the protein family mediates a flexible and effective immune response to multiple foreign cells. Bioinformatic analysis predicts that rSp0032 is intrinsically disordered, and its multiple binding characteristic suggests structural flexibility to adopt different conformations depending on the characteristics of the target. To address the flexibility and structural shifting hypothesis, circular dichroism analysis of rSp0032 suggests that it transforms from disordered (random coil) to α helical structure. This structural transformation may be the basis for the strong affinity between rSp0032 and several pathogen-associated molecular patterns. The N-terminal Gly-rich fragment of rSp0032 and the C-terminal His-rich fragment show unique transformations by either intensifying the α helical structure or changing from α helical to β strand depending on the solvents and molecules added to the buffer. Based on these results, we propose a name change from rSp0032 to rSpTransformer-E1 to represent its flexible structural conformations and its E1 element pattern. Given that rSpTransformer-E1 shifts its conformation in the presence of solvents and binding targets and that all Sp185/333 proteins are predicted to be disordered, many or all of these proteins may undergo structural transformation to enable multitasking binding activity toward a wide range of targets. Consequently, we also propose an overarching name change for the entire family from Sp185/333 proteins to SpTransformer proteins. Copyright © 2017 by The American Association of Immunologists, Inc.

  5. Resistance to Puccinia graminis f. sp. avenae in Barley Is Associated with the Rpg5 Locus.

    Science.gov (United States)

    Dracatos, Peter; Singh, Davinder; Fetch, Tom; Park, Robert

    2015-04-01

    In barley, gene Rpg5 was first identified for providing resistance to the rye stem rust pathogen (Puccinia graminis f. sp. secalis). A subsequent study determined that Rpg5 is required for rpg4-mediated resistance to the wheat stem rust pathogen (P. graminis f. sp. tritici) including pathotype TTKSK ("Ug99"), which poses a major threat to global wheat and barley production. Based on the effectiveness of Rpg5 against P. graminis f. sp. tritici and P. graminis f. sp. secalis, we assessed whether it also conferred resistance to the oat stem rust pathogen (P. graminis f. sp. avenae). A barley F8 recombinant inbred line (RIL) population was produced by crossing 'Q21861' (Rpg1 and Rpg5) with '73-G1' (Rpg1), which is susceptible to P. graminis f. sp. avenae, P. graminis f. sp. secalis, and some pathotypes of P. graminis f. sp. tritici. Seedling tests were performed on the F8 RIL population using Australian pathotypes of P. graminis f. sp. tritici, P. graminis f. sp. secalis, P. graminis f. sp. avenae, and a putative somatic hybrid between P. graminis f. sp. tritici and P. graminis f. sp. secalis known as the 'Scabrum' rust. Segregation in the responses to all rust isolates for the RILs was identical (50 resistant: 52 susceptible), and fitted a 1:1 ratio (X2=0.039, P=0.843), indicating that resistance to all isolates was monogenetically inherited. Screening of the RILs and the parental lines with perfect markers for the functional Rpg1 and Rpg5 resistance alleles indicated that Rpg1 was fixed, while Rpg5 was positive in all resistant lines and negative in all susceptible lines. This suggests that different formae speciales of P. graminis may share common effectors, and that the Rpg5 locus confers resistance to both P. graminis f. sp. tritici and P. graminis f. sp. secalis and the heterologous formae speciales of P. graminis, P. graminis f. sp. avenae.

  6. Molecular evidence of a new Babesia sp. in goats.

    Science.gov (United States)

    Ozubek, Sezayi; Aktas, Munir

    2017-01-15

    In this study, a novel Babesia sp. infecting goats was detected and its phylogenetic relationship to related species was determined. A total of 200 blood samples collected from sheep (n=78) and goats (n=122) were examined in the study. The V4 hypervariable region of the 18S rRNA gene of the novel Babesia sp. was amplified by PCR and analysed using a reverse line blot hybridization assay adapted for small ruminants. Samples from seven goats hybridized to Theileria/Babesia catch-all and Babesia catch-all probes and did not hybridize to any species-specific probe tested, suggesting the presence of an unrecognized Babesia species or genotype. Sequencing results showed the isolate to clearly differ from ovine Babesia species and genotypes currently available in the GenBank database. The isolate showed 90.9%, 93.5%, and 93.4% identity to B. ovis, B. motasi, and B. crassa, respectively and 91-93% similarity to Babesia genotypes recently described in small ruminants. The highest homology (∼96-97%) observed was with Babesia odocoilei, Babesia sp. EU1, and Babesia divergens. The new isolate was provisionally designated Babesia sp. The study contributes to better insight into the distribution and phylogenetic diversity of piroplasms in small ruminants. The survey indicated a high prevalence of piroplasms in small ruminants (21.5%). Of those detected, T. ovis was the most prevalent (17%), followed by Babesia sp. (3.5%), and B. ovis (2%). Copyright © 2016 Elsevier B.V. All rights reserved.

  7. Sp1/Sp3 and DNA-methylation contribute to basal transcriptional activation of human podoplanin in MG63 versus Saos-2 osteoblastic cells

    Directory of Open Access Journals (Sweden)

    Puri Christina

    2007-03-01

    Full Text Available Abstract Background Podoplanin is a membrane mucin that, among a series of tissues, is expressed on late osteoblasts and osteocytes. Since recent findings have focussed on podoplanin's potential role as a tumour progression factor, we aimed at identifying regulatory elements conferring PDPN promoter activity. Here, we characterized the molecular mechanism controlling basal PDPN transcription in human osteoblast-like MG63 versus Saos-2 cells. Results We cloned and sequenced 2056 nucleotides from the 5'-flanking region of the PDPN gene and a computational search revealed that the TATA and CAAT box-lacking promoter possesses features of a growth-related gene, such as a GC-rich 5' region and the presence of multiple putative Sp1, AP-4 and NF-1 sites. Reporter gene assays demonstrated a functional promoter in MG63 cells exhibiting 30-fold more activity than in Saos-2 cells. In vitro DNase I footprinting revealed eight protected regions flanked by DNaseI hypersensitive sites within the region bp -728 to -39 present in MG63, but not in Saos-2 cells. Among these regions, mutation and supershift electrophoretic mobility shift assays (EMSA identified four Sp1/Sp3 binding sites and two binding sites for yet unknown transcription factors. Deletion studies demonstrated the functional importance of two Sp1/Sp3 sites for PDPN promoter activity. Overexpression of Sp1 and Sp3 independently increased the stimulatory effect of the promoter and podoplanin mRNA levels in MG63 and Saos-2 cells. In SL2 cells, Sp3 functioned as a repressor, while Sp1 and Sp3 acted positively synergistic. Weak PDPN promoter activity of Saos-2 cells correlated with low Sp1/Sp3 nuclear levels, which was confirmed by Sp1/Sp3 chromatin immunoprecipitations in vivo. Moreover, methylation-sensitive Southern blot analyses and bisulfite sequencing detected strong methylation of CpG sites upstream of bp -464 in MG63 cells, but hypomethylation of these sites in Saos-2 cells. Concomitantly

  8. Hydrolysis of surimi wastewater for production of transglutaminase by Enterobacter sp. C2361 and Providencia sp. C1112.

    Science.gov (United States)

    H-Kittikun, Aran; Bourneow, Chaiwut; Benjakul, Soottawat

    2012-12-01

    Surimi wastewater (SWW) is an industrial wastewater, released during the washing step of surimi preparation from minced fish, that causes environmental problem. In this study, SWW produced from ornate threadfin bream (Nemipterus hexodon) was hydrolysed and used to cultivate Enterobacter sp. C2361 and Providencia sp. C1112 for the production of microbial transglutaminase (MTGase, EC 2.3.2.13). The SWW was repeatedly used to wash the fish mince that gained a final protein content of 3.20% (w/v). The commercial protease, Delvolase was the most appropriate protease used to produce fish protein hydrolysate (FPH) from SWW. The FPH at 40% degree of hydrolysis was used instead of a peptone portion in the SPY medium (3.0% starch, 2.0% peptone, 0.2% yeast extract, 0.2% MgSO(4), 0.2% K(2)HPO(4) and 0.2% KH(2)HPO(4), pH 7.0) to cultivate the tested strains at 37°C, shaking speed at 150rpm. Providencia sp. C1112 produced higher MTGase activity (1.78±0.05U/ml) than Streptoverticillium mobaraense (1.61±0.02U/ml) at 18h of cultivation in FPH medium. On the other hand, the Enterobacter sp. C2361 produced lower MTGase activity (1.18±0.03U/ml). Copyright © 2012 Elsevier Ltd. All rights reserved.

