Multijet production at low xBj in deep inelastic scattering at HERA

International Nuclear Information System (INIS)

Chekanov, S.; Derrick, M.; Magill, S.

2007-05-01

Inclusive dijet and trijet production in deep inelastic ep scattering has been measured for 10 2 2 and low Bjorken x, 10 -4 Bj -2 . The data were taken at the HERA ep collider with centre-of-mass energy √(s)=318 GeV using the ZEUS detector and correspond to an integrated luminosity of 82 pb -1 . Jets were identified in the hadronic centre-of-mass (HCM) frame using the k T cluster algorithm in the longitudinally invariant inclusive mode. Measurements of dijet and trijet differential cross sections are presented as functions of Q 2 , x Bj , jet transverse energy, and jet pseudorapidity. As a further examination of low-x Bj dynamics, multi-differential cross sections as functions of the jet correlations in transverse momenta, azimuthal angles, and pseudorapidity are also presented. Calculations at O(α 3 s ) generally describe the trijet data well and improve the description of the dijet data compared to the calculation at O(α 2 s ). (orig.)

Preliminary results from FNAL E665 muon scattering at low. chi. sub Bj

Energy Technology Data Exchange (ETDEWEB)

Schellman, H.

1991-11-01

We present measurements of inelastic muon scattering cross section ratios at very low x{sub Bj}. The Xe/D{sub 2} cross section ratio has been measured for x{sub Bj} down to 2 {times} 10{sup 3}. We have also measured the n/p cross section ratio down to x{sub Bj} = 10{sup 3} and see no significant deviation from unity. 8 refs., 4 figs.

Southampton: A Case Study on Why Academies Are Not the Answer

Science.gov (United States)

Harris, Richard

2009-01-01

The author recounts the arrival of two Oasis Community Learning Academies in Southampton through a process of failed political courage to continue supporting the Local Authority. He tells of the subsequent impact when children and parents react against the regime in one of the Academies. In conclusion he challenges the Labour Government over the…

The development of labour politics in Southampton 1890 - 1945

OpenAIRE

Heaney, G.P.

2000-01-01

The debate on the development of Labour politics has become more complex and it is accepted that local economic, social and political experiences are crucial to an understanding of the growth of Labour and the decline of the Liberals. The majority of regional and local studies have concentrated on the north or London. This study tries to redress the balance by looking at how and why Labour politics developed in Southampton. The economic background is considered including ...

The enigma of capitalism - Beyond human power II and John Gabriel Borkman. Bjørnstjere Bjørnson and Henrik Ibsen as critics of capitalism

Directory of Open Access Journals (Sweden)

Fredrik Engelstad

2015-02-01

Full Text Available The mid-1890s saw the publication of two seminal critiques of capitalism in Norwegian drama: Bjørnstjerne Bjørnson’s Beyond Human Power – Second Play (1895, and Henrik Ibsen’s John Gabriel Borkman (1896. The obvious differences, as well as the similarities of these plays, invite a comparative analysis. Bjørnson’s play is a sociological depiction of class differences and class struggles, expressed in collective action strategies by employers, and a strange mixture of powerlessness and terrorism by the working class.  The main references are work relations and social and political collectivities. Nevertheless, identities and close social relations are a necessary part of social structures as well as dramatic plots. The analysis of Bjørnson’s play focuses on the relationships between individual lives and individual action on the one hand, and the broad social landscape on the other. John Gabriel Borkman is about a stagnated universe, where all of the main characters are trying to revive the past. Borkman is not about work and collectivities, but about financial capital. To Ibsen, financial capital is the ideal environment for research on the ambitions and shortcomings of individuals. Finance in one sense leads to the aggrandizement of individual power; it makes possible the idea that one man can rule the world. At the same time, there is a world of production in the Ibsenesque universe, as there is a world of social identities in Bjørnson. The inspiration for both plays may be found in the developments of capitalism during the latter half of the nineteenth century, but also in their intertextual relationships with Nietzsche and Goethe’s Faust.

Björn Andersson – et liv for elevene, lærerne og naturfagene Björn Andersson – a life for students, teachers and science

Directory of Open Access Journals (Sweden)

Svein Sjøberg

2013-11-01

Full Text Available This article is written in memory of Professor Björn Andersson (1939-2013, the pioneer in the emerging field of science education research in Sweden. In 1976 he was the first to present a PhD in the field of science education in the Nordic countries, and later he became the first to hold a chair in this field in Sweden. The article lifts his PhD (Andersson, 1976 as an example for how a PhD should be written and argues that it should be re-read today. The theses has a clear purpose and research agenda, a well-argued theoretical foundation, a solid anchoring to classroom context, sound choices of methods, excellent analysis of empirical data, both qualitative and qualitative, and a clear presentation of findings and implications. In the decades that followed, Björn was the key person to build the field of science education research in Sweden. This article presents just a few aspects of his wide scope of interests and activities as they have unfolded on the national as well as on the international scene. Björn brought international perspectives to Sweden, and he also represented Sweden abroad. Now, nearly 40 years after Björn graduated, the field of science education in Sweden and the other Nordic countries is well established and flourishing. Björn combined a series of qualities and can serve as a model for new generations: a concern for the learner, teachers and their classroom activities, and a care for coworkers. He provides an example of how to combine an academic activity with a devotion to improve the quality of teaching and learning.

[Late complications following Björk-Shiley and St. Jude Medical heart valve replacement].

Science.gov (United States)

Horstkotte, D; Körfer, R; Budde, T; Haerten, K; Schulte, H D; Bircks, W; Loogen, F

1983-05-01

Valve-related complications after Björk-Shiley mitral (n = 475), aortic (n = 424), or mitral-aortic implantation (n = 119) were compared to complications after St. Jude mitral (n = 173), aortic (n = 152), and St. Jude mitral and aortic (n = 63) replacements. The 1,018 consecutive patients with Björk-Shiley valves had been operated upon between 1974 and 1982, those with St. Jude valves between 1978 and 1982. All patients were placed on anticoagulant therapy with phenprocoumon early after operation and no significant intergroup differences in the effectiveness of the anticoagulant therapy were found. At a comparable follow-up time of approximately 23 months, 24 major thromboembolic episodes were observed after Björk-Shiley mitral (BSM) and 3 after St. Jude mitral valve implantation (SJM), corresponding to a thromboembolic rate of 2.82/100 patient years with BSM and 0.93/100 patient years with SJM. After aortic valve replacements, 1.93 events in 100 patient years occurred after Björk-Shiley aortic (BSA) and 0.73 after St. Jude aortic implantation (SJA). In patients with double valve replacements, these rates were 3.2 (BSM + BSA) and 0.88 (SJM + SJA), respectively. The cerebral vessels were involved in 52% and the arteries of the extremities in 22% of these major events. Six Björk-Shiley prostheses had to be replaced because of valve thrombosis. The overall incidence of severe hemorrhagic complications was 2.94/100 patient years in BSM and 1.79 in SJM. After aortic valve replacement, we found rates of 1.80/100 patient years (BSA) and 2.57/100 patient years (SJA), respectively. Intravascular hemolysis no longer seems to be a significant clinical problem. However, indications of red cell damage after heart valve replacement were significantly greater in patients with perivalvular leakage, valve thrombosis, or dysfunction than in those with normally functioning prostheses. Reoperations were necessary because of valve thrombosis (0.46%), perivalvular leakage (2

Migration in Vulnerable Deltas: A Research Strategy

Science.gov (United States)

Hutton, C.; Nicholls, R. J.; Allan, A.

2015-12-01

C. Hutton1, & R. J. Nicholls1, , 1 University of Southampton, University Road, Southampton, Hampshire, United Kingdom, SO17 1BJ. cwh@geodata. soton.ac.ukAbstractGlobally, deltas contain 500 million people and with rising sea levels often linked to large number of forced migrants are expected in the coming century. However, migration is already a major process in deltas, such as the growth of major cities such as Dhaka and Kolkata. Climate and environmental change interacts with a range of catchment and delta level drivers, which encompass a nexus of sea-level rise, storms, freshwater and sediment supply from the catchment, land degradation, subsidence, agricultural loss and socio-economic stresses. DECCMA (Deltas, Vulnerability and Climate Change: Migration and Adaptation/CARRIA) is investigating migration in the Ganges-Brahmaputra-Meghna (GBM), Mahanadi and Volta Deltas, including the influence of climate change. The research will explore migration from a range of perspectives including governance and stakeholder analysis, demographic analysis, household surveys of sending and receiving areas, macro-economic analysis, and hazards and hotspot analysis both historically and into the future. Migration under climate change will depend on other adaptation in the deltas and this will be examined. Collectively, integrated analysis will be developed to examine migration, other adaptation and development pathways with a particular focus on the implications for the poorest. This will require the development of input scenarios, including expert-derived exogenous scenarios (e.g., climate change) and endogenous scenarios of the delta developed in a participatory manner. This applied research will facilitate decision support methods for the development of deltas under climate change, with a focus on migration and other adaptation strategies.

Multijet production at low x{sub Bj} in deep inelastic scattering at HERA

Energy Technology Data Exchange (ETDEWEB)

Chekanov, S.; Derrick, M.; Magill, S. [Argonne National Laboratory, Argonne, IL (US)] (and others)

2007-05-15

Inclusive dijet and trijet production in deep inelastic ep scattering has been measured for 10Bj}<10{sup -2}. The data were taken at the HERA ep collider with centre-of-mass energy {radical}(s)=318 GeV using the ZEUS detector and correspond to an integrated luminosity of 82 pb{sup -1}. Jets were identified in the hadronic centre-of-mass (HCM) frame using the k{sub T} cluster algorithm in the longitudinally invariant inclusive mode. Measurements of dijet and trijet differential cross sections are presented as functions of Q{sup 2}, x{sub Bj}, jet transverse energy, and jet pseudorapidity. As a further examination of low-x{sub Bj} dynamics, multi-differential cross sections as functions of the jet correlations in transverse momenta, azimuthal angles, and pseudorapidity are also presented. Calculations at O({alpha}{sup 3}{sub s}) generally describe the trijet data well and improve the description of the dijet data compared to the calculation at O({alpha}{sup 2}{sub s}). (orig.)

Ibsen, Bjørnson and the art of acting

Directory of Open Access Journals (Sweden)

Keld Hyldig

2015-02-01

Full Text Available In this article Henrik Ibsen’s and Bjørnstjerne Bjørnson’s contribution to the development of acting in Norwegian theatre are discussed within the background of Danish romantic acting. In the 1850s and -60s both were active as theatre critics, directors and dramatists. Both had a view on theatre and acting marked by a mixture of romantic and realistic ideas, and both urged for the development of Norwegian acting in continuation of Danish and European traditions. It was, however, Bjørnson, who to begin with, came to be most influential with regard to what direction the acting style, among the Norwegian actors, developed. Through his inspiration and efforts a specific national coloured way of acting developed and came to dominate Norwegian theatre at least until the beginning of the 20th century. The influence from Ibsen – and the development of a Norwegian Ibsen tradition – has first of all come from his contemporary plays. A specific Ibsenian (i.e. psychological realistic acting style developed gradually from the 1880s and onwards, through the actors’ work with the characters in Ibsen’s contemporary plays.

Analysis of BJ493 diesel engine lubrication system properties

Science.gov (United States)

Liu, F.

2017-12-01

The BJ493ZLQ4A diesel engine design is based on the primary model of BJ493ZLQ3, of which exhaust level is upgraded to the National GB5 standard due to the improved design of combustion and injection systems. Given the above changes in the diesel lubrication system, its improved properties are analyzed in this paper. According to the structures, technical parameters and indices of the lubrication system, the lubrication system model of BJ493ZLQ4A diesel engine was constructed using the Flowmaster flow simulation software. The properties of the diesel engine lubrication system, such as the oil flow rate and pressure at different rotational speeds were analyzed for the schemes involving large- and small-scale oil filters. The calculated values of the main oil channel pressure are in good agreement with the experimental results, which verifies the proposed model feasibility. The calculation results show that the main oil channel pressure and maximum oil flow rate values for the large-scale oil filter scheme satisfy the design requirements, while the small-scale scheme yields too low main oil channel’s pressure and too high. Therefore, application of small-scale oil filters is hazardous, and the large-scale scheme is recommended.

Band gap characterization of ternary BBi1−xNx (0≤x≤1) alloys using modified Becke–Johnson (mBJ) potential

International Nuclear Information System (INIS)

Yalcin, Battal G.

2015-01-01

The semi-local Becke–Johnson (BJ) exchange-correlation potential and its modified form proposed by Tran and Blaha have attracted a lot of interest recently because of the surprisingly accurate band gaps they can deliver for many semiconductors and insulators (e.g., sp semiconductors, noble-gas solids, and transition-metal oxides). The structural and electronic properties of ternary alloys BBi 1−x N x (0≤x≤1) in zinc-blende phase have been reported in this study. The results of the studied binary compounds (BN and BBi) and ternary alloys BBi 1−x N x structures are presented by means of density functional theory. The exchange and correlation effects are taken into account by using the generalized gradient approximation (GGA) functional of Wu and Cohen (WC) which is an improved form of the most popular Perdew–Burke–Ernzerhof (PBE). For electronic properties the modified Becke–Johnson (mBJ) potential, which is more accurate than standard semi-local LDA and PBE calculations, has been chosen. Geometric optimization has been implemented before the volume optimization calculations for all the studied alloys structure. The obtained equilibrium lattice constants of the studied binary compounds are in coincidence with experimental works. And, the variation of the lattice parameter of ternary alloys BBi 1−x N x almost perfectly matches with Vegard's law. The spin–orbit interaction (SOI) has been also considered for structural and electronic calculations and the results are compared to those of non-SOI calculations

Structure functions at small xBj in a Euclidean field theory approach

International Nuclear Information System (INIS)

Hebecker, A.; Meggiolaro, E.; Nachtmann, O.

2000-01-01

The small-x Bj limit of deep inelastic scattering is related to the high-energy limit of the forward Compton amplitude in a familiar way. We show that the analytic continuation of this amplitude in the energy variable is calculable from a matrix element in Euclidean field theory. This matrix element can be written as a Euclidean functional integral in an effective field theory. Its effective Lagrangian has a simple expression in terms of the original Lagrangian. The functional integral expression obtained can, at least in principle, be evaluated using genuinely non-perturbative methods, e.g., on the lattice. Thus, a fundamentally new approach to the long-standing problem of structure functions at very small x Bj seems possible. We give arguments that the limit x Bj →0 corresponds to a critical point of the effective field theory where the correlation length becomes infinite in one direction

Uudised : Tõnso. Triibud. Björk. DVD

Index Scriptorium Estoniae

2005-01-01

Juuli lõpus ja augusti alguses Leigo järvel etenduvale Shakespeare'i näidendile "Suveöö muusika" kirjutab originaalmuusika Aivar Tõnso. Detroidi duot White Stripes soojendab Tallinna kontserdil 29. juunil klubis Hollywood ansambel Röövel Ööbik. Islandi lauljatar Björk annab juulis välja soundtrack-plaadi Matthew Barney viimasele filmile "Drawing Restraint 9". Piraat-DVDde arestimisest Suurbritannias

Björk aitab põhjamaades õppida / Epp Adler

Index Scriptorium Estoniae

Adler, Epp

2008-01-01

Põhjamaade Ministrite Nõukogu ja põhjamaade saatkondade koostöös on teoks saanud laiahaardeline ja mitmekülgne hariduse ja karjäärivalikute teavitusprogramm "Björk - õpi Põhjamaades". Teavitusprogrammi fookuses on kutseõpe, e-õpe ja elukestev õpe

The wine trade, piracy and maritime contract law in late medieval Southampton

OpenAIRE

Pamuk, Fatih

2014-01-01

Ankara : The Department of History, İhsan Doğramacı Bilkent University, 2014. Thesis (Master's) -- Bilkent University, 2014. Includes bibliographical references leaves 102-105. In late medieval Southampton, wine was a commodity, which was extensively traded, and quite precious to the pirates of the English Channel because it was easy to sell and the vessels loaded with wine had less protection than the ships of precious metals. Therefore, increase of wine trade in the late m...

Mr Bjørn Haugstad, State Secretary, Ministry of Education and Research, Norway

CERN Multimedia

Maximilien Brice

2003-01-01

Photos 01,02: Mr Bjørn Haugstad, State Secretary, Ministry of Education and Research, Norway signing the guest book; standing, Dr Carlo Wyss Photo 03: Luncheon in honour of Mr Bjørn Haugstad, State Secretary, Ministry of Education and Research, Norway, April 2003. Around the table, from left to right: State Secretary Haugstad (standing); Prof. Cecilia Jarlskog, Adviser to the Director-General for Member State Relations; Mr Morten Knutsen, CERN staff - Purchase; Mr Jens Vigen, CERN staff, Library and Norwegian Contact; Prof. Steinar Stapnes, Prof. Univ. of Oslo and Physicist in the ATLAS experiment (in profile), Dr Carlo Wyss, Director for Accelerators (standing), Dr Leif Westgaard, Senior Adviser, Research Council of Norway, CERN Delegate. Photo 04: Luncheon in honour of Mr Bjørn Haugstad, State Secretary, Ministry of Education and Research, Norway, April 2003. Around the table, from left to right: State Secretary Haugstad (standing); Mr Jens Vigen, CERN staff, Library and Norwegian Contact; Prof. Steinar ...

Effective field theory approach to structure functions at small xBj

International Nuclear Information System (INIS)

Nachtmann, O.

2003-01-01

We relate the structure functions of deep inelastic lepton-nucleon scattering to current-current correlation functions in a Euclidean field theory depending on a parameter r. The r-dependent Hamiltonian of the theory is P 0 -(1-r)P 3 , with P 0 the usual Hamiltonian and P 3 the third component of the momentum operator. We show that a small x Bj in the structure functions corresponds to the small r limit of the effective theory. We argue that for r→0 there is a critical regime of the theory where simple scaling relations should hold. We show that in this framework Regge behaviour of the structure functions obtained with the hard pomeron ansatz corresponds to a scaling behaviour of the matrix elements in the effective theory where the intercept of the hard pomeron appears as a critical index. Explicit expressions for various analytic continuations of the structure functions and matrix elements are given as well as path integral representations for the matrix elements in the effective theory. Our aim is to provide a framework for truly non-perturbative calculations of the structure functions at small x Bj for arbitrary Q 2 . (orig.)

Radiographic detection of single-leg fracture in Björk-Shiley Convexo-Concave prosthetic valves: a phantom model study.

Science.gov (United States)

Gilchrist, I C; Cardella, J F; Fox, P S; Pae, W E; el-Ghamry Sabe, A A; Landis, J R; Localio, A R; Kunselman, A R; Hopper, K D

1997-02-01

Cineradiography can identify patients with single-leg fractured Björk-Shiley Convexo-Concave valves, although little is known about the sensitivity and specificity of this technique. We evaluated three normal and six (0 microm gap) single-leg fractured Björk-Shiley valves that were placed in a working phantom model. Valves were randomly imaged a total of 33 times and duplicated into a 120-valve series with a 1:9 ratio of abnormal/normal valves. Six reviewers independently graded each valve and demonstrated markedly different rates of identifying the fractured valves. Average sensitivity at the grade that clinically results in valve explanation was 47%. Among the normal valves, a correct identification was made 96% (range 91% to 99%) of the time. Present radiographic technology may have significant difficulty in identifying true single-leg fracture in Björk-Shiley valves with limb separations that are common among clinically explanted valves.

The Björk-Shiley 70 degree convexo-concave prosthesis strut fracture problem (present state of information).

Science.gov (United States)

Ostermeyer, J; Horstkotte, D; Bennett, J; Huysmans, H; Lindblom, D; Olin, C; Orinius, E; Semb, G

1987-04-01

Between June 1980 and June 1983 4028 Björk-Shiley 70 degree convexo-concave prosthetic heart valves were distributed and implanted in Australia, Canada, Europe and South Africa. As of March 1986, a total of 52 outlet strut fractures (1.29%; 70% CL: 1.1%-1.5%) have been reported from 29 implant institutions in 12 countries. The majority (82.7%) occurred in Europe. Intervals between implantation and fracture were 13 days to 45.3 months (mean: 18.4 months; 70% CL: 16.6 months-20.1 months). The mortality rate after strut fracture was 78.7% (70% CL: 72.5%-84.9%). Upon stratification of the fracture by valve sizes and types it becomes evident that 75% (70% CL: 68.8%-81.2%) of all fractures are related to the sizes 29 mm to 33 mm (which virtually represent the same valve size) and predominantly to mitral valves (p less than 0.01). The large valves again have been stratified into two subsets, namely those fabricated from flanges originally machined as Björk-Shiley 60 degree convexo-concave valves (group I) and later produced valves machined initially to 70 degree specifications (group II). In group I the fracture rate was 5.2% (70% CL: 4.2%-6.2%) versus 1.6% (70% CL: 1.1%-2.1%) in group II (p less than 0.01), which identifies the group I 29 mm-33 mm Björk-Shiley 70 degree convexo-concave valves as the highest risk group for strut fracture. The rates are based upon all available information as of March 16, 1986.(ABSTRACT TRUNCATED AT 250 WORDS)

A Cenozoic record of the equatorial Pacific carbonate compensation depth

Digital Repository Service at National Institute of Oceanography (India)

Palike, H.; Lyle, M.W.; Nishi, H.; Raffi, I.; Ridgwell, A.; Gamage, K.; Klaus, A.; Acton, G.; Anderson, L.; Backman, J.; Baldauf, J.; Beltran, C.; Bohaty, S.M.; Bown, P.; Busch, W.; Channell, J.E.T.; Chun, C.O.J.; Delaney, M.; Dewangan, P.; et al.

A. Wilson 1, Yuhji Yamamoto 49, Shinya Yamamoto 50, Toshitsugu Yamazaki 51 & Richard E. Zeebe 52       1 Ocean and Earth Science, National Oceanography Centre Southampton, University of Southampton, Waterfront Campus, European Way, Southampton, SO... revision 7491). Scenarios were investigated as open system runs and with enabled climate feedback (temperature responsive to greenhouse gas forcing) until steady state conditions were achieved (~150 kyr). Ensembles were run on the Southampton high...