  9. Antifungal Activity of Jasminum sambac against Malassezia sp. and Non-Malassezia sp. Isolated from Human Skin Samples

    Directory of Open Access Journals (Sweden)

    Jacinta Santhanam

    2014-01-01

    Full Text Available Malassezia sp. causes skin diseases such as pityriasis versicolor, folliculitis, and atopic dermatitis. The present study aims to evaluate the antifungal activity of J. sambac or Arabian jasmine, a flowering plant abundant in the Southeast Asia against Malassezia sp. using disc diffusion and broth microdilution method. The methanol extract and essential oil from the flowers and leaves of J. sambac were, respectively, prepared using solvent extraction and hydrodistillation process. Skin samples from individuals with dandruff were cultured on Sabouraud dextrose agar overlaid with olive oil. The fungi that grew were observed microscopically, tested with Tween assimilation test, and cultured on CHROMagar (the chromogenic media pioneer to identify Malassezia sp. Out of 5 skin samples, only 2 Malassezia sp. isolates were identified based on morphology and their ability to assimilate Tween. The inhibition zones of methanol extract of flowers and leaves of J. sambac and essential oil of flowers showed potential for antifungal activity with inhibition zones of 11.10 ± 1.92, 12.90 ± 1.68, and 13.06 ± 0.26 mm, respectively, and minimum inhibitory concentration (MIC values of 80 mg/mL to 160 mg/mL and 50%, respectively. In conclusion, J. sambac may be used as an alternative treatment against Malassezia-associated skin infections.

  10. SP-A-enriched surfactant for treatment of rat lung transplants with SP-A deficiency after storage and reperfusion

    NARCIS (Netherlands)

    Erasmus, ME; Hofstede, GJH; Petersen, AH; Batenburg, JJ; Haagsman, HP; Oetomo, SB; Prop, J

    2002-01-01

    Background. The function of pulmonary surfactant is affected by lung transplantation, contributing to impaired lung transplant function. A decreased amount of surfactant protein-A (SP-A) after reperfusion is believed to contribute to the impaired surfactant function. Surfactant treatment has been

  11. Effect of Indigenous Pseudomonas sp. and Bacillus sp. Strains on Yield and Main Chemical Growth Parameters of Radicchio

    Directory of Open Access Journals (Sweden)

    Stanojković-Sebić Aleksandra

    2018-03-01

    Full Text Available Pseudomonas sp. and Bacillus sp. belong to plant growth promoting rhizobacteria which are able to colonize the plants roots and stimulate growth. In this study, the effect of two indigenous plant growth promoting rhizobacterial strains Pseudomonas sp. Q4 and Bacillus sp. Q10 and their mixture (mix Q4+Q10 on content of the main chemical growth parameters (nitrogen, phosphorus, potassium, calcium and magnesium and the yield of dry biomass of radicchio (Cichorium spp. var. rossa di treviso aerial parts and root, was investigated. The study was carried out with stagnosol type of soil in pot experiments under semi-controlled conditions in the Institute of Soil Science (Belgrade, in the period from July to October in 2013. Phosphorus was determined by spectrophotometer, potassium - by flame emission photometry and total nitrogen and carbon - using elemental CNS analyzer, while calcium and magnesium were determined by AAS. The data on yield of both aerial parts and root dry biomass of radicchio showed that its treatment with Q4 and Q10 strains, as well as with their mixture, caused noticeably increase in this parameter in relation to the control, whereby the strain Q4 was more effective for aerial parts, while mix Q4+Q10 - for roots. The obtained data on the studied chemical parameters of radicchio root and aerial parts were in total accordance with their yield. Concluding, studied strains have a potential in promoting the biomass yield and main chemical growth parameters of both aerial parts and root of radicchio.

  12. Evaluation of Culture Conditions to Obtain Fatty Acids from Saline Microalgae Species: Dunaliella salina, Sinecosyfis sp., and Chroomonas sp.

    Directory of Open Access Journals (Sweden)

    D. A. Castilla Casadiego

    2016-01-01

    Full Text Available The use of the saline microalgae, Dunaliella salina, Sinecosyfis sp., and Chroomonas sp., was explored as an alternative source for the production of fatty acids using fertilizer and glycerol as culture media. The nutrient medium used contained “Nutrifoliar,” a commercial fertilizer, and/or glycerol, in natural sea water. The microalgae were placed in cultures with different conditions. The parameters that favored the largest production of fatty acids were 24 hours of agitation and illumination, 1620 L/day of air supply, 2.25 L of air/min, and a temperature of 32°C using “Nutrifoliar” as the culture media. Results indicated that, from 3 g of microalgae in wet base of Chroomonas sp., 54.43 mg of oil was produced. The chromatographic characterization of oil obtained revealed the presence of essential fatty acids such as 9,12,15-octadecatrienoic acid (omega-3 and 4,7,10-hexadecatrienoic acid (omega-6 from the species Dunaliella salina. On the other hand, 9,12-octadecadienoic acid (omega-6 and cis-11-eicosenoic acid (omega-9 were identified from the species Chroomonas sp. The temperature variations played an important role in the velocity of growth or the production of the algae biomass, the amount of oil, and the ability to produce fatty acids.

  13. Ocorrência de Babesia sp em pequenos roedores no Brasil Occurrence of Babesia sp in small rodents in Brazil

    Directory of Open Access Journals (Sweden)

    G.S. Gazeta

    2004-12-01

    Full Text Available Foi analisada a ocorrência de babesiose em pequenos roedores nos municípios de Silva Jardim e Nova lguaçu, Estado do Rio de Janeiro. Foram capturados 44 roedores de seis espécies diferentes e entre eles a prevalência da infecção foi de 27,3%. Rattus norvegicus foi considerado o principal reservatório (50,0% e Oligoryzomys nigripes como novo hospedeiro para Babesia sp. Este foi o primeiro relato de Babesia sp. em roedores no Brasil. A freqüência de roedores positivos e o risco de infecção dos roedores não diferiram entre as áreas estudadas.The occurrence of babesiosis was studied in 44 small rodents of six species captured in Silva Jardim and Nova lguaçu counties, State of Rio de Janeiro, Brazil. The prevalence of injection was 27.3%. Rattus norvegicus was considered as the main reservoir and Oligoryzomys nigripes as a new host to Babesia sp. The frequency and the risk of rodent infection were considered equal among the studied areas. This is the first report of Babesia sp in small rodents in Brazil.

  14. Serum-surfactant SP-D correlates inversely to lung function in cystic fibrosis

    DEFF Research Database (Denmark)

    Olesen, Hanne Vebert; Holmskov, Uffe; Schiøtz, Peter Oluf

    2010-01-01

    BACKGROUND: Cystic fibrosis (CF) affects the lungs causing infections and inflammation. Surfactant protein D (SP-D) is an innate defense lectin primarily secreted in the lungs. We investigated the influence of the SP-D Met11Thr polymorphism on CF lung function; and serum SP-D as a marker for CF...

  15. Symbiotic Hydrogenase Activity in Bradyrhizobium sp. (Vigna) Increases Nitrogen Content in Vigna unguiculata Plants

    Science.gov (United States)

    Baginsky, Cecilia; Brito, Belén; Imperial, Juan; Ruiz-Argüeso, Tomás; Palacios, Jose M.

    2005-01-01

    Bradyrhizobium sp. (Lupinus) and Bradyrhizobium sp. (Vigna) mutants in which hydrogenase (hup) activity was affected were constructed and analyzed. Vigna unguiculata plants inoculated with the Bradyrhizobium sp. (Vigna) hup mutant showed reduced nitrogenase activity and also a significant decrease in nitrogen content, suggesting a relevant contribution of hydrogenase activity to plant yield. PMID:16269797

  16. Sphyrna gilberti sp. nov., a new hammerhead shark (Carcharhiniformes, Sphyrnidae) from the western Atlantic Ocean.

    Science.gov (United States)

    Quattro, Joseph M; Driggers, William B; Grady, James M; Ulrich, Glenn F; Roberts, Mark A

    2013-01-01

    Sphyrna gilberti sp. nov. is described based on 54 specimens collected in the coastal waters of South Carolina, U.S.A. Morphologically, S. gilberti sp. nov. is separable from S. lewini (Griffith & Smith 1834) only in the number of precaudal vertebrae. Due to rarity of specimens and the highly migratory behavior of most sphyrnids, the range of S. gilberti sp. nov. is unknown.

  17. Major metabolites from Monostroma sp. and Porphyra vietnamensis Tan. et. Ho

    Digital Repository Service at National Institute of Oceanography (India)

    Jagtap, T.G.

    in Monostroma sp. Total calorific value of P. vietnamensis was observed to be 3164 cal/g (ash free dry weight) while that of Monostroma sp. was 1941 cal/g (ash free dry weight). C:N ratio was found lower (13.7) in P. vietnamensis than in Monostroma sp. (16.6%)...