Measurement of the mass splittings between the b{bar b}{chi}{sub b,J}(1P) states

Energy Technology Data Exchange (ETDEWEB)

Edwards, K.W.; Edwards, K.W. [Institute of Particle Physics (Canada); Bellerive, A.; Bellerive, A.; Janicek, R.; Janicek, R.; MacFarlane, D.B.; MacFarlane, D.B.; Patel, P.M.; Patel, P.M. [Institute of Particle Physics (Canada); Sadoff, A.J. [Ithaca College, Ithaca, New York,14850 (United States); Ammar, R.; Baringer, P.; Bean, A.; Besson, D.; Coppage, D.; Darling, C.; Davis, R.; Kotov, S.; Kravchenko, I.; Kwak, N.; Zhou, L. [University of Kansas, Lawrence, Kansas, 66045 (United States); Anderson, S.; Kubota, Y.; Lee, S.J.; ONeill, J.J.; Poling, R.; Riehle, T.; Smith, A. [University of Minnesota, Minneapolis, Minnesota, 55455 (United States); Alam, M.S.; Athar, S.B.; Ling, Z.; Mahmood, A.H.; Timm, S.; Wappler, F. [State University of New York at Albany, Albany, New York, 12222 (United States); Anastassov, A.; Duboscq, J.E.; Fujino, D.; Gan, K.K.; Hart, T.; Honscheid, K.; Kagan, H.; Kass, R.; Lee, J.; Schwarthoff, H.; Spencer, M.B.; Sung, M.; Undrus, A.; Wolf, A.; Zoeller, M.M. [Ohio State University, Columbus, Ohio, 43210 (United States); Richichi, S.J.; Severini, H.; Skubic, P. [University of Oklahoma, Norman, Oklahoma, 73019 (United States); Bishai, M.; Fast, J.; Hinson, J.W.; Menon, N.; Miller, D.H.; Shibata, E.I.; Shipsey, I.P.; Yurko, M. [Purdue University, West Lafayette, Indiana, 47907 (United States); Glenn, S.; Kwon, Y.; Lyon, A.L.; Roberts, S.; Thorndike, E.H. [University of Rochester, Rochester, New York, 14627 (United States); Jessop, C.P.; Lingel, K.; Marsiske, H.; Perl, M.L.; Savinov, V.; Ugolini, D.; Zhou, X. [Stanford Linear Accelerator Center, Stanford University, Stanford, California, 94309 (United States); Coan, T.E.; Fadeyev, V.; Korolkov, I.; Maravin, Y.; Narsky, I.; Shelkov, V.; Staeck, J.; Stroynowski, R.; Volobouev, I.; Ye, J. [Southern Methodist University, Dallas, Texas, 75275 (United States); Artuso, M.; Azfar, F.; Efimov, A.; Goldberg, M.; He, D.; Kopp, S.; Moneti, G.C.; Mountain, R.; Schuh, S.; Skwarnicki, T.; and others

1999-02-01

We present new measurements of photon energies and branching fractions for the radiative transitions {Upsilon}(2S){r_arrow}{gamma}{chi}{sub b(J=0,1,2)}(1P). The masses of the {chi}{sub b} states are determined from the measured radiative photon energies. The ratio of mass splittings between the {chi}{sub b} substates, r{equivalent_to}(M{sub J=2}{minus}M{sub J=1})/(M{sub J=1}{minus}M{sub J=0}), with M the {chi}{sub b} mass, provides information on the nature of the b{bar b} confining potential. We find r(1P)=0.542{plus_minus}0.022{plus_minus}0.024. This value is somewhat lower than the previous world average, but more consistent with the theoretical expectation that r(1P){lt}r(2P); i.e., that this mass splitting ratio is smaller for the {chi}{sub b}(1P) states than for the {chi}{sub b}(2P) states. {copyright} {ital 1999} {ital The American Physical Society}

Late complications in patients with Björk-Shiley and St. Jude Medical heart valve replacement.

Science.gov (United States)

Horstkotte, D; Körfer, R; Seipel, L; Bircks, W; Loogen, F

1983-09-01

Valve-related complications after Björk-Shiley mitral valve implantation (n = 475), aortic valve implantation (n = 424), or mitral-aortic valve implantation (n = 119) were compared with those after St. Jude Medical mitral valve replacement (n = 173), aortic valve replacement (n = 152), or mitral-aortic valve replacement (n = 69). All patients were placed on anticoagulant therapy with phenprocoumon early after operation. All patients had a comparable follow-up time of approximately 23 months, which showed that cumulative thromboembolic rates were significantly higher after St. Jude valve implantation than after Björk-Shiley valve implantation. Reoperations were necessary because of valve thrombosis (0.46%), perivalvular leakage (2.2%), or prosthetic valve endocarditis with perivalvular regurgitation (0.46%). One Björk-Shiley mitral valve prosthesis had to be replaced because of fracture of the outlet strut. Without significant intergroup differences, hemorrhage due to anticoagulant treatment was the most frequent complication. Thromboembolic complications were significantly more frequent after Björk-Shiley mitral, aortic, and double valve replacements than after St. Jude valve implantation. This may lead to consideration of changes in the prophylaxis of thrombus formations in the St. Jude valve, especially in aortic valve replacements, in patients with sinus rhythm.

A measurement of multijet production in low-x{sub Bj} neutral current deep inelastic scattering with ZEUS at HERA

Energy Technology Data Exchange (ETDEWEB)

Danielson, T.E.

2007-12-15

Inclusive dijet and trijet production in deep inelastic ep scattering has been measured for 10Bj}<10{sup -2}. The data were taken at the HERA ep collider with center-of-mass energy {radical}(s)=318 GeV using the ZEUS detector and correspond to an integrated luminosity of 82 pb{sup -1}. Jets were identified in the hadronic center-of-mass (HCM) frame using the k{sub T} cluster algorithm in the longitudinally invariant inclusive mode. Measurements of dijet and trijet differential cross sections are presented as functions of Q{sup 2}, x{sub Bj}, jet transverse energy, and jet pseudorapidity. As a further examination of low-x{sub Bj} dynamics, multi-differential cross sections as functions of the jet correlations in transverse momenta, azimuthal angles, and pseudorapidity are also presented. Calculations at O({alpha}{sup 3}{sub s}) generally describe the trijet data well and improve the description of the dijet data compared to the calculation at O({alpha}{sup 2}{sub s}). (orig.)

[Minor strut fracture of the Björk-Shiley mitral valve].

Science.gov (United States)

Sugita, T; Yasuda, R; Watarida, S; Onoe, M; Tabata, R; Mori, A

1990-06-01

In May, 1982, a 49-year-old man underwent mitral valve replacement (MVR) in our hospital with a 31 mm Björk-Shiley prosthesis for mitral regurgitation. He had been doing well until his episode of palpitation and dyspnea of sudden onset, and was transferred to our ICU with severe cardiogenic shock in Aug, 1986. Chest X-ray film revealed pulmonary edema and breakage of the valve with migration of the disc and the minor strut of the prosthesis. He was operated upon 5 hours after the onset of his complaints. The minor strut was removed from the left upper pulmonary vein and mitral valve re-replacement was done with a 29 mm Björk-Shiley Monostrut valve. The disc which had dislocated into the abdominal aorta was also recovered on the twenty-third post operative day. His postoperative course was uneventful. Immediate diagnosis and subsequent re-operation is absolute indication for rescue from acute cardiac failure due to mechanical failure of any prosthetic valve.

Een concentratieprobleem bij B.J. van der Walt

Directory of Open Access Journals (Sweden)

S. Griffioen

2010-07-01

Full Text Available B.J. van der Walt’s concentration problem This contribution probes the concept of secularism, a key notion of B.J. van der Walt’s “Transforming power” (2007. It is found that Van der Walt’s interpretation of secularism rests on a double assumption. The first assumption is that human nature is intrinsically religious. Humans cannot live without putting their trust in something. The second is that this religious nature manifests itself in “concentrated” ways, rather than dispersing itself over a plurality of objects. These assumptions in tandem explain why Van der Walt holds the view that atheism, agnosticism and even overt indifference in matters of faith are at heart propelled by convictions that share the main features of positive religions. It also explains why he assumes that all these convictions tend towards one and the same goal: to gain dominance in the public realm. This article is sympathetic towards the first assumption, and skeptical towards the second. It is argued that the “concentration- thesis” fails to do justice to world and life-views that obviously do not claim total allegiance. To illustrate this point it turns to the phenomenon of “multiple religious participation”, as well as to different strands within contemporary humanism. It concludes that the main problem may well be that secular culture has little to offer to satisfy the innate religious drive in humankind.

Reducing hospital admissions and improving the diagnosis of COPD in Southampton City: methods and results of a 12-month service improvement project.

Science.gov (United States)

Wilkinson, Tom; North, Mal; Bourne, Simon C

2014-08-21

The British Lung Foundation highlighted Southampton City as a hotspot for patients at future risk of chronic obstructive pulmonary disease (COPD) exacerbations due to severe deprivation levels and a high undiagnosed level of disease based on health economic modelling. We developed a strategy spanning primary and secondary care to reduce emergency admissions of patients with acute exacerbations of COPD and increase the diagnosed prevalence of COPD on general practitioner (GP) registers closer to that predicted from local modelling. A comprehensive 3-year audit of admissions was performed. Patients who had been admitted with an exacerbation to University Hospital Southampton three or more times in the previous 12 months were cohorted and cared for in a consultant-led, but community based, COPD service. Within primary care, a programme of education and case-based finding was delivered to most practices within the city. Thirty-four patients were found to be responsible for 176 admissions (22% of total COPD admissions) to the hospital. These 34 patients required 185 active interventions during the 12-month period but only 39 hospital admissions. The 30-day readmission rate dropped from 13.4 to 1.9% (Pmodel.

Women and children first? The administration of Titanic relief in Southampton, 1912–59.

Science.gov (United States)

Gregson, Sarah

2012-01-01

One of the principal narratives woven around the 1912 sinking of the Titanic is that the tragedy united people around the world in a shared sense of horror and grief. This study examines the administration of the relief fund collected for victims and questions the established image of social unity and collective suffering. The records of the Southampton Titanic Relief Fund reveal welfare processes imbued with class and gender prejudices that consigned many of the relatives of victims to poverty-stricken lives, despite the massive fund collected in their names.

Acute aortic regurgitation secondary to disk embolization of a Björk-Shiley prosthetic aortic valve.

Science.gov (United States)

Grande, Robert D; Katz, William E

2011-03-01

Having passed the 30th anniversary of the first implantation of a Björk-Shiley convexo-concave tilting mechanical valve, recognition of the life-threatening complication of strut fracture is not widespread. The authors report the case of a 48-year-old man with acute-onset chest pain and dyspnea found to have strut fracture and disk embolization of a 26-year-old Björk-Shiley prosthetic aortic valve. The value of echocardiography in the diagnosis of this condition is discussed. Copyright © 2010 American Society of Echocardiography. Published by Mosby, Inc. All rights reserved.

The Evolution of Digital Chemistry at Southampton.

Science.gov (United States)

Bird, Colin; Coles, Simon J; Frey, Jeremy G

2015-09-01

In this paper we take a historical view of e-Science and e-Research developments within the Chemical Sciences at the University of Southampton, showing the development of several stages of the evolving data ecosystem as Chemistry moves into the digital age of the 21(st) Century. We cover our research on aspects of the representation of chemical information in the context of the world wide web (WWW) and its semantic enhancement (the Semantic Web) and illustrate this with the example of the representation of quantities and units within the Semantic Web. We explore the changing nature of laboratories as computing power becomes increasing powerful and pervasive and specifically look at the function and role of electronic or digital notebooks. Having focussed on the creation of chemical data and information in context, we finish the paper by following the use and reuse of this data as facilitated by the features provided by digital repositories and their importance in facilitating the exchange of chemical information touching on the issues of open and or intelligent access to the data. © 2015 The Authors. Published by Wiley-VCH Verlag GmbH & Co. KGaA. This is an open access article under the terms of the Creative Commons Attribution License, which permits use, distribution and reproduction in any medium, provided the original work is properly cited.

BJ-TSA-9, a novel human tumor-specific gene, has potential as a biomarker of lung cancer.

Science.gov (United States)

Li, Yunyan; Dong, Xueyuan; Yin, Yanhui; Su, Yanrong; Xu, Qingwen; Zhang, Yuxia; Pang, Xuewen; Zhang, Yu; Chen, Weifeng

2005-12-01

Using bioinformatics, we have identified a novel tumor-specific gene BJ-TSA-9, which has been validated by Northern blot analysis and reverse transcription-polymerase chain reaction (RT-PCR). BJ-TSA-9 mRNA was expressed in 52.5% (21 of 40) of human lung cancer tissues and was especially higher in lung adenocarcinoma (68.8%). To explore the potential application of BJ-TSA-9 for the detection of circulating cancer cells in lung cancer patients, nested RT-PCR was performed. The overall positive detection rate was 34.3% (24 of 70) in peripheral blood mononuclear cells (PBMCs) of patients with various types of lung cancers and was 53.6% (15 of 28) in PBMCs of lung adenocarcinoma patients. In combination with the detection of two known marker genes SCC and LUNX, the detection rate was increased to 81.4%. A follow-up study was performed in 37 patients after surgical removal of tumor mass. Among nine patients with persistent detection of two to three tumor marker transcripts in PBMCs, six patients had recurrence/metastasis. In contrast, 28 patients with transient detection of one tumor marker or without detection of any tumor marker were all in remission. Thus, BJ-TSA-9 may serve as a marker for lung cancer diagnosis and as a marker, in combination with two other tumor markers, for the prediction of the recurrence and prognosis of lung cancer patients.

Measurement of multijet events at low x{sub Bj} and low Q{sup 2} with the ZEUS detector at HERA

Energy Technology Data Exchange (ETDEWEB)

Gosau, T.

2007-07-15

In this thesis, cross sections of inclusive and differential di- and trijet production in deep inelastic electron-proton scattering at low Bjorken-x have been determined and compared to perturbative QCD calculations at next-to- leading order. The data were taken during the years 1998-2000 with the ZEUS detector at the HERA collider and had an integrated luminosity of 82 pb{sup -1}. The center-of-mass energy was {radical}(s)=318 GeV. The phase space was defined by 10{sup -4}Bj}<10{sup -2}, 10 GeV{sup 2}1Bj}, transverse energy of the jets in the hadronic center-of-mass frame, E{sup jet}{sub T,HCM}, and the pseudorapidity of the jets in the laboratory frame, {eta}{sup jet}{sub LAB}. Multidifferential cross sections were measured as functions of x{sub Bj} and correlations of the jet momenta in the transverse plane. The 6m Tagger, which was reinstalled in 2003, was calibrated using the measurement of the photon energies by the Spectrometer. First measurements of the acceptance of the luminosity photon detectors where carried out. (orig.)

A 0.7-V 17.4- μ W 3-lead wireless ECG SoC.

Science.gov (United States)

Khayatzadeh, Mahmood; Zhang, Xiaoyang; Tan, Jun; Liew, Wen-Sin; Lian, Yong

2013-10-01

This paper presents a fully integrated sub-1 V 3-lead wireless ECG System-on-Chip (SoC) for wireless body sensor network applications. The SoC includes a two-channel ECG front-end with a driven-right-leg circuit, an 8-bit SAR ADC, a custom-designed 16-bit microcontroller, two banks of 16 kb SRAM, and a MICS band transceiver. The microcontroller and SRAM blocks are able to operate at sub-/near-threshold regime for the best energy consumption. The proposed SoC has been implemented in a standard 0.13- μ m CMOS process. Measurement results show the microcontroller consumes only 2.62 pJ per instruction at 0.35 V . Both microcontroller and memory blocks are functional down to 0.25 V. The entire SoC is capable of working at single 0.7-V supply. At the best case, it consumes 17.4 μ W in heart rate detection mode and 74.8 μW in raw data acquisition mode under sampling rate of 500 Hz. This makes it one of the best ECG SoCs among state-of-the-art biomedical chips.

Vývoj grafického editoru pro zásuvný modul BJ2NB do NetBeans

OpenAIRE

Müller, Martin

2011-01-01

This bachelor thesis is part of a project whose goal is to create a plug-in BJ2NB to NetBeans. It aims to bring into the NetBeans some approaches and possibilities of BlueJ environment, widely used for educational purposes, and to simplify the transition from simple BlueJ IDE to extensive and professional NetBeans for novice programmers. The goal of this work is to design and implement a graphical editor for plug-in BJ2NB that would display the current class diagram of the project and allow t...

Representations of the q-deformed algebras Uq (so2,1) and Uq (so3,1)

International Nuclear Information System (INIS)

Gavrilik, O.M.; Klimyk, A.U.

1993-01-01

Representations of algebra U q (so 2 ,1) are studied. This algebra is a q-deformation of the universal enveloping algebra U(so 2 ,1) of the Lie algebra of the group SO 0 (2,1) and differs from the quantum algebra U q (SU 1 ,1). Classifications of irreducible representations and of infinitesimally irreducible representations of U q (SU 1 ,1). The sets of irreducible representations and of infinitesimally unitary irreducible representations of the algebra U q (so 3 ,1) are given. We also consider representations of U q (so n ,1) which are of class 1 with respect to subalgebra U q (so n ). (author). 22 refs

Functional analysis, harmonic analysis, and image processing a collection of papers in honor of Bj"orn Jawerth

CERN Document Server

Cwikel, Michael

2017-01-01

This volume is dedicated to the memory of Björn Jawerth. It contains original research contributions and surveys in several of the areas of mathematics to which Björn made important contributions. Those areas include harmonic analysis, image processing, and functional analysis, which are of course interrelated in many significant and productive ways. Among the contributors are some of the world's leading experts in these areas. With its combination of research papers and surveys, this book may become an important reference and research tool. This book should be of interest to advanced graduate students and professional researchers in the areas of functional analysis, harmonic analysis, image processing, and approximation theory. It combines articles presenting new research with insightful surveys written by foremost experts.

Schisandrin B protects against solar irradiation-induced oxidative injury in BJ human fibroblasts.

Science.gov (United States)

Chiu, Po Yee; Lam, Philip Y; Yan, Chung Wai; Ko, Kam Ming

2011-06-01

The effects of schisandrin B (Sch B) and its analogs on solar irradiation-induced oxidative injury were examined in BJ human fibroblasts. Sch B and schisandrin C (Sch C) increased cellular reduced glutathione (GSH) level and protected against solar irradiation-induced oxidative injury. The photoprotection was paralleled by decreases in the elastases-type protease activity and matrix-metalloproteinases-1 expression in solar-irradiated fibroblasts. The cytochrome P-450-mediated metabolism of Sch B or Sch C caused ROS production. The results suggest that by virtue of its pro-oxidant action and the subsequent glutathione antioxidant response, Sch B or Sch C may offer the prospect of preventing skin photo-aging. Copyright © 2011 Elsevier B.V. All rights reserved.

Carbonate and carbon fluctuations in the Eastern Arabian Sea over 140 ka: Implications on productivity changes?

Digital Repository Service at National Institute of Oceanography (India)

Guptha, M.V.S.; Naidu, P.D.; Haake, B.G.; Schiebel, R.

, University of Hamburg, Grabenstr. 27, 20357 Hamburg, Germany c School of Ocean and Earth Science, University of Southampton, Southampton Oceanography Centre, European Way, Southampton, SO14 3ZH, UK Received25April2003;accepted21May2005 Abstract Biological...

Active faulting on the Ninetyeast Ridge and its relation to deformation of the Indo-Australian plate

Digital Repository Service at National Institute of Oceanography (India)

Sager, W.W.; Bull, J.M.; Krishna, K.S.

Southampton, University of Southampton, Southampton SO14 3ZH, UK , bull@noc.soton.ac.uk 4CSIR - National Institute of Oceanography, Dona Paula, Goa 403004, India, krishna@nio.org Abstract The ~4500 km-long Ninetyeast Ridge (NER) in the northeastern...

Intraoperative echocardiography of a dislodged Björk-Shiley mitral valve disc.

Science.gov (United States)

Tanaka, M; Abe, T; Takeuchi, E; Watanabe, T; Tamaki, S

1991-02-01

The successful management of a patient who suffered an outlet strut fracture of a Björk-Shiley 60-degree convexo-concave mitral valve prosthesis is reported. Emergency operation was life-saving. Preoperative echocardiography assisted in making a prompt diagnosis, and intraoperative echocardiography allowed the detection and removal of the dislodged disc from the left ventricle at the time of the operation. The role of intraoperative echocardiography in the diagnosis of prosthetic strut fracture is emphasized.

High angle of attack position sensing for the Southampton University magnetic suspension and balance system

Science.gov (United States)

Parker, David H.

1987-01-01

An all digital five channel position detection system is to be installed in the Southampton University Magnetic Suspension and Balance System (SUMSBS). The system is intended to monitor a much larger range of model pitch attitudes than has been possible hitherto, up to a maximum of a 90 degree angle of attack. It is based on the use of self-scanning photodiode arrays and illuminating laser light beams, together with purpose built processing electronics. The principles behind the design of the system are discussed, together with the results of testing one channel of the system which was used to control the axial position of a magnetically suspended model in SUMSBS. The removal of optically coupled heave position information from the axial position sensing channel is described.

Disc dislodgment in Björk Shiley mitral valve prosthesis: two successfully operated cases.

Science.gov (United States)

Dubernet, J; Irarrázaval, M J; Urzúa, J; Maturana, G; Morán, S; Lema, G; Asenjo, F; Fajuri, A

1986-02-01

Two patients with Björk Shiley mitral valve replacement had migration and embolization of the occluding disc. One patient suffered migration of the disc a few hours after surgery and the other had a strut fracture with disc translocation six years after the initial operation. Clinical signs in both cases were pulmonary edema, cardiogenic shock, and absence of prosthetic sounds. Both patients were reoperated on an emergency basis, recovering after a complicated postoperative course. They are on functional Class I, 8 and 1 years later, respectively, with their dislodged discs still in the abdominal aorta. The only hope for survival in these patients is emergency reoperation, once the prosthetic mitral valve dysfunction is confirmed.

Entre Lilith y Eva: Björk canta E. E. Cummings

Directory of Open Access Journals (Sweden)

Jordi Mas López

2016-05-01

del poeta norteamericano en Sun In My Mouth y el resto de composiciones de Vespertine. Frente a la inequívoca exaltación del héroe solar de Cummings, Björk utiliza una mirada femenina que duda entre los referentes de Lilith, la mujer que encuentra su libertad fuera de la sociedad, y Eva, aquella cuya sumisión es socialmente productiva. El resultado es un discurso de gran valor artístico, pero sujeto, en lo ideológico, a las limitaciones que imponen los motivos de partida

Dicty_cDB: Contig-U01127-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( BJ076721 ) Xenopus laevis cDNA clone:XL058i17, 3' end, singl... 44 5.9 1 ( FG291907 ) 1108800220021 New World... Screwworm Egg 9261 ESTs C... 44 5.9 1 ( FG291539 ) 1108793348396 New World Sc...rewworm Egg 9261 ESTs C... 44 5.9 1 ( FG286660 ) 1108770723740 New World Screwworm Egg 9261 ESTs C... 44 5.9

Elective removal of convexo-concave Björk-Shiley valves.