  18. The dynamics of the fungal aerospores Alternaria sp. and Cladosporium sp. in Parisian atmospheric air, in France

    Science.gov (United States)

    Brezoczki, V. M.

    2016-08-01

    The bioallergens occurring naturally in the atmospheric air are microorganisms, pollen grains, plant seeds, leaf and stem scrap, or their protein molecules. The presence of various airborne fungal spores determines a high allergenic potential for public health. This effect is due to the high number of produced spores, which under favourable meteorological conditions (dry weather and wind) reach the surrounding air. This paper traces the dynamics of two types of fungi, Alternaria sp and Cladosporium sp, fungi which can be found outdoors, in the surrounding air, as well as indoors, inside houses (especially the conidia of Cladosporium sp). The effects of these fungal spores on human health are varies, ranging from seasonal allergies (hay fever, rhinitis, sinusitis etc.) to sever afflictions of the respiratory system, onset of asthma, disfunctionalities of the nervous systems, of the immune system, zymoses etc. The monitoring of the dynamics of the aerospores Alternaria sp and Cladosporium sp was carried out between 2010 and 2013, over a period of 42 weeks during one calendar year, from February to the end of September, in the surrounding air in the French capital, Paris. The regional and global climate and meteorological conditions are directly involved in the occurrence and development of fungi colonies, the transportation and dispersion of fungal spores in the atmospheric air, as well as in the creation of the environment required for the interaction of chemical and biological components in the air. Knowledge of the dynamics of the studied fungal aerospores, coupled with climate and meteorological changes, offers a series of information on the magnitude of the allergenic potential these airborne spores can determine. Legal regulations in this domain set the allergen risk threshold for the Alternaria sp aerospores at 3500 ÷ 7000 spores/m3 air/week, and for the Cladosporium sp aerospores at 56,000 spores/m3 air/week. Besides these regulations there exist a series of

  19. Marinobacter salarius sp. nov. and Marinobacter similis sp. nov., isolated from sea water.

    Directory of Open Access Journals (Sweden)

    Hooi Jun Ng

    Full Text Available Two non-pigmented, motile, Gram-negative marine bacteria designated R9SW1T and A3d10T were isolated from sea water samples collected from Chazhma Bay, Gulf of Peter the Great, Sea of Japan, Pacific Ocean, Russia and St. Kilda Beach, Port Phillip Bay, the Tasman Sea, Pacific Ocean, respectively. Both organisms were found to grow between 4 °C and 40 °C, between pH 6 to 9, and are moderately halophilic, tolerating up to 20% (w/v NaCl. Both strains were found to be able to degrade Tween 40 and 80, but only strain R9SW1T was found to be able to degrade starch. The major fatty acids were characteristic for the genus Marinobacter including C16:0, C16:1ω7c, C18:1ω9c and C18:1ω7c. The G+C content of the DNA for strains R9SW1T and A3d10T were determined to be 57.1 mol% and 57.6 mol%, respectively. The two new strains share 97.6% of their 16S rRNA gene sequences, with 82.3% similarity in the average nucleotide identity (ANI, 19.8% similarity in the in silico genome-to-genome distance (GGD, 68.1% similarity in the average amino acid identity (AAI of all conserved protein-coding genes, and 31 of the Karlin's genomic signature dissimilarity. A phylogenetic analysis showed that R9SW1T clusters with M. algicola DG893T sharing 99.40%, and A3d10T clusters with M. sediminum R65T sharing 99.53% of 16S rRNA gene sequence similarities. The results of the genomic and polyphasic taxonomic study, including genomic, genetic, phenotypic, chemotaxonomic and phylogenetic analyses based on the 16S rRNA, gyrB and rpoD gene sequence similarities, the analysis of the protein profiles generated using MALDI-TOF mass spectrometry, and DNA-DNA relatedness data, indicated that strains R9SW1T and A3d10(T represent two novel species of the genus Marinobacter. The names Marinobacter salarius sp. nov., with the type strain R9SW1(T ( =  LMG 27497(T  =  JCM 19399(T  =  CIP 110588(T  =  KMM 7502(T and Marinobacter similis sp. nov., with the type strain A3d10(T (

  20. Population-based laboratory surveillance for Giardia sp. and Cryptosporidium sp. infections in a large Canadian health region

    Directory of Open Access Journals (Sweden)

    Laupland Kevin B

    2005-09-01

    Full Text Available Abstract Background Giardia lamblia (intestinalis and Cryptosporidium parvum are the two most important intestinal parasites infecting North Americans but there is a paucity of active population-based surveillance data from Canada. This study determined the incidence of and demographic risk factors for developing Giardia sp. and Cryptosporidium sp. infections in a general Canadian population. Methods Population-based laboratory surveillance was conducted among all residents of the Calgary Health Region (CHR; population ≅ 1 million during May 1, 1999 and April 30, 2002. Results Giardia sp. infection occurred at a rate of 19.6 per 100,000 populations per year. Although the yearly incidence was stable, a significant seasonal variation was observed with a peak in late summer to early fall. Males were at higher risk for development of this infection as compared to females (21.2 vs. 17.9 per 100,000/yr; relative risk (RR 1.19; 95% confidence interval (CI, 1.00–1.40, p = 0.047, and there was a significant decrease in risk associated with an increasing age. Cryptosporidium sp. infection occurred at an overall rate of 6.0 per 100,000 populations per year although a large outbreak of Cryptosporidium sp. infections occurred in the second half of the summer of 2001. During August and September of 2001, the incidence of cryptosporidiosis was 55.1 per 100,000 per year as compared to 3.1 per 100,000 per year for the remainder of the surveillance period (p Conclusion This study provides important information on the occurrence and demographic risk groups for acquisition of giardiasis and cryptosporidiosis in a non-selected Canadian population.

  1. Rhipidocotyle gibsoni n. sp. from a Brazilian Freshwater Fish and Rhipidocotyle froesi n.sp. for r. baculum (linton, 1905 of Eckmann (1932 (Bucephalidae; Digenea

    Directory of Open Access Journals (Sweden)

    Anna Kohn

    1994-12-01

    Full Text Available Rhipidocotyle gibsoni n.sp. is described from Acestrorhynchus lacustris from Paraná River, brazil. It is most closely related to r. froesi n. sp. and to R. eckmanni in the shape of the cephalic hood, differing in the extent of the uterus, in the position of the vitelline follicles and in that the host is a freshwater fish. Rhipidocotyle froesi n. sp. is proposed for the marine specimens described by Eckmann (1932 as R. baculum (Linton, 1905.

  2. Sp1 is essential for p16 expression in human diploid fibroblasts during senescence.

    Directory of Open Access Journals (Sweden)

    Junfeng Wu

    Full Text Available BACKGROUND: p16(INK4a tumor suppressor protein has been widely proposed to mediate entrance of the cells into the senescent stage. Promoter of p16(INK4a gene contains at least five putative GC boxes, named GC-I to V, respectively. Our previous data showed that a potential Sp1 binding site, within the promoter region from -466 to -451, acts as a positive transcription regulatory element. These results led us to examine how Sp1 and/or Sp3 act on these GC boxes during aging in cultured human diploid fibroblasts. METHODOLOGY/PRINCIPAL FINDINGS: Mutagenesis studies revealed that GC-I, II and IV, especially GC-II, are essential for p16(INK4a gene expression in senescent cells. Electrophoretic mobility shift assays (EMSA and ChIP assays demonstrated that both Sp1 and Sp3 bind to these elements and the binding activity is enhanced in senescent cells. Ectopic overexpression of Sp1, but not Sp3, induced the transcription of p16(INK4a. Both Sp1 RNAi and Mithramycin, a DNA intercalating agent that interferes with Sp1 and Sp3 binding activities, reduced p16(INK4a gene expression. In addition, the enhanced binding of Sp1 to p16(INK4a promoter during cellular senescence appeared to be the result of increased Sp1 binding affinity, not an alteration in Sp1 protein level. CONCLUSIONS/SIGNIFICANCE: All these results suggest that GC- II is the key site for Sp1 binding and increase of Sp1 binding activity rather than protein levels contributes to the induction of p16(INK4a expression during cell aging.

  3. [A STUDY OF THE ISOLATED BACTERIOPHAGE ΦAB-SP7 ADSORPTION ON THE CELL SURFACE OF THE AZOSPIRILLUM BRASILENSE SP7].