Science.gov (United States)

Rajesh, P B; Smith, G H; Lawford, P V; Black, M M

1994-08-01

Replacement has been an accepted method for treating advanced cardiac valvular disease for more than 25 years. However, the perfect prosthesis has yet to be developed, judging by the number of devices available. A prosthesis that initially appears promising may cause problems in due course, and indeed some devices have been modified or withdrawn from clinical use. A notable example of a prosthetic valve that has give problems is the Björk-Shiley convexo-concave prosthesis, some models of which have undergone mechanical failure due to strut fracture. We report the elective removal of such a valve and the subsequent examination of the prosthesis. The results of this examination suggest that a policy of elective removal is justified.

[Late outlet strut fracture of an aortic Björk-Shiley and embolization of the prosthetic disc].

Science.gov (United States)

Brochet, E; Bougis de Brux, M A; Assayag, P; Benacin, Y; Gamerman, G; Guerot, C; Valère, P E

1988-09-01

A new case of late fracture of an outlet strut in a convexo-concave Björk-Shiley valve is reported. The fracture occurred 6 years after aortic implantation of the valve and was responsible for aorto-iliac embolization by the prosthetic disc and death of the patient from cardiogenic shock. This not uncommon complication of the Björk-Shiley valve prosthesis is usually ascribed to the relative fragility of its outlet strut welded to the metallic ring and subjected to strong pressures. Although most cases were observed within the first two years of prosthetic valve insertion, and mainly with valves manufactured in 1981 and 1982, our case and a few others demonstrate the possibility of late rupture. Cardiologists must be aware of this possible complication, since in some favourable cases it can be diagnosed at an early stage and the patient's life can be saved by an emergency operation.

CALL in a Climate of Change: Adapting to Turbulent Global Conditions. Short Papers from EUROCALL 2017 (25th, Southampton, United Kingdom, August 23-26, 2017)

Science.gov (United States)

Borthwick, Kate, Ed.; Bradley, Linda, Ed.; Thouësny, Sylvie, Ed.

2017-01-01

The 25th European Association of Computer-Assisted Language Learning (EUROCALL) conference was hosted by Modern Languages and Linguistics at the University of Southampton, in the United Kingdom, from the 23rd to the 26th of August 2017. The theme of the conference was "CALL in a climate of change." The theme encompassed the notion of how…

Occupational physical activities, working hours and outcome of pregnancy: findings from the Southampton Women's Survey.

Science.gov (United States)

Bonzini, M; Coggon, D; Godfrey, K; Inskip, H; Crozier, S; Palmer, K T

2009-10-01

To investigate risks of physical activity at work by pregnancy trimester, including the effects on head and abdominal circumference. At 34 weeks of gestation we interviewed 1327 mothers from the prospective Southampton Women's Survey (SWS); we asked about their activities (working hours, standing/walking, kneeling/squatting, trunk bending, lifting and night shifts) in jobs held at each of 11, 19 and 34 weeks of gestation, and subsequently ascertained four birth outcomes (preterm delivery, small for gestational age (SGA) and reduced head or abdominal circumference) blinded to employment history. Risk of preterm delivery was elevated nearly threefold in women whose work at 34 weeks entailed trunk bending for >1 h/day. Small head circumference was more common in babies born to women who worked for >40 h/week. However, no statistically significant associations were found with SGA or small abdominal circumference, and preterm delivery showed little association with long working hours, lifting, standing or shift work. There is a need for more research on trunk bending late in pregnancy, and on the relationship of work to reduced head circumference. Our findings on several other occupational exposures common among pregnant workers are reassuring.

Sea level changes induced by local winds on the west coast of India

Digital Repository Service at National Institute of Oceanography (India)

Mehra, P.; Tsimplis, M.N.; Desai, R.G.P.; Joseph, A.; Shaw, A.G.P.; Somayajulu, Y.K.; Cipollini, P.

1 National Institute of Oceanography, Goa, India 2 National Oceanography Centre, Southampton, UK # [Corresponding author: pmehra@nio.org] Abstract The contribution of atmospheric pressure and wind to sea level variability at Goa (West...), Southampton under an Indian Ocean Tsunami Warning System (IOWTS) fellowship-2008-2009. We are all grateful to the International Oceanographic Commission for providing us with the opportunity of working together. 17 R: Correlation coefficient between sea...

Strut fracture and disc embolization of a Björk-Shiley mitral valve prosthesis: localization of embolized disc by computerized axial tomography.

Science.gov (United States)

Larrieu, A J; Puglia, E; Allen, P

1982-08-01

The case of a patient who survived strut fracture and embolization of a Björk-Shiley mitral prosthetic disc is presented. Prompt surgical treatment was directly responsible for survival. In addition, computerized axial tomography of the abdomen aided in localizing and retrieving the embolized disc, which was lodged at the origin of the superior mesenteric artery. A review of similar case reports from the literature supports our conclusions that the development of acute heart failure and absent or muffled prosthetic heart sounds in a patient with a Björk-Shiley prosthetic heart valve inserted prior to 1978 should raise the possibility of valve dysfunction and lead to early reoperation.

Vector coherent state representations of SO5 contains SU2 + SU2 contains U1 + U1 and SO5 contains U1 + U1

International Nuclear Information System (INIS)

Pan Feng

1991-01-01

VCS representations of SO 5 contains SU 2 + SU 2 contains U 1 + U 1 and SO 5 contains U 1 + U 1 are discussed. Reduced matrix elements for SO 5 contains SU 2 + SU 2 are derived. The multiplicity of a weight for SO 5 is determined by using the K-matrix technique

Björk-Shiley strut fracture and disc escape: literature review and a method of disc retrieval.

Science.gov (United States)

Hendel, P N

1989-03-01

Embolization of a prosthetic valve poppet is a rare but life-threatening event. It was reported sporadically before the introduction of the Björk-Shiley 70-degree convexoconcave prosthesis in 1980. Since that time, there have been a large number of reported mechanical failures with disc escape. The rate for the 29-mm to 33-mm mitral valves is estimated as 5.2%. In 29 of 35 patients (including the 2 presented here) in whom the site of disc lodgment could be determined, the disc was in the descending or abdominal aorta. Fifteen of these patients died. Six survivors had the disc removed at the same operation and 6 at a later operation. In 2 patients, the disc was not removed. In 2 patients in whom the disc was not removed initially, it was thought to contribute to postoperative complications. Two more cases of structural failure of the Björk-Shiley convexoconcave prosthesis are presented. A transpericardial approach to the descending aorta on bypass is described. It allows easy removal of the disc and eliminates the need for a second operation.

Integrable quadratic classical Hamiltonians on so(4) and so(3, 1)

International Nuclear Information System (INIS)

Sokolov, Vladimir V; Wolf, Thomas

2006-01-01

We investigate a special class of quadratic Hamiltonians on so(4) and so(3, 1) and describe Hamiltonians that have additional polynomial integrals. One of the main results is a new integrable case with an integral of sixth degree

Adaptação transcultural e análise da confiabilidade do Southampton Assessment of Mobility para avaliar a mobilidade de idosos brasileiros com demência Cross-cultural adaptation and reliability analyses of the Southampton Assessment of Mobility to assess mobility of Brazilian elderly with dementia

Directory of Open Access Journals (Sweden)

Leani Souza Máximo Pereira

2006-10-01

Full Text Available O objetivo deste trabalho foi adaptar transculturalmente o instrumento Southampton Assessment of Mobility e testar sua confiabilidade intra e interexaminadores para idosos brasileiros da comunidade, com demência, classificados quanto à gravidade pelo Clinical Dementia Rating. O instrumento adaptado foi aplicado em uma amostra de 107 idosos (76,26 anos ± 7,59; 27,1% homens, 72,9% mulheres com diagnóstico clínico de demência dado pelo serviço de geriatria do Centro de Referência em Atenção ao Idoso Professor Caio Benjamin Dias, do Estado de Minas Gerais, Hospital das Clínicas, Universidade Federal de Minas Gerais, Minas Gerais, Brasil. Dentre os avaliados, 39 (76,85 anos ± 7,75; 23,1% homens, 76,9% mulheres foram aleatorizados para avaliação da confiabilidade. A ferramenta estatística foi o teste kappa. Os resultados mostraram que a confiabilidade intra e interexaminadores foram, respectivamente: demência leve 0,89-0,86; moderada 0,79-0,85 e grave 0,53-0,49. O instrumento adaptado demonstrou ser aplicável à população alvo e demonstrou ter confiabilidade "quase perfeita" para demência leve e moderada. Para a demência grave os índices de confiabilidade foram "moderados".The objective was to perform a cross-cultural adaptation of the Southampton Assessment of Mobility and test its intra- and inter-examiner reliability for Brazilian elderly living in the community and diagnosed with dementia, with severity classified according to the Clinical Dementia Rating. The instrument was applied to 107 elderly (76.26 years ± 7.59; 27.1% males, 72.9% females diagnosed with dementia by the geriatric clinic at the university hospital of the Federal University in Minas Gerais. From the initial group, a randomized sample of 39 elderly (76.85 years ± 7.75; 23.1% males, 76.9% females was selected for the reliability tests. The statistical tool was the kappa test. The respective reliability indices were: mild dementia ­ 0.89-0.86; moderate �

Darkness in El Dorado: human genetics on trial

Indian Academy of Sciences (India)

Unknown

Human Genetics Research Division, University of Southampton, Southampton SO16 6YD, UK. A recent ..... advice' he acknowledges in his book (p. xviii), leading to revision .... Venezuelan government, held his team back from giving medical ...

The power and statistical behaviour of allele-sharing statistics when ...

Indian Academy of Sciences (India)

Unknown

3Human Genetics Division, School of Medicine, University of Southampton, Southampton SO16 6YD, UK. Abstract ... that the statistic S-#alleles gives good performance for recessive ... (H50) of the families are linked to the single marker. The.

Detailed molecular epidemiology of Chlamydia trachomatis in the population of Southampton attending the genitourinary medicine clinic in 2012-13 reveals the presence of long established genotypes and transitory sexual networks.

Science.gov (United States)

Labiran, Clare; Rowen, David; Clarke, Ian Nicholas; Marsh, Peter

2017-01-01

Chlamydia trachomatis is the most common sexually transmitted infection (STI) in England. Our objective was to perform a detailed survey of the molecular epidemiology of C. trachomatis in the population of Southampton UK attending the genitourinary medicine clinic (GUM) to seek evidence of sexual network activity. Our hypothesis was that certain genotypes can be associated with specific demographic determinants. 380 positive samples were collected from 375 C. trachomatis positive GUM attendees out of the 3118 who consented to be part of the survey. 302 of the positive samples were fully genotyped. All six of the predominant genotypes possessed ompA locus type E. One ward of Southampton known to contain a large proportion of students had a different profile of genotypes compared to other areas of the city. Some genotypes appeared embedded in the city population whilst others appeared transient. Predominant circulating genotypes remain stable within a city population whereas others are sporadic. Sexual networks could be inferred but not conclusively identified using the data from this survey.