    Science.gov (United States)

    Guliy, O I; Karavaeva, O A; Velikov, V A; Sokolov, O I; Pavily, S A; Larionova, O S; Burov, A M; Ignatov, O V

    2016-01-01

    The bacteriophage ΦAb-Sp7 was isolated from the cells of the Azospirillum brasilense Sp7. The morphology, size of the gram-negative colonies, and range of lytic activity against other strains and species of the genus Azospirillum was tested. The isolated phage DNA was examined using electrophoretic and restriction analysis, and the size of the genome were established. The electron microscopy. resuIts show that the phage (capsid) has a strand-like form. The electron microscopy study of the bacteriophage ΦAb-Sp7 adsorption on the A. brasilense Sp7 bacterial surface was performed.

  4. Effect of Mycobacterium sp. strain CH1 and mycobacterium sp. strain CH2 on the degradation of four-ring creosote compounds.

    Science.gov (United States)

    Harper, Jennifer Paige; Churchill, Perry F; Lokey-Flippo, Laura; Lalor, Melinda M

    2005-01-01

    The influence of nutrients, Mycobacterium sp. strain CH1 and Mycobacterium sp. strain CH2 on the degradation of aged creosote hydrocarbon contaminants was investigated. The Mycobacterium sp. strain CH2 showed the highest positive influence on the degradation of three- and four-ring PAH compounds. The addition of Mycobacterium sp. strain CH1 had the second highest measured positive influence on the degradation of four-ring compounds. Soluble nitrogen and phosphorus also increased the degradation of aged creosote compounds in the contaminated soil. The addition of bacteria decreased the number of measured bacterial species, indicating competition for limited nutrients in the soil.

  5. Average nucleotide identity of genome sequences supports the description of Rhizobium lentis sp. nov., Rhizobium bangladeshense sp. nov. and Rhizobium binae sp. nov. from lentil (Lens culinaris) nodules.

    Science.gov (United States)

    Rashid, M Harun-or; Young, J Peter W; Everall, Isobel; Clercx, Pia; Willems, Anne; Santhosh Braun, Markus; Wink, Michael

    2015-09-01

    Rhizobial strains isolated from effective root nodules of field-grown lentil (Lens culinaris) from different parts of Bangladesh were previously analysed using sequences of the 16S rRNA gene, three housekeeping genes (recA, atpD and glnII) and three nodulation genes (nodA, nodC and nodD), DNA fingerprinting and phenotypic characterization. Analysis of housekeeping gene sequences and DNA fingerprints indicated that the strains belonged to three novel clades in the genus Rhizobium. In present study, a representative strain from each clade was further characterized by determination of cellular fatty acid compositions, carbon substrate utilization patterns and DNA-DNA hybridization and average nucleotide identity (ANI) analyses from whole-genome sequences. DNA-DNA hybridization showed 50-62% relatedness to their closest relatives (the type strains of Rhizobium etli and Rhizobium phaseoli) and 50-60% relatedness to each other. These results were further supported by ANI values, based on genome sequencing, which were 87-92% with their close relatives and 88-89% with each other. On the basis of these results, three novel species, Rhizobium lentis sp. nov. (type strain BLR27(T) = LMG 28441(T) = DSM 29286(T)), Rhizobium bangladeshense sp. nov. (type strain BLR175(T) = LMG 28442(T) = DSM 29287(T)) and Rhizobium binae sp. nov. (type strain BLR195(T) = LMG 28443(T) = DSM 29288(T)), are proposed. These species share common nodulation genes (nodA, nodC and nodD) that are similar to those of the symbiovar viciae.

  6. Identification of Acetobacter strains isolated from Indonesian sources, and proposals of Acetobacter syzygii sp. nov., Acetobacter cibinongensis sp. nov., and Acetobacter orientalis sp. nov.

    Science.gov (United States)

    Lisdiyanti, Puspita; Kawasaki, Hiroko; Seki, Tatsuji; Yamada, Yuzo; Uchimura, Tai; Komagata, Kazuo

    2001-06-01

    Forty-six strains of acetic acid bacteria newly isolated from flowers, fruits, and fermented foods collected in Indonesia were taxonomically studied. They were Gram-negative rods, produced acetic acid from ethanol, oxidized acetate and lactate to CO(2) and H(2)O, and had Q-9 as the major ubiquinone system. On the basis of DNA-DNA similarity, all strains studied, including type strains and reference strains of the genus Acetobacter, were separated into eleven groups (Groups I to XI). Of the 46 isolates, two isolates were included in Group II and identified as Acetobacter pasteurianus, five in Group IV as A. orleanensis, 16 in Group V as A. lovaniensis, five in Group VII as A. indonesiensis, and three in Group VIII as A. tropicalis. The remaining 15 isolates constituted three new groups based on DNA-DNA similarity; four isolates were included in Group IX, two in Group X, and nine in Group XI. No isolates were identified as A. aceti (Group I), A. peroxydans (Group III), and A. estunensis (Group VI). Phylogenetic analysis based on 16S rDNA sequences of representative strains of the Groups indicated belonging to the strains of the genus Acetobacter. On the basis of DNA base composition, DNA-DNA similarity, and 16S rDNA sequences, three new species of the genus Acetobacter are proposed: Acetobacter syzygii sp. nov. for Group IX, Acetobacter cibinongensis sp. nov. for Group X, and Acetobacter orientalis sp. nov. for Group XI. The distribution of Acetobacter strains in Indonesia is discussed in light of isolation sources.

  7. Acetobacter okinawensis sp. nov., Acetobacter papayae sp. nov., and Acetobacter persicus sp. nov.; novel acetic acid bacteria isolated from stems of sugarcane, fruits, and a flower in Japan.

    Science.gov (United States)

    Iino, Takao; Suzuki, Rei; Kosako, Yoshimasa; Ohkuma, Moriya; Komagata, Kazuo; Uchimura, Tai

    2012-01-01

    Eleven strains of acetic acid bacteria were isolated from stems of sugarcane, fruits, and a flower in Japan. The isolates were separated into three groups, Groups I, II, and III, in the genus Acetobacter according to phylogenetic analysis based on 16S rRNA sequences. The isolates had sequence similarities of 99.8-100% within the Group, 99.3-99.6% to those of the type strains of each related Acetobacter species, and less than 98.4% to those of the type strains of other Acetobacter species. Genomic DNA G+C contents of Groups I, II, and III were 59.2-59.4, 60.5-60.7, and 58.7-58.9 mol%, respectively. The isolates in the Group showed high values of DNA-DNA relatedness to each other, but low values less than 46% to the type strains of related Acetobacter species. A good correlation was found between the three Groups and groups based on DNA G+C contents and DNA-DNA relatedness. All the strains had Q-9 as the main component, and Q-8 and Q-10 as minor components. The isolates in the three Groups did not completely match with any Acetobacter species on catalase reaction, the production of ketogluconic acids from D-glucose, growth on ammoniac nitrogen with ethanol (Hoyer-Frateur medium and Frateur modified Hoyer medium), growth on 30% (w/v) D-glucose, growth in 10% (v/v) ethanol, or DNA G+C contents. On the basis of phylogenetic relationships in the genus Acetobacter and chemosystematic and phenotypic characteristics, the three Groups were regarded as novel species in the genus Acetobacter. Acetobacter okinawensis sp. nov. is proposed for Group I, Acetobacter papayae sp. nov. for Group II, and Acetobacter persicus sp. nov. for Group III.

  8. Adsorption of procion red and congo red dyes using microalgae Spirulina sp

    Directory of Open Access Journals (Sweden)

    Risfidian Mohadi

    2017-10-01

    Full Text Available Adsorption of procion red and congo red dyes using microalgae Spirulina sp was conducted. Spirulina sp was obtained by cultivation and production in laboratory scale. Spirulina sp was used as adsorbent for adsorption of dyes. Adsorption process was studied by kinetic and thermodynamic in order to know the adsorption phenomena. The results showed that kinetically congo red is reactive than procion red on Spirulina sp. On the other hand, thermodynamically procion red was stable than congo red on Spirulina sp which was indicated by adsorption capacity, enthalpy, and entropy.

  9. Molecular Phylogeny and Surface Morphology of Thiriotia hyperdolphinae n. sp. and Cephaloidophora oradareae n. sp. (Gregarinasina, Apicomplexa) Isolated from a Deep Sea Oradarea sp. (Amphipoda) in the West Pacific.

    Science.gov (United States)

    Wakeman, Kevin C; Yabuki, Akinori; Fujikura, Katsunori; Tomikawa, Ko; Horiguchi, Takeo

    2017-10-17

    In an effort to broaden our understanding of the biodiversity and distribution of gregarines infecting crustaceans, this study describes two new species of gregarines, Thiriotia hyperdolphinae n. sp. and Cephaloidophora oradareae n. sp., parasitizing a deep sea amphipod (Oradarea sp.). Amphipods were collected using the ROV Hyper-Dolphin at a depth of 855 m while on a cruise in Sagami Bay, Japan. Gregarine trophozoites and gamonts were isolated from the gut of the amphipod and studied with light and scanning electron microscopy, and phylogenetic analysis of 18S rDNA. Thiriotia hyperdolphinae n. sp. was distinguished from existing species based on morphology, phylogenetic position, as well as host niche and geographic locality. Cephaloidophora oradareae n. sp. distinguished itself from existing Cephaloidophora, based on a difference in host (Oradarea sp.), geographic location, and to a certain extent morphology. We established this latter new species with the understanding that a more comprehensive examination of diversity at the molecular level is necessary within Cephaloidophora. Results from the 18S rDNA molecular phylogeny showed that T. hyperdolphinae n. sp. was positioned within a clade consisting of Thiriotia spp., while C. oradareae n. sp. grouped within the Cephaloidophoridae. Still, supplemental genetic information from gregarines infecting crustaceans will be needed to better understand relationships within this group of apicomplexans. © 2017 The Author(s) Journal of Eukaryotic Microbiology © 2017 International Society of Protistologists.

  10. Preparation of {sup 99m}Tc labeled substance P (SP)

    Energy Technology Data Exchange (ETDEWEB)

    Ozker, S.K. E-mail: ozker@mcw.edu; Hellman, Robert S.; Krasnow, Arthur Z

    2002-11-01

    Substance P (SP) is an ll-amino acid neuropeptide of the tachykinin family. This study investigated the preparation of an SP analog labeled with {sup 99m}Tc for imaging SP receptor positive tissue (inflammatory diseases and neoplasms with increased expression of SP receptors). High specific activity {sup 99m}Tc-SP was prepared using the 1-imino-4-mercaptobutyl (IMB) group as a bifunctional chelator. Biological distribution in mice showed increased {sup 99m}Tc-SP uptake in the salivary glands (which have a high concentration of SP receptors), but this activity was displaced in animals pre-treated with excess non-radioactive SP. These data show that the uptake of {sup 99m}Tc-SP is receptor specific. IMB derivatization at the N-terminal location is suitable for labeling of SP analogues with {sup 99m}Tc. Synthetic analogues of SP labeled with {sup 99m}Tc may be an attractive alternative to {sup 111}In labeled molecules and merit further investigation.

  11. Characterization of diazotrophic bacteria non-symbiotic associated with eucalyptus (eucalyptus sp.) in Codazzi, Cesar (Colombia)

    International Nuclear Information System (INIS)

    Obando Castellanos, Dolly Melissa; Burgos Zabala, Ludy Beatriz; Rivera Botia, Diego Mauricio; Rubiano Garrido, Maria Fernanda; Divan Baldini, Vera Lucia; Bonilla Buitrago, Ruth Rebeca

    2010-01-01

    The effect of climatic seasons (rainy and dry) and the stratum sample (rhizospheric soil, roots and leaves) the population of the genera Azotobacter, Beijerinckia, Derxia, Azospirillum, Herbaspirillum, Gluconacetobacter and Burkholderia in soil rhizosphere, roots and leaves of eucalyptus (eucalyptus sp.). It also assesses their ability to produce indoles compounds as plant growth promoters and their acetylene reduction activity as an indicator of biological fixation of nitrogen. The results showed no statistically significant differences in the Duncan test (p ≤ 0.05) in the population with respect to the climate epoch, suggesting that these bacteria are able to tolerate stress conditions by different physiological mechanisms. With respect to the stratum sample isolates attempts of Herbaspirillum sp. and Azospirillum sp. significant differences in rhizospheric soil and roots. we obtained 44 isolates of which were grouped by phenotypic characterization as 14 suspected of Beijerinckia sp., 12 Azotobacter sp., 8 Derxia sp., 4 Herbaspirillum sp., 5 Azospirillum sp., 1 Gluconacetobacter sp. and 1 Burkholderia sp. due to their high potential were selected isolates C27, C26 and C25. These four strains present the best values of efficiency in vitro, exceeding production values of the reference strains used (A. chroococcum (AC1) and a. brasilense (SP7)).

  12. Novel cyclohexane monooxygenase from Acidovorax sp. CHX100.

    Science.gov (United States)

    Salamanca, Diego; Karande, Rohan; Schmid, Andreas; Dobslaw, Daniel

    2015-08-01

    Acidovorax sp. CHX100 has a remarkable ability for growth on short cycloalkanes (C5-C8) as a sole source of carbon and energy under aerobic conditions via an uncharacterized mechanism. Transposon mutagenesis of Acidovorax sp. CHX100 revealed a novel cytochrome P450 monooxygenase (CYP450chx) which catalyzed the transformation of cyclohexane to cyclohexanol. Primer walking methods categorized CYP450chx as cytochrome P450 class I taking into account its operon structure: monooxygenase, FAD oxidoreductase, and ferredoxin. CYP450chx was successfully cloned and expressed in Escherichia coli JM109. The activity of CYP450chx was demonstrated by means of the indole co-oxidation. Biotransformation capability of CYP450chx was confirmed through the catalysis of cycloalkanes (C5-C8) to their respective cyclic alcohols.

  13. Primary loop simulation of the SP-100 space nuclear reactor

    Energy Technology Data Exchange (ETDEWEB)

    Borges, Eduardo M.; Braz Filho, Francisco A.; Guimaraes, Lamartine N.F., E-mail: eduardo@ieav.cta.b, E-mail: fbraz@ieav.cta.b, E-mail: guimarae@ieav.cta.b [Instituto de Estudos Avancados (IEAv/DCTA) Sao Jose dos Campos, SP (Brazil)

    2011-07-01

    Between 1983 and 1992 the SP-100 space nuclear reactor development project for electric power generation in a range of 100 to 1000 kWh was conducted in the USA. Several configurations were studied to satisfy different mission objectives and power systems. In this reactor the heat is generated in a compact core and refrigerated by liquid lithium, the primary loops flow are controlled by thermoelectric electromagnetic pumps (EMTE), and thermoelectric converters produce direct current energy. To define the system operation point for an operating nominal power, it is necessary the simulation of the thermal-hydraulic components of the space nuclear reactor. In this paper the BEMTE-3 computer code is used to EMTE pump design performance evaluation to a thermalhydraulic primary loop configuration, and comparison of the system operation points of SP-100 reactor to two thermal powers, with satisfactory results. (author)

  14. Algoritmi un heiristikas spēlei Rendzju

    OpenAIRE

    Firjans, Aleksandrs

    2006-01-01

    Šī darba mērķis ir Mākslīga Intelekta nodaļas divu spēlētāju spēles pētīšana Rendzju piemērā. Darbā ir aprakstīti alfa-beta un uzvārējošas bīstamības secības meklēšanas algoritms un dažādas heiristikas , lai paātrināt algoritmu darbību un novērtēt pozīciju. Šie algoritmi ir realizēti manā programmā.

  15. Transformation of 3-chlorodibenzofuran by Pseudomonas sp. HH69.

    Science.gov (United States)

    Harms, H; Wilkes, H; Sinnwell, V; Wittich, R M; Figge, K; Francke, W; Fortnagel, P

    1991-06-01

    The dibenzofuran-degrading bacterial strain Pseudomonas sp. HH69 showed high oxidative activity towards 3-chlorodibenzofuran (3CDF). During the co-metabolic turnover of 3CDF large amounts of 4-chlorosalicylate and temporarily small amounts of salicylate were excreted. Simultaneously a yellow colour appeared due to the excretion of two polar products. Conversion of 3CDF by a mutant, derived from Pseudomonas sp. HH69 and defective in 2,3-dihydroxybiphenyl-1,2-dioxygenase led to the formation of equal quantities of 4'-chloro-2,2',3-trihydroxybiphenyl (4'CTHBP) and 4-chloro-2,2',3-trihydroxybiphenyl (4CTHBP). Crude extracts of the wild type transformed 4'CTHBP to 4-chlorosalicylate, whilst 4CTHBP was transformed to salicylate. Hence, we propose a non-selective initial attack on both aromatic rings of 3CDF and a degradative pathway for the resulting chlorotrihydroxybiphenyls.

  16. Complete genome sequence of Paenibacillus sp. strain JDR-2

    Science.gov (United States)

    Chow, Virginia; Nong, Guang; St. John, Franz J.; Rice, John D.; Dickstein, Ellen; Chertkov, Olga; Bruce, David; Detter, Chris; Brettin, Thomas; Han, James; Woyke, Tanja; Pitluck, Sam; Nolan, Matt; Pati, Amrita; Martin, Joel; Copeland, Alex; Land, Miriam L.; Goodwin, Lynne; Jones, Jeffrey B.; Ingram, Lonnie O.; Shanmugam, Keelnathan T.; Preston, James F.