A first principles study of Nd doped cubic LaAlO{sub 3} perovskite: mBJ+U study

Energy Technology Data Exchange (ETDEWEB)

Sandeep, E-mail: sndp.chettri@gmail.com [Dept. of Physics, Mizoram University, Aizawl 796004 (India); Rai, D.P. [Dept. of Physics, Pachhunga University College, Aizawl, Mizoram 796001 (India); Shankar, A. [Department of Physics, University of North Bengal, Darjeeling 734013 (India); Ghimire, M.P. [Condensed Matter Physics Research Center, Butwal-13, Rupandehi, Lumbini (Nepal); Khenata, R. [Laboratoire de Physique Quantique et de Modlisation Mathmatique (LPQ3M), Dpartement de Technologie, Universit de Mascara, 29000 Mascara (Algeria); Thapa, R.K. [Dept. of Physics, Mizoram University, Aizawl 796004 (India)

2016-11-01

The structural, electronic and magnetic properties of Nd-doped Rare earth aluminate, La{sub 1−x}Nd{sub x}AlO{sub 3} (x=0–100%) are studied using the full potential linearized augmented plane-wave (FP-LAPW) method within the density functional theory. The effects of Nd substitution in LaAlO{sub 3} are studied using super-cell calculations. The electronic structures were computed using modified Beck Johnson (mBJ) potential based approximation with the inclusion of Coulomb energy (U) for Nd-4f state electrons. The La{sub 1−x}Nd{sub x}AlO{sub 3} may possess half metallic behavior on Nd doping with finite density of states at E{sub F}. The direct and indirect band gaps were studied as a function of Nd concentration in LaAlO{sub 3}. The calculated magnetic moments in La{sub 1−x}Nd{sub x}AlO{sub 3} were found to arise mainly from the Nd-4f state electrons. A probable half-metallic nature is suggested for these systems with supportive integral magnetic moments and high spin polarized electronic structures in these doped cases at E{sub F}. The controlled decrease in band gap with increase in concentration of Nd doping is a suitable technique for harnessing useful spintronic and magnetic devices. - Highlights: • Electronic and magnetic properties of La{sub 1−x}Nd{sub x}AlO{sub 3} to study the effect of doping (x=0%, 25%, 50%, 75% and 100%) is carried out using DFT. • Theoretically calculated U was used in the mBJ+U approximation in order to stress accuracy in band-gap determination along with electron correlation effects in rare earth ions. • A high DOS at E{sub F} for certain doping concentrations in one spin channel with insulting DOS in the other channel supported their probable use as spintronic devices. • The change in doping concentration was found suitable for rare earth aluminates for desirable properties through band-gap tuning.

Five-year results after valve replacement with the Björk-Shiley 70 degrees convexo-concave prosthesis.

Science.gov (United States)

Koldsland, S; Svennevig, J L; Abdelnoor, M; Aas, H; Semb, G

1992-01-01

In the 18 months up to July 1983, 120 Björk-Shiley convexo-concave prostheses with 70 degrees opening angle were implanted in 47 women and 61 men aged 19-78 (mean 58.6) years. The prosthetic valves were aortic in 65 cases, mitral in 23 and both aortic and mitral in 20 cases. Emergency operation was required in ten cases, and concomitant surgery was performed in 43 (39.8%). The early mortality was 5.5%. A follow-up study, comprising 498 patient years, revealed 73.1% 5-year survival. There were three mechanical failures of prosthesis, in one of which re-replacement was successful. Elective prosthesis replacement was performed in four other cases judged to be at high risk of strut fracture.

Gravitating SO (3,1) gauge field

International Nuclear Information System (INIS)

Aragone, C.; Restuccia, A.

1978-01-01

In this article, we postulate SO (3,1) as a local symmetry of any relativistic theory. This is equivalent to assuming the existence of a gauge field associated with this noncompact group. This SO (3,1) gauge field is the spinorial affinity which usually appears when we deal with weighting spinors, which, as is well known, cannot be coupled to the metric tensor field. Furthermore, according to the integral approach to gauge fields proposed by Yang, it is also recognized that in order to obtain models of gravity we have to introduce ordinary affinities as the gauge field associated with GL (4) (the local symmetry determined by the parallel transport). Thus if we assume both GL (4) and SO (3,1) as local independent symmetries we are led to analyze the dynamical gauge system constituted by the Einstein field interacting with the SO (3,1) Weyl--Yang gauge field. We think this system is a possible model of strong gravity. Once we give the first-order action for this Einstein--Weyl--Yang system we study whether the SO (3,1) gauge field could have a tetrad associated with it. It is also shown that both fields propagate along a unique characteristic cone. Algebraic and differential constraints are solved when the system evolves along a null coordinate. The unconstrained expression for the action of the system is found working in the Bondi gauge. That allows us to exhibit an explicit expression of the dynamical generator of the system. Its signature turns out to be nondefinite, due to the nondefinite contribution of the Weyl--Yang field, which has the typical spinorial behavior. A conjecture is made that such an unpleasant feature could be overcome in the quantized version of this model

An Improved dem Construction Method for Mudflats Based on BJ-1 Small Satellite Images: a Case Study on Bohai Bay

Science.gov (United States)

Wu, D.; Du, Y.; Su, F.; Huang, W.; Zhang, L.

2018-04-01

The topographic measurement of muddy tidal flat is restricted by the difficulty of access to the complex, wide-range and dynamic tidal conditions. Then the waterline detection method (WDM) has the potential to investigate the morph-dynamics quantitatively by utilizing large archives of satellite images. The study explores the potential for using WDM with BJ-1 small satellite images to construct a digital elevation model (DEM) of a wide and grading mudflat. Three major conclusions of the study are as follows: (1) A new intelligent correlating model of waterline detection considering different tidal stages and local geographic conditions was explored. With this correlative algorithm waterline detection model, a series of waterlines were extracted from multi-temporal remotely sensing images collected over the period of a year. The model proved to detect waterlines more efficiently and exactly. (2) The spatial structure of elevation superimposing on the points of waterlines was firstly constructed and a more accurate hydrodynamic ocean tide grid model was used. By the newly constructed abnormal hydrology evaluation model, a more reasonable and reliable set of waterline points was acquired to construct a smoother TIN and GRID DEM. (3) DEM maps of Bohai Bay, with a spatial resolution of about 30 m and height accuracy of about 0.35 m considering LiDAR and 0.19 m considering RTK surveying were constructed over an area of about 266 km2. Results show that remote sensing research in extremely turbid estuaries and tidal areas is possible and is an effective tool for monitoring the tidal flats.

Tracing the strength of the southwest monsoon using boron isotopes in the eastern Arabian Sea

Digital Repository Service at National Institute of Oceanography (India)

Naik, S.S.; Naidu, P.D.; Foster, G.L.; Martínez-Boti, M.A.

. Foster and Miguel A. Martínez-Botí Ocean and Earth Science, National Oceanography Centre Southampton, University of Southampton, SO14 3ZH,UK Corresponding author: S. S. Naik, CSIR-National Institute of Oceanography, Goa 403004, India (sushant... of the foraminifers was determined at the University of Southampton on a Thermo Scientific Neptune MC-ICPMS [see Foster, 2008 and Henehan et al., 2013]. External reproducibility of the MC-ICPMS δ11B data is determined from a relationship between the reproducibility...

The K Domain Mediates Homologous and Heterologous Interactions Between FLC and SVP Proteins of Brassica juncea

Directory of Open Access Journals (Sweden)

Ma Guanpeng

2015-07-01

Full Text Available The transcription factors FLOWERING LOCUS C (FLC and SHORT VEGETATIVE PHASE (SVP can interact to form homologous and heterologous protein complexes that regulate flowering time in Brassica juncea Coss. (Mustard.Previous studies showed that protein interactions were mediated by the K domain, which contains the subdomains K1, K2 and K3. However, it remains unknown how the subdomains mediate the interactions between FLC and SVP. In the present study, we constructed several mutants of subdomains K1–K3 and investigated the mechanisms involved in the heterologous interaction of BjFLC/BjSVP and in the homologous interaction of BjFLC/BjFLC or BjSVP/BjSVP. Yeast two-hybrid and β-Galactosidase activity assays showed that the 19 amino acids of the K1 subdomain in BjSVP and the 17 amino acids of the K1 subdomain in BjFLC were functional subdomains that interact with each other to mediate hetero-dimerization. The heterologous interaction was enhanced by the K2 subdomain of BjSVP protein, but weakened by its interhelical domain L2. The heterologous interaction was also enhanced by the K2 subdomain of BjFLC protein, but weakened by its K3 subdomain. The homologous interaction of BjSVP was mediated by the full K-domain. However, the homologous interaction of BjFLC was regulated only by its K1 and weakened by its K2 and K3 subdomains. The results provided new insights into the interactions between FLC and SVP, which will be valuable for further studies on the molecular regulation mechanisms of the regulation of flowering time in B. juncea and other Brassicaceae.

Overexpression of NPR1 in Brassica juncea Confers Broad Spectrum Resistance to Fungal Pathogens

Directory of Open Access Journals (Sweden)

Sajad Ali

2017-10-01

Full Text Available Brassica juncea (Indian mustard is a commercially important oil seed crop, which is highly affected by many biotic stresses. Among them, Alternaria leaf blight and powdery mildew are the most devastating diseases leading to huge yield losses in B. juncea around the world. In this regard, genetic engineering is a promising tool that may possibly allow us to enhance the B. juncea disease resistance against these pathogens. NPR1 (non-expressor of pathogen-related gene 1 is a bonafide receptor of salicylic acid (SA which modulates multiple immune responses in plants especially activation of induced and systemic acquired resistance (SAR. Here, we report the isolation and characterization of new NPR1 homolog (BjNPR1 from B. juncea. The phylogenetic tree constructed based on the deduced sequence of BjNPR1 with homologs from other species revealed that BjNPR1 grouped together with other known NPR1 proteins of Cruciferae family, and was nearest to B. napus. Furthermore, expression analysis showed that BjNPR1 was upregulated after SA treatment and fungal infection but not by jasmonic acid or abscisic acid. To understand the defensive role of this gene, we generated B. juncea transgenic lines overexpressing BjNPR1, and further confirmed by PCR and Southern blotting. The transgenic lines showed no phenotypic abnormalities, and constitutive expression of BjNPR1 activates defense signaling pathways by priming the expression of antifungal PR genes. Moreover, BjNPR1 transgenic lines showed enhanced resistance to Alternaria brassicae and Erysiphe cruciferarum as there was delay in symptoms and reduced disease severity than non-transgenic plants. In addition, the rate of disease spreading to uninfected or distal parts was also delayed in transgenic plants thus suggesting the activation of SAR. Altogether, the present study suggests that BjNPR1 is involved in broad spectrum of disease resistance against fungal pathogens.

Reconstructing historical trends in metal input in heavily-disturbed, contaminated estuaries: studies from Bilbao, Southampton Water and Sicily

International Nuclear Information System (INIS)

Cundy, A.B.; Croudace, I.W.; Cearreta, A.; Irabien, M.J.

2003-01-01

Estuaries may be important reservoirs for contaminants as they tend to act as sinks for fine, contaminant-reactive sediments, and, historically, they have acted as centres for industrial and urban development. Analysis of dated sediment cores from these areas may allow historical trends in heavy metal input to be reconstructed, and recent and historical inputs of metal contaminants to be compared. Undisturbed saltmarsh settings have been used widely in the reconstruction of historical trends in metal input as saltmarshes provide a stable, vegetated substrate of dominantly fine sediments, and are less prone to erosion and reworking than adjacent mudflat areas. In comparison, much less research on historical pollution trends has been undertaken at estuarine sites which are prone to severe local disturbance, such as intertidal areas which are routinely dredged or where sedimentary processes have been modified by human activities such as shipping, salt working, port activities, land claim etc. This paper assesses the usefulness of 210 Pb and 137 Cs dating, combined with geochemical studies, in reconstructing historical trends in heavy metal input and sediment accretion in 3 heavily-modified, industrialised estuarine areas in Europe: the Bilbao estuary (Spain), Southampton Water (UK), and the Mulinello estuary (Sicily). Of these sites, only a salt marsh core from the Mulinello estuary provides a high-resolution record of recent heavy metal inputs. In Southampton Water only a partial record of changing metal inputs over time is retained due to land-claim and possible early-diagenetic remobilisation, while at Bilbao the vertical distribution of heavy metals in intertidal flats is mainly controlled by input on reworked sediment particles and variations in sediment composition. Where 137 Cs and 210 Pb distributions with depth allow a chronology of sediment deposition to be established, and early-diagenetic remobilisation has been minimal, mudflat and saltmarsh cores from

Distribution of SO_{2} and so in the Envelope of Vy-Canis Majoris: Insight Into Circumstellar Sulfur Chemistry

Science.gov (United States)

Adande, Gilles; Ziurys, L. M.