    2012-01-01

    Paenibacillus sp. strain JDR-2, an aggressively xylanolytic bacterium isolated from sweetgum (Liquidambar styraciflua) wood, is able to efficiently depolymerize, assimilate and metabolize 4-O-methylglucuronoxylan, the predominant structural component of hardwood hemicelluloses. A basis for this capability was first supported by the identification of genes and characterization of encoded enzymes and has been further defined by the sequencing and annotation of the complete genome, which we describe. In addition to genes implicated in the utilization of β-1,4-xylan, genes have also been identified for the utilization of other hemicellulosic polysaccharides. The genome of Paenibacillus sp. JDR-2 contains 7,184,930 bp in a single replicon with 6,288 protein-coding and 122 RNA genes. Uniquely prominent are 874 genes encoding proteins involved in carbohydrate transport and metabolism. The prevalence and organization of these genes support a metabolic potential for bioprocessing of hemicellulose fractions derived from lignocellulosic resources. PMID:22675593

  17. Professional ASPNET 35 SP1 Edition In C# and VB

    CERN Document Server

    Evjen, Bill; Rader, Devin

    2009-01-01

    Professional ASP.NET 3.5 SP1 In C# and VB. ASP.NET 3.5 brings the power of Visual Studio® 2008 along with the multitude of language improvements in C# 2008 and Visual Basic® 2008 as well as powerful new technology called LINQ, together with the ASP.NET 2.0 Framework you already know and love. Packed with valuable coverage of ASP.NET 3.5 SP1, this essential resource offers both C# and VB examples throughout the book, and shares new and updated content on the ADO.NET Entity Framework, ADO.NET Dynamic Data, and ADO.NET Data Services. While ASP.NET 3.5 boasts server controls like the ListView and

  18. Primary loop simulation of the SP-100 space nuclear reactor

    International Nuclear Information System (INIS)

    Borges, Eduardo M.; Braz Filho, Francisco A.; Guimaraes, Lamartine N.F.

    2011-01-01

    Between 1983 and 1992 the SP-100 space nuclear reactor development project for electric power generation in a range of 100 to 1000 kWh was conducted in the USA. Several configurations were studied to satisfy different mission objectives and power systems. In this reactor the heat is generated in a compact core and refrigerated by liquid lithium, the primary loops flow are controlled by thermoelectric electromagnetic pumps (EMTE), and thermoelectric converters produce direct current energy. To define the system operation point for an operating nominal power, it is necessary the simulation of the thermal-hydraulic components of the space nuclear reactor. In this paper the BEMTE-3 computer code is used to EMTE pump design performance evaluation to a thermalhydraulic primary loop configuration, and comparison of the system operation points of SP-100 reactor to two thermal powers, with satisfactory results. (author)

  19. Complete genome sequence of Paenibacillus sp. strain JDR-2

    Energy Technology Data Exchange (ETDEWEB)

    Chow, Virginia [University of Florida; Nong, Guang [University of Florida; St. John, Franz J. [US Forest Service, Forest Products Laboratory, Madison, Wisconsin, USA; Dickstein, Ellen [University of Florida; Chertkov, Olga [Los Alamos National Laboratory (LANL); Bruce, David [Los Alamos National Laboratory (LANL); Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Brettin, Thomas S [ORNL; Han, James [U.S. Department of Energy, Joint Genome Institute; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Martin, Joel [U.S. Department of Energy, Joint Genome Institute; Copeland, A [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Jones, Jeffrey B. [University of Florida; Ingram, Lonnie O. [University of Florida; Shanmugam, Keelnathan T. [University of Florida; Preston, James F. [University of Florida

    2012-01-01

    Paenibacillus sp. strain JDR-2, an aggressively xylanolytic bacterium isolated from sweetgum (Liquidambar styraciflua) wood, is able to efficiently depolymerize, assimilate and metabolize 4-O-methylglucuronoxylan, the predominant structural component of hardwood hemicelluloses. A basis for this capability was first supported by the identification of genes and characterization of encoded enzymes and has been further defined by the sequencing and annotation of the complete genome, which we describe. In addition to genes implicated in the utilization of -1,4-xylan, genes have also been identified for the utilization of other hemicellulosic polysaccharides. The genome of Paenibacillus sp. JDR-2 contains 7,184,930 bp in a single replicon with 6,288 protein-coding and 122 RNA genes. Uniquely prominent are 874 genes encoding proteins involved in carbohydrate transport and metabolism. The prevalence and organization of these genes support a metabolic potential for bioprocessing of hemicellulose fractions derived from lignocellulosic resources.

  20. Complete genome sequence of Paenibacillus sp. strain JDR-2.

    Science.gov (United States)

    Chow, Virginia; Nong, Guang; St John, Franz J; Rice, John D; Dickstein, Ellen; Chertkov, Olga; Bruce, David; Detter, Chris; Brettin, Thomas; Han, James; Woyke, Tanja; Pitluck, Sam; Nolan, Matt; Pati, Amrita; Martin, Joel; Copeland, Alex; Land, Miriam L; Goodwin, Lynne; Jones, Jeffrey B; Ingram, Lonnie O; Shanmugam, Keelnathan T; Preston, James F

    2012-03-19

    Paenibacillus sp. strain JDR-2, an aggressively xylanolytic bacterium isolated from sweetgum (Liquidambar styraciflua) wood, is able to efficiently depolymerize, assimilate and metabolize 4-O-methylglucuronoxylan, the predominant structural component of hardwood hemicelluloses. A basis for this capability was first supported by the identification of genes and characterization of encoded enzymes and has been further defined by the sequencing and annotation of the complete genome, which we describe. In addition to genes implicated in the utilization of β-1,4-xylan, genes have also been identified for the utilization of other hemicellulosic polysaccharides. The genome of Paenibacillus sp. JDR-2 contains 7,184,930 bp in a single replicon with 6,288 protein-coding and 122 RNA genes. Uniquely prominent are 874 genes encoding proteins involved in carbohydrate transport and metabolism. The prevalence and organization of these genes support a metabolic potential for bioprocessing of hemicellulose fractions derived from lignocellulosic resources.

  1. Sodium pumps in the Malpighian tubule of Rhodnius sp.

    Directory of Open Access Journals (Sweden)

    CARUSO-NEVES CELSO

    2000-01-01

    Full Text Available Malpighian tubule of Rhodnius sp. express two sodium pumps: the classical ouabain-sensitive (Na+ + K+ATPase and an ouabain-insensitive, furosemide-sensitive Na+-ATPase. In insects, 5-hydroxitryptamine is a diuretic hormone released during meals. It inhibits the (Na+ + K+ATPase and Na+ -ATPase activities indicating that these enzymes are involved in fluid secretion. Furthermore, in Rhodnius neglectus, proximal cells of Malpighian tubule exposed to hyperosmotic medium, regulate their volume through a mechanism called regulatory volume increase. This regulatory response involves inhibition of the (Na+ + K+ATPase activity that could lead to accumulation of active osmotic solute inside the cell, influx of water and return to the normal cell volume. Adenosine, a compound produced in stress conditions, also inhibits the (Na+ + K+ATPase activity. Taken together these data indicate that (Na+ + K+ATPase is a target of the regulatory mechanisms of water and ions transport responsible for homeostasis in Rhodnius sp.

  2. The karyotype of Cathorops sp, a marine catfish from Brazil

    Directory of Open Access Journals (Sweden)

    Vicente Gomes

    1992-01-01

    Full Text Available Cathorops sp has the diploid number of 54 chromosomes. The karyotype comprises lm + sm, 6m, 6sm and 14st pairs. This result is compared with those of other species of Ariidae, mainly Ariopsis felis and Arius dussumieri, found in literature.Foram realizados estudos cromossômicos em 25 espécimens de Cathorops sp pelo método de air-drying. O número modal diplóide encontrado foi de 54 cromossomos sendo 1 par m + sm, 6 pares m, 6 pares sm e 14 pares st. Os resultados são comparados com dados da literatura referentes a cromossomos de outros ariídeos, principalmente de Ariopsis felis e Arius dussumieri.

  3. Pseudomonas matsuisoli sp. nov., isolated from a soil sample.

    Science.gov (United States)

    Lin, Shih-Yao; Hameed, Asif; Hung, Mei-Hua; Liu, You-Cheng; Hsu, Yi-Han; Young, Li-Sen; Young, Chiu-Chung

    2015-03-01

    An aerobic, Gram-stain-negative, rod-shaped and polar-flagellated bacterium, designated strain CC-MHH0089(T), was isolated from a soil sample taken on Matsu Island (Taiwan). Strain CC-MHH0089(T) grew at 15-30 °C and pH 5.0-10.0 and tolerated ≤8 % (w/v) NaCl. 16S rRNA gene sequence analysis showed high pairwise sequence similarity to Pseudomonas azotifigens 6H33b(T) (97.3 %) and Pseudomonas balearica SP1402(T) (96.7 %) and lower sequence similarity to other strains (Pseudomonas, for which the name Pseudomonas matsuisoli sp. nov. is proposed. The type strain is CC-MHH0089(T) ( = BCRC 80771(T) = JCM 30078(T)). © 2015 IUMS.

  4. Mitochondrial genome of Boleophthalmus sp. nov. (Osteichthyes: Gobiidae).

    Science.gov (United States)

    Zhang, Jie; Takita, Toru; Muchtar, Agusnimar; Chen, Changmao; Ishimatsu, Atsushi

    2016-09-01

    Boleophthalmus is a genus that consists of six valid species and possesses a number of specializations in terms of amphibious life. The complete mtDNA sequence of Boleophthalmus sp. nov. (17,113 bp in length) has 13 protein-coding genes, 22 tRNA genes, two rRNA genes (12S and 16 S rRNA), and one control region. By comparing the COI sequences, Boleophthalmus sp. nov. is closely related of B. pectinirostris but exhibits 8.93% genetic distance with B. pectinirostris and 13.26% with B. boddarti. This finding may fill some gaps remaining on the taxonomy and biodiversity of this taxon and contribute to the understanding of the phylogeographic relationships between the continental coast and Southeast Asia.

  5. Tongue adhesion in the horned frog Ceratophrys sp.

    Science.gov (United States)

    Kleinteich, Thomas; Gorb, Stanislav N.

    2014-06-01

    Frogs are well-known to capture elusive prey with their protrusible and adhesive tongues. However, the adhesive performance of frog tongues and the mechanism of the contact formation with the prey item remain unknown. Here we measured for the first time adhesive forces and tongue contact areas in living individuals of a horned frog (Ceratophrys sp.) against glass. We found that Ceratophrys sp. generates adhesive forces well beyond its own body weight. Surprisingly, we found that the tongues adhered stronger in feeding trials in which the coverage of the tongue contact area with mucus was relatively low. Thus, besides the presence of mucus, other features of the frog tongue (surface profile, material properties) are important to generate sufficient adhesive forces. Overall, the experimental data shows that frog tongues can be best compared to pressure sensitive adhesives (PSAs) that are of common technical use as adhesive tapes or labels.

  6. Bioactive Compounds of Edible Purple Laver Porphyra sp. (Nori).

    Science.gov (United States)

    Bito, Tomohiro; Teng, Fei; Watanabe, Fumio

    2017-12-13

    Porphyra sp. (nori) is widely cultivated as an important marine crop. Dried nori contains numerous nutrients, including vitamin B 12 , which is the only vitamin absent from plant-derived food sources. Vegetarian diets are low in iron and vitamin B 12 ; depletion of both causes severe anemia. Nori also contains large amounts of iron compared with other plant-derived foods and eicosapentaenoic acid, which is an important fatty acid found in fish oils. In nori, there are also many bioactive compounds that exhibit various pharmacological activities, such as immunomodulation, anticancer, antihyperlipidemic, and antioxidative activities, indicating that consumption of nori is beneficial to human health. However, Porphyra sp. contains toxic metals (arsenic and cadmiun) and/or amphipod allergens, the levels of which vary significantly among nori products. Further evidence from human studies of such beneficial or adverse effects of nori consumption is required.

  7. Genome sequence and description of Anaerosalibacter massiliensis sp. nov.

    Directory of Open Access Journals (Sweden)

    N. Dione

    2016-03-01

    Full Text Available Anaerosalibacter massiliensis sp. nov. strain ND1T (= CSUR P762 = DSM 27308 is the type strain of A. massiliensis sp. nov., a new species within the genus Anaerosalibacter. This strain, the genome of which is described here, was isolated from the faecal flora of a 49-year-old healthy Brazilian man. Anaerosalibacter massiliensis is a Gram-positive, obligate anaerobic rod and member of the family Clostridiaceae. With the complete genome sequence and annotation, we describe here the features of this organism. The 3 197 911 bp long genome (one chromosome but no plasmid contains 3271 protein-coding and 62 RNA genes, including six rRNA genes.

  8. The noncompact portion of Sp(4, R) via quaternions

    Energy Technology Data Exchange (ETDEWEB)

    Ansari, Yassmin R; Ramakrishna, Viswanath [Department of Mathematical Sciences and Center for Signals, Systems and Communications, University of Texas at Dallas, PO Box 830688, Richardson, TX 75083 (United States)], E-mail: vish@utdallas.edu

    2008-08-22

    This work provides a quaternionic representation for real symplectic matrices in dimension four, analogous to that for the orthogonal group. This is achieved by characterizing positive definite symplectic matrices via quaternions. It also provides a technique to compute the polar decomposition for Sp(4, R) which requires no diagonalization, but relies only on the solution of a 2 x 2 linear system. This constructive technique to compute the 'non-compact portion' of Sp(4, R) is then used to compute the smallest eigenvalue of the noise (covariance) matrix of the so-called Gaussian two-mode systems. Other applications where this non-compact portion is relevant are also discussed.

  9. Influence of copper on Euplotes sp. and associated bacterial population

    Directory of Open Access Journals (Sweden)

    Guilherme Oliveira Andrade da Silva

    2014-05-01

    Full Text Available The influence of copper on the ciliate Euplotes sp. and associated bacteria isolated from sediment samples of Guanabara Bay were investigated in bioassays. This region is highly affected by heavy metals such as copper, from solid waste constantly dumped in the bay and other sources such as industrial effluents, antifouling paints, atmospheric deposition and urban drainage, and even today there are few data on the metal toxicity to the ecosystem of the Bay of Guanabara. Bioassays were conducted to estimate the LC50-24 h of copper, in order to determine the concentration of metal bearing 50% of the population mortality. The results indicated that the concentrations of 0.05 and 0.009 mg L-1 presented no toxicity to Euplotes sp. The associated bacteria are tolerant to copper concentrations used in bioassays, and suggest that they could be used as a potential agent in the bioremediation of areas affected by copper.

  10. Microbiological Quality of Panicum maximum Grass Silage with Addition of Lactobacillus sp. as Starter

    Science.gov (United States)

    Sumarsih, S.; Sulistiyanto, B.; Utama, C. S.

    2018-02-01

    The aim of the research was to evaluate microbiological quality of Panicum maximum grass silage with addition Lactobacillus sp as starter. The completely randomized design was been used on this research with 4 treaments and 3 replications. The treatments were P0 ( Panicum maximum grass silage without addition Lactobacillus sp ), P1 ( Panicum maximum grass silage with 2% addition Lactobacillus sp), P2 (Panicum maximum grass silage with 4% addition Lactobacillus sp) and P3 (Panicum maximum grass silage with 6% addition Lactobacillus sp).The parameters were microbial populations of Panicum maximum grass silage (total lactic acid bacteria, total bacteria, total fungi, and Coliform bacteria. The data obtained were analyzed variance (ANOVA) and further tests performed Duncan’s Multiple Areas. The population of lactic acid bacteria was higher (PMicrobiological quality of Panicum maximum grass silage with addition Lactobacillus sp was better than no addition Lactobacillus sp.

  11. A Verhulst model for microalgae Botryococcus sp. growth and nutrient removal in wastewater

    Science.gov (United States)

    Jamaian, Siti Suhana; Bakeri, Noorhadila Mohd; Sunar, Norshuhaila Mohamed; Gani, Paran

    2017-08-01

    Microalgae Botryococcus sp. is a colonial green alga found in lakes and reservoirs in Malaysia. Previous studies reported that the potential of Botryococcus sp. photosynthesis as a source of fuel. The Botryococcus sp. contains hydrocarbon up to 75% of dry weight, which can be converted into petrol, diesel or turbine fuel or other liquid or gaseous hydrocarbons. Recently, an experimental study was conducted on phycoremediation technology for wastewater using Botryococcus sp. The phycoremediation technology is useful to remove the excess of nutrients such as nitrogen, phosphorus and also have the ability to remove various pollutants from wastewater. This research implements the Verhulst model to estimate the nutrient removal by microalgae Botryococcus sp. from the wastewater. This model has been validated with the experiments of microalgae Botryococcus sp. grown in domestic and palm oil wastewater. The results suggested that microalgae Botryococcus sp. could be cultured in domestic and palm oil wastewater while nutrients are reduced from these wastewaters.