2013-06-01

Millimeter wave observations of SO_{2} and SO in the envelope of the O-rich supergiant VY-Canis Majoris have been conducted with the Submillimeter Telescope (SMT) of the Arizona Radio Observatory, between 210 and 290 GHz. A non LTE radiative transfer code has been written to fit the line profile of 22 lines of SO_{2} and 5 transitions of SO, and model their abundance and distribution within the circumstellar envelope. The rotational levels involved span a wide energy range, from 13 cm^{-1} to 104 cm^{-1} for SO_{2}, and 17 to 40 cm^{-1} for SO. The high number of transitions fitted provides strong constraints on the excitation conditions, hydrogen density and kinetic temperatures. The results will be discussed in relation to the formation processes and chemistry of these two species in O-rich molecular envelopes.

Environmental impact of early Sadlermiut settlements at Native Point (Southampton Island, Nunavut, Canada) before the Little Ice Age

Science.gov (United States)

Viehberg, Finn; Pienitz, Reinhard; Plessen, Birgit; Muir, Derek; Wang, Xiaowa

2017-04-01

Several Thule forager groups settled successfully in the Hudson Bay region of the Canadian Arctic starting at ca. AD 1050. First evidence of settlements at Native Point on Southampton Island dates prior to AD 1400 by Sadlermiuts. The village consisted of numerous sod and winter houses which framed a small shallow freshwater body (ca. 20,000 m2). Numerous butchered carcasses of mainly walrus, seal, bowhead whales and caribou remained in the pond and further decayed in the water. Here, we present first results from three short sediment cores taken from the bottom of the settlement pond. Sedimentological, geochemical and micropaleontological analyses show an abrupt change at ca. AD 1500 from pristine aquatic environments to eutrophic conditions. Variation in d15N and d13C of the organic matter suggest that this shift is related to the first butchering activity of Sadlermiuts in the area.

33 CFR 17.05-1 - Gifts.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Gifts. 17.05-1 Section 17.05-1 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL UNITED STATES COAST GUARD GENERAL GIFT FUND Administration § 17.05-1 Gifts. The gifts or bequests may be in money or...

High-Temperature Corrosion of AlCrSiN Film in Ar-1%SO2 Gas

Directory of Open Access Journals (Sweden)

Poonam Yadav

2017-03-01

Full Text Available AlCrSiN film with a composition of 29.1Al-17.1Cr-2.1Si-51.7N in at. % was deposited on a steel substrate by cathodic arc ion plating at a thickness of 1.8 μm. It consisted of nanocrystalline hcp-AlN and fcc-CrN, where a small amount of Si was dissolved. Corrosion tests were carried out at 800 °C for 5–200 h in Ar-1%SO2 gas. The major corrosion reaction was oxidation owing to the high oxygen affinity of Al and Cr in the film. The formed oxide scale consisted primarily of (Al,Cr2O3, within which Fe, Si, and S were dissolved. Even after corrosion for 200 h, the thickness of the scale was about 0.7–1.2 μm, indicating that the film had good corrosion resistance in the SO2-containing atmosphere.

Björk-Shiley convexoconcave valves: susceptibility artifacts at brain MR imaging and mechanical valve fractures.

Science.gov (United States)

van Gorp, Maarten J; van der Graaf, Yolanda; de Mol, Bas A J M; Bakker, Chris J G; Witkamp, Theo D; Ramos, Lino M P; Mali, Willem P T M

2004-03-01

To assess the relationship between heart valve history and susceptibility artifacts at magnetic resonance (MR) imaging of the brain in patients with Björk-Shiley convexoconcave (BSCC) valves. MR images of the brain were obtained in 58 patients with prosthetic heart valves: 20 patients had BSCC valve replacements, and 38 had other types of heart valves. Two experienced neuroradiologists determined the presence or absence of susceptibility artifacts in a consensus reading. Artifacts were defined as characteristic black spots that were visible on T2*-weighted gradient-echo MR images. The statuses of the 20 explanted BSCC valves-specifically, whether they were intact or had an outlet strut fracture (OSF) or a single-leg fracture (SLF)-had been determined earlier. Number of artifacts seen at brain MR imaging was correlated with explanted valve status, and differences were analyzed with nonparametric statistical tests. Significantly more patients with BSCC valves (17 [85%] of 20 patients) than patients with other types of prosthetic valves (18 [47%] of 38 patients) had susceptibility artifacts at MR imaging (P =.005). BSCC valve OSFs were associated with a significantly higher number of artifacts than were intact BSCC valves (P =.01). No significant relationship between SLF and number of artifacts was observed. Susceptibility artifacts at brain MR imaging are not restricted to patients with BSCC valves. These artifacts can be seen on images obtained in patients with various other types of fractured and intact prosthetic heart valves. Copyright RSNA, 2004

21 CFR 17.1 - Scope.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Scope. 17.1 Section 17.1 Food and Drugs FOOD AND... Food, Drug, and Cosmetic Act (the act) authorizing civil money penalties for certain violations of the... trial data bank and section 303(f)(4) of the act authorizing civil money penalties for certain...

AVE0991, a nonpeptide analogue of Ang-(1-7), attenuates aging-related neuroinflammation.

Science.gov (United States)

Jiang, Teng; Xue, Liu-Jun; Yang, Yang; Wang, Qing-Guang; Xue, Xiao; Ou, Zhou; Gao, Qing; Shi, Jian-Quan; Wu, Liang; Zhang, Ying-Dong

2018-04-17

During the aging process, chronic neuroinflammation induced by microglia is detrimental for the brain and contributes to the etiology of several aging-related neurodegenerative diseases such as Alzheimer's disease and Parkinson's disease. As a newly identified axis of renin-angiotensin system, ACE2/Ang-(1-7)/MAS1 axis plays a crucial role in modulating inflammatory responses under various pathological conditions. However, its relationship with aging-related neuroinflammation is less studied so far. In this study, by using SAMP8 mice, an animal model of accelerated aging, we revealed that the neuroinflammation in the aged brain might be attributed to a decreased level of Ang-(1-7). More importantly, we provided evidence that AVE0991, a nonpeptide analogue of Ang-(1-7), attenuated the aging-related neuroinflammation via suppression of microglial-mediated inflammatory response through a MAS1 receptor-dependent manner. Meanwhile, this protective effect might be ascribed to the M2 activation of microglia induced by AVE0991. Taken together, these findings reveal the association of Ang-(1-7) with the inflammatory response in the aged brain and uncover the potential of its nonpeptide analogue AVE0991 in attenuation of aging-related neuroinflammation.

Single leg separation prevalence among explanted Björk-Shiley prosthetic heart valves.

Science.gov (United States)

Blot, William J; Signorello, Lisa B; Cohen, Sarah S; Ibrahim, Michel A

2007-11-01

Björk-Shiley convexo-concave (BSCC) prosthetic heart valves are believed to have been implanted in over 86,000 patients worldwide. Limited data are available on the prevalence of single leg separations (SLS) of the valves' outlet struts, a potential precursor to complete valve fracture. Data maintained by the manufacturer, including results of examinations for SLS in explanted valves, were merged with available information on the characteristics of the valve. The prevalence of SLS in the examined valves was calculated according to valve angle, size, position, and study. Among 343 examined valves, the overall prevalence of SLS was 8.2%, but this varied significantly by valve size, being three-fold higher among 29+ mm valves than among smaller valves, with statistically non-significantly higher prevalences among mitral than aortic, and among 70 degrees than 60 degrees valves. By applying the size, position and angle-specific SLS prevalences to the worldwide valve distribution, it is estimated that SLS may be present in 6.8% (95% confidence limits 4.1-9.4%) of all BSCC valves. These findings suggest that SLS may affect between 820 and 1,880 of the almost 20,000 BSCC valves among surviving patients worldwide. Such estimates help frame the context for potential patient screenings, should imaging and acoustic techniques to detect SLS become available.

Role of PTEN in the Tumor Microenvironment

Science.gov (United States)

2009-06-01

themselves, as well as the matrix that holds these cells together. Because the entire system is so complex, we plan to study how the Pten gene behaves as...Rev. 17, 501-519 8. Gould HJ, Sutton BJ. (2008). IgE in allergy and asthma today. Nat. Rev. Immunol. 8, 205-217. 9. Granucci F, Petralia F, Urbano M

SO(9,1) invariant matrix formulation of a supermembrane

International Nuclear Information System (INIS)

Fujikawa, K.; Okuyama, K.

1998-01-01

An SO(9,1) invariant formulation of an 11-dimensional supermembrane is presented by combining an SO(10,1) invariant treatment of reparametrization symmetry with an SO(9,1) invariant θ R = 0 gauge of κ-symmetry. The Lagrangian thus defined consists of polynomials in dynamical variables (up to quartic terms in X μ and up to the eighth power in θ), and reparametrization BRST symmetry is manifest. The area preserving diffeomorphism is consistently incorporated and the area preserving gauge symmetry is made explicit. The SO(9,1) invariant theory contains terms which cannot be induced by a naive dimensional reduction of higher-dimensional supersymmetric Yang-Mills theory. The SO(9,1) invariant Hamiltonian and the generator of area preserving diffeomorphism together with the supercharge are matrix regularized by applying the standard procedure. As an application of the present formulation, we evaluate the possible central charges in superalgebra both in the path integral and in the canonical (Dirac) formalism, and we find only the two-form charge [ X μ , X ν ]. (orig.)

SO(14) unification of 3+1 families

International Nuclear Information System (INIS)

Karadayi, H.R.

1982-03-01

It is shown that the unification of 3+1 families is possible within the framework of 64 dimensional spinor representation of SO(14). Special care is given for a description without the heavy excess fermions such as conjugate and mirror or completely exotic fermions of some family unification schemes. With the aid of an intrinsic ''L-R Asymmetry'' mechanism which we proposed recently, the conventional strong and electromagnetic interactions are obtained for all four families by concentrating only on the symmetry breaking SO(14) → SU(3)sub(c) x U(1)sub(e.m.). However, the conventional weak interactions of the first three families are obtained just as in the standard SU(2)sub(L) x U(1)sub(Y) model, while those of the prescribed fourth family show certain differences. This is what we mean by 3+1 family unification. All vector particles mediating strong, electromagnetic and weak interactions which are the subjects of present phenomenological tests are specified among the vector fields of SO(14) and their mass mechanisms leading to a consistent description of this low-energy phenomenology are studied with the aid of the Higgs multiplets 14, 364, 1716 and 2002 of SO(14). Moreover, the fermion mass mechanisms are considered with the aid of these scalar multiplets and the contributions from these scalars to the vector and fermion masses are explicitly calculated. All these calculations are carried out in the new mathematical technique for the Lie algebra representations which we introduced recently. (author)

Nd(NH2SO3)(SO4) . 1.5 H2O: a non-centrosymmetric amidosulfate-sulfate of neodymium

International Nuclear Information System (INIS)

Wickleder, M.S.