  12. Siphateles (Gila) sp. and Catostomus sp. from the Pleistocene OIS-6 Lake Gale, Panamint Valley, Owens River system, California

    Science.gov (United States)

    Jayko, A. S.; Forester, R. M.; Smith, G. R.

    2014-12-01

    Panamint Valley lies within the Owens River system which linked southeastern Sierra Nevada basins between Mono Lake and Death Valley during glacial-pluvial times. Previous work indicates that late Pleistocene glacial-pluvial Lake Gale, Panamint Valley was an open system during OIS-6, a closed ground water supported shallow lake during OIS-4, and the terminal lake basin for the Owens River system during OIS-2. We here report the first occurrence of fossil fish from the Plio-Pleistocene Panamint basin. Fish remains are present in late Pleistocene OIS-6 nearshore deposits associated with a highstand that was spillway limited at Wingate Wash. The deposits contain small minnow-sized remains from both Siphateles or Gila sp. (chubs) and Catostomus sp. (suckers) from at least four locations widely dispersed in the basin. Siphateles or Gila sp. and Catostomus are indigenous to the Pleistocene and modern Owens River system, in particular to the historic Owens Lake area. Cyprinodon (pupfish) and Rhinichthys (dace) are known from the modern Amargosa River and from Plio-Pleistocene deposits in Death Valley to the east. The late Pleistocene OIS-6 to OIS-2 lacustrine and paleohydrologic record in Panamint basin is interpreted from ostracod assemblages, relative abundance of Artemia sp. pellets, shallow water indicators including tufa fragments, ruppia sp. fragments and the relative abundance of charophyte gyrogonites obtained from archived core, as well as faunal assemblages from paleoshoreline and nearshore deposits. The OIS-4 groundwater supported shallow saline lake had sufficiently low ratios of alkalinity to calcium (alk/Ca) to support the occurrence of exotic Elphidium sp. (?) foraminfera which are not observed in either OIS-2 or OIS-6 lacustrine deposits. The arrival of Owens River surface water into Panamint Basin during OIS-2 is recorded by the first appearance of the ostracod Limnocythere sappaensis at ~27 m depth in an ~100 m archived core (Smith and Pratt, 1957) which

  13. Natural transformation of Thermotoga sp. strain RQ7.

    Science.gov (United States)

    Han, Dongmei; Xu, Hui; Puranik, Rutika; Xu, Zhaohui

    2014-05-10

    Thermotoga species are organisms of enormous interest from a biotechnological as well as evolutionary point of view. Genetic modifications of Thermotoga spp. are often desired in order to fully release their multifarious potentials. Effective transformation of recombinant DNA into these bacteria constitutes a critical step of such efforts. This study aims to establish natural competency in Thermotoga spp. and to provide a convenient method to transform these organisms. Foreign DNA was found to be relatively stable in the supernatant of a Thermotoga culture for up to 6 hours. Adding donor DNA to T. sp. strain RQ7 at its early exponential growth phase (OD600 0.18 ~ 0.20) resulted in direct acquisition of the DNA by the cells. Both T. neapolitana chromosomal DNA and Thermotoga-E. coli shuttle vectors effectively transformed T. sp. strain RQ7, rendering the cells resistance to kanamycin. The kan gene carried by the shuttle vector pDH10 was detected by PCR from the plasmid extract of the transformants, and the amplicons were verified by restriction digestions. A procedure for natural transformation of Thermotoga spp. was established and optimized. With the optimized method, T. sp. strain RQ7 sustained a transformation frequency in the order of 10⁻⁷ with both genomic and plasmid DNA. T. sp. strain RQ7 cells are naturally transformable during their early exponential phase. They acquire DNA from both closely and distantly related species. Both chromosomal DNA and plasmid DNA serve as suitable substrates for transformation. Our findings lend a convenient technical tool for the genetic engineering of Thermotoga spp.

  14. Paediatric SpRs' experiences of breaking bad news.

    Science.gov (United States)

    Horwitz, N; Ellis, J

    2007-09-01

    To ascertain the level of support and training available to paediatric specialist registrars (SpRs) in breaking bad news and their self-reported confidence in this task. A questionnaire-based survey. Paediatric SpRs working in North Thames region. Specialist registrars (n = 206) were sent a questionnaire relating to the level of support and training available to them in breaking bad news and their attitudes to this task. A repeat questionnaire was sent out 2 weeks later. The response rate was 54.9%. The study sample included 78 females and 34 males. The median year of qualification was 1995 [interquartile range (IQR) 1993-1997] and the median year of Calman training was Year 3 (IQR 2-4). Only 15.9% of participants had guidelines where they worked and 91.2% had received training in breaking bad news. Median self-perceived confidence in breaking bad news was rated as 4 out of 5. Only 21.2% of all respondents had both disclosed a diagnosis of Down syndrome and received feedback on their performance from their seniors. Few SpRs were able to adhere to all evidence-based recommendations for breaking bad news. Most SpRs had received training in breaking bad news and self-reported confidence in this skill was high, although their hands-on experience was limited. Recent research shows, however, that parental dissatisfaction with the way in which bad news is broken remains high. The potential discrepancy between self-reported confidence and actual competence casts doubt on the value of self-evaluation.

  15. Effet de la fraction oligosaccharidique de Fusarium oxysporum f. sp ...

    African Journals Online (AJOL)

    La fusariose, causée par Fusarium oxysporum f. sp. vasinfectum (FOV), provoque plus de dégâts dans les cotonneraies.La recherche de méthodes alternatives est donc nécessaire. Le but de cette étude est de montrer l'effet de la fraction oligosaccharidique de FOV en tant qu'éliciteur des défenses naturelles du cotonnier.

  16. Chemical Constituents of the Lichens Cladonia multiformis and Cryptothecia sp

    International Nuclear Information System (INIS)

    Hasliza Yusof; Husna Azahar; Laily Din; Nazlina Ibrahim

    2015-01-01

    Two depsides (atranorin 1 and evernic acid 4), an aromatic compound (methyl β-orcinolcarboxylate 2) and one cleavage product of depside (everninic acid 3) were isolated from two lichens, Cladonia multiformis (1 and 2) and Cryptothecia sp. (3 and 4). The identification of the four compounds was carried out by comparison of the recorded NMR data with that of the reported. Compounds 1 and 4 showed antibacterial activity against Bacillus subtilis and Enterobacter aerogenes. (author)

  17. SP-100 reactor disassembly remote handling test program

    International Nuclear Information System (INIS)

    Wilson, C.E.; Potter, J.D.; Maiden, G.E.; Vader, D.P.

    1991-01-01

    This paper is presented as an overview of the remote handling equipment validation testing, which will be conducted before installation and use in the ground engineering test facility. This equipment will be used to defuel the SP-100 reactor core after removing it from the Test Assembly following nuclear testing. A series of full scale mock-up operational tests will be conducted at a Hanford Site facility to verify equipment design, operation, and capabilities

  18. Studies on Mucopolysaccharidases from Oral Bacteroides sp., especially on Heparinase

    OpenAIRE

    谷口, 裕朗; 藤村, 節夫; 中村, 武

    1982-01-01

    Mucopolysaccharide lyases in the cell extract from a oral strain of Bacteroides sp. produced △4, 5-unsaturated disaccharides from the several substrates including, heparan sulfate, chondroitin sulfate A (ChS-A), chondroitin sulfate C (ChS-C), hyaluronic acid and chondroitin by the elimination reaction. However this enzyme preparation did not degrade chondroitin sulfate B (ChS-B). As for production of heparinase, the presence of heparin in the culture medium was essential. These enzymes were s...

  19. Sp(2) BRST invariant quantization of strings: The harmonic gauge

    International Nuclear Information System (INIS)

    Latorre, J.I.; Massachusetts Inst. of Tech., Cambridge

    1988-01-01

    We analyze the mixed algebra of local diffeomorphisms and Weyl transformations for bosonic strings. BRST and anti-BRST operators are then constructed keeping a manifest Sp(2) invariance. The harmonic gauge arises as a natural gauge choice. All this work is redone in the presence of a two-dimensional background metric. We manage to write down a simple action, to compute the stress tensor and to work out the critical dimensions. (orig.)

  20. Phytochemical characterization of wild edible Boletus sp. from Northeast Portugal

    OpenAIRE

    Heleno, Sandrina A.; Barros, Lillian; Martins, Anabela; Sousa, Maria João; Ferreira, Isabel C.F.R.

    2010-01-01

    Our research has been focused on the documentation of nutritional composition and nutraceutical potential of wild mushrooms, making the information available for a better management and conservation of these species and related habitats. In the present work, the chemical composition and bioactivity of three wild edible Boletus sp. (Boletus aereus, Boletus edulis, Boletus reticulatus) from Northeast Portugal were evaluated, in order to valorise these species as sources of important...