2005-01-01

The thermal decomposition of Nd(NH 2 SO 3 ) 3 . 2 H 2 O in a closed tube leads to violet single crystals of Nd(NH 2 SO 3 )(SO 4 ) . 1.5 H 2 O. The compound crystallizes with the space group P1 (Z = 2, a = 689.2, b = 691.4, c = 962.0 pm, α = 109.64, β = 97.00, γ = 109.62 ). The triclinic unit cell can be transformed into the respective bodycentered setting I1 (Z = 2, a = 977.9, b = 795.6, c = 1113.0 pm, α = 90.69, β = 115.06, γ = 88.98 ) leading to a nearly monoclinic unit cell for the compound. In the crystal structure of Nd(NH 2 SO 3 )(SO 4 ) . 1.5 H 2 O two Nd 3+ ions are present. Nd(1) 3+ is coordinated by four NH 2 SO 3 - and two SO 4 2- ions, and one H 2 O molecule. Owing to the chelating attack of the sulfate groups, the CN is nine. Nd(2) 3+ is surrounded by four monodentate SO 4 2- and two NH 2 SO 3 - groups. Two H 2 O ligands fill up the coordination sphere and lead to a CN of eight. The linkage of the polyhedra leads to a three-dimensional network. (orig.)

Seasonal variability of the mixed layer in the central Bay of Bengal and associated changes in nutrients and chlorophyll

Digital Repository Service at National Institute of Oceanography (India)

Narvekar, J.; PrasannaKumar, S.

Indian Ocean during 1977 and 1979 summer monsoon seasons, Indian Journal of Marine Sciences 17, 258-264. Josey, S. A., Kent, E. C. and Taylor, P. K., 1998. The Southampton Oceanography Centre (SOC) Ocean - Atmosphere Heat, Momentum... and Freshwater Flux Atlas, Southampton Oceanography Centre Report No. 6, 30 pp. plus figs. Levitus, S., 1982. Climatological Atlas of the World Ocean, NOAA Professional paper 13, National Oceanic and Atmospheric Administration, Rockville Md, 173...

SO(2 ell + 1) contains ? contains SO/sub L/(3) in group chains for L-S coupling

International Nuclear Information System (INIS)

Wu, Z.Y.; Sun, C.P.; Zhang, L.; Li, B.F.

1986-01-01

Racah pointed out in his 1949 article that there exists a proper subgroup of SO(7) which properly contains SO/sub L/(3) in group chains for L-S coupling. This paper investigates whether such a proper subgroup exists for SO(2l + 1) which contains SO/sub L/(3) for an arbitrary l and concludes that this subgroup exists only for the case in which l is equal to 3. 4 references

Spectrophotometric Determination of the CuSO4 Soret Coefficient of a CuSO4-H2O Binary Solutions System

Directory of Open Access Journals (Sweden)

Ijang Rohman

2010-06-01

Full Text Available A spectrophotometric technique for the determination of the CuSO4 soret coefficient of a CuSO4-water binary solutions system is described. A short column of solutions is placed between horizontal metal plates that are held at different temperatures. The subsequent changes in composition due to thermal diffusion are followed by monitoring changes of transmittance near the end of the solutions column. In water, CuSO4 diffuses to the warm compartment of column. The soret coefficient of CuSO4 0.0254 molal in water agrees with the appropriate theory, i.e. 17.60x10-3 °C-1 on the average.

Preparation and provisional certification of NBL Spectrographic Impurity Standards, CRM 123 (1-7) and 124 (1-7)

International Nuclear Information System (INIS)

Santoliquido, P.M.

1983-09-01

This report describes the design, production, and provisional certification of two new certified reference materials (CRMs): CRM No. 123 (1-7), U 3 O 8 containing 18 trace elements, and CRM No. 124 (1-7), U 3 O 8 containing 24 trace elements. The elements to be included and concentrations to be used were decided on the basis of information gathered from users of a previous CRM of this type, CRM No. 98 (1-7). The new CRMs were prepared by the addition of trace elements to high purity U 3 O 8 . Provisional certification was accomplished by an interlaboratory program in which four different laboratories analyzed the materials by carrier distillation dc arc emission spectrography

1/4-BPS M-theory bubbles with SO(3) x SO(4) symmetry

International Nuclear Information System (INIS)

Kim, Hyojoong; Kim, Kyung Kiu; Kim, Nakwoo

2007-01-01

In this paper we generalize the work of Lin, Lunin and Maldacena on the classification of 1/2-BPS M-theory solutions to a specific class of 1/4-BPS configurations. We are interested in the solutions of 11 dimensional supergravity with SO(3) x SO(4) symmetry, and it is shown that such solutions are constructed over a one-parameter familiy of 4 dimensional almost Calabi-Yau spaces. Through analytic continuations we can obtain M-theory solutions having AdS 2 x S 3 or AdS 3 x S 2 factors. It is shown that our result is equivalent to the AdS solutions which have been recently reported as the near-horizon geometry of M2 or M5-branes wrapped on 2 or 4-cycles in Calabi-Yau threefolds. We also discuss the hierarchy of M-theory bubbles with different number of supersymmetries

SAJAA SO Orig res1 17-22 new

African Journals Online (AJOL)

Studio G5

Department of Psychology, University of the Free State, Bloemfontein ... The role of psychosocial variables in physician judgement of ... Depression and anxiety symptoms predicted factors played in patients' pain experiences. Health ... Mental health, emotional ..... distress are not predictive of positive functional judgements.

17 CFR 39.1 - Scope.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Scope. 39.1 Section 39.1 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION DERIVATIVES CLEARING ORGANIZATIONS § 39.1 Scope. The provisions of this part apply to any derivatives clearing organization as defined...

17 CFR 240.15c1-7 - Discretionary accounts.

Science.gov (United States)

2010-04-01

... transactions or purchase or sale which are excessive in size or frequency in view of the financial resources... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-7 Discretionary...

Chemoselective synthesis of sialic acid 1,7-lactones.

Science.gov (United States)

Allevi, Pietro; Rota, Paola; Scaringi, Raffaella; Colombo, Raffaele; Anastasia, Mario

2010-08-20

The chemoselective synthesis of the 1,7-lactones of N-acetylneuraminic acid, N-glycolylneuraminic acid, and 3-deoxy-d-glycero-d-galacto-nononic acid is accomplished in two steps: a simple treatment of the corresponding free sialic acid with benzyloxycarbonyl chloride and a successive hydrogenolysis of the formed 2-benzyloxycarbonyl 1,7-lactone. The instability of the 1,7-lactones to protic solvents has been also evidenced together with the rationalization of the mechanism of their formation under acylation conditions. The results permit to dispose of authentic 1,7-sialolactones to be used as reference standards and of a procedure useful for the preparation of their isotopologues to be used as inner standards in improved analytical procedures for the gas liquid chromatography-mass spectrometry (GLC-MS) analysis of 1,7-sialolactones in biological media.

31 CFR 1.7 - Fees for services.

Science.gov (United States)

2010-07-01

... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Fees for services. 1.7 Section 1.7 Money and Finance: Treasury Office of the Secretary of the Treasury DISCLOSURE OF RECORDS Freedom of... Department shall charge for search time at the salary rate(s) (basic pay plus 16 percent) of the employee(s...

Enhanced expression of Ang-(1-7 during pregnancy

Directory of Open Access Journals (Sweden)

Brosnihan K.B.

2004-01-01

Full Text Available Pregnancy is a physiological condition characterized by a progressive increase of the different components of the renin-angiotensin system (RAS. The physiological consequences of the stimulated RAS in normal pregnancy are incompletely understood, and even less understood is the question of how this system may be altered and contribute to the hypertensive disorders of pregnancy. Findings from our group have provided novel insights into how the RAS may contribute to the physiological condition of pregnancy by showing that pregnancy increases the expression of both the vasodilator heptapeptide of the RAS, angiotensin-(1-7 [Ang-(1-7], and of a newly cloned angiotensin converting enzyme (ACE homolog, ACE2, that shows high catalytic efficiency for Ang II metabolism to Ang-(1-7. The discovery of ACE2 adds a new dimension to the complexity of the RAS by providing a new arm that may counter-regulate the activity of the vasoconstrictor component, while amplifying the vasodilator component. The studies reviewed in this article demonstrate that Ang-(1-7 increases in plasma and urine of normal pregnant women. In preeclamptic subjects we showed that plasma Ang-(1-7 was suppressed as compared to the levels found in normal pregnancy. In addition, kidney and urinary levels of Ang-(1-7 were increased in pregnant rats coinciding with the enhanced detection and expression of ACE2. These findings support the concept that in normal pregnancy enhanced ACE2 may counteract the elevation in tissue and circulating Ang II by increasing the rate of conversion to Ang-(1-7. These findings provide a basis for the physiological role of Ang-(1-7 and ACE2 during pregnancy.

The spin-dependent structure function g1 of the deuteron

International Nuclear Information System (INIS)

Bueltmann, S.

1996-01-01

Results on the spin-dependent structure function g 1 d of the deuteron measured by the Spin Muon Collaboration at CERN are presented. They are based on deep-inelastic scattering of 190 GeV polarized muons off a polarized deuteron target in the kinematic range of 0.003 ≤ x Bj ≤ 0.7 and 1 GeV 2 ≤ Q 2 ≤ 60 GeV 2 . The structure function is found to be negative for small values of x Bj , while the proton structure function g 1 p measured earlier by the SMC is positive over the whole x Bj -range. The Bjorken sum rule is in good agreement with the first moments of the structure functions, while the Ellis-Jaffe sum rule is violated by more than three standard deviations for the deuteron measurement. (author)

26 CFR 1.381(c)(17)-1 - Deficiency dividend of personal holding company.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Deficiency dividend of personal holding company. 1.381(c)(17)-1 Section 1.381(c)(17)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(17)-1...

Symmetry breaking of SO(10) and constraints on Higgs potential, (1)

International Nuclear Information System (INIS)

Yasue, Masaki.

1980-08-01

The symmetry breaking of SO(10) is studied in the tree approximation of the potential for an adjoint (45) representation and a spinorial (16) representation. The potential can break SO(10) down to SU(3)sub(c) x SU(2)sub(L) x U(1). It is not allowed to break SO(10) down to SU(3)sub(c) x U(1)sub(em) via SU(3)sub(c) x SU(2)sub(L) x U(1) even in the presence of a cubic (16) (16*) (45) coupling. Instead, SU(3) x U(1) comes from SU(4) x U(1). The masses for the physical Higgs scalars are calculated in SU(3)sub(c) x SU(2)sub(L) x U(1). The dynamically allowed region of the vacuum expectation values of the (45) is found to be strongly restricted. As a result, SO(6) and SO(4) cannot show up in the course of the breaking. (author)

Cosmic ray observations deep underground and further analysis of the evidence for the production of new particles

International Nuclear Information System (INIS)

Krishnaswamy, M.R.; Menon, M.G.K.; Narasimham, V.S.; Ito, N.; Kawakami, S.; Miyake, S.

1976-01-01

In a cosmic ray experiment at a depth of 7000 kg/cm 2 three clear new particle events are found, out of a total of 17 events, in which the zenith angle of the penetrating particles is greater than 50 0 , and which have so far been identified as arising from neutrino interactions. The new heavy particles, charged or neutral, must have had low momenta to be consistent which the large opening angles of their decay products. There exists so far no observation of these Kolar events in accelerator experiments with neutrinos. (BJ) [de

17 CFR 270.17g-1 - Bonding of officers and employees of registered management investment companies.

Science.gov (United States)

2010-04-01

... employees of registered management investment companies. 270.17g-1 Section 270.17g-1 Commodity and... ACT OF 1940 § 270.17g-1 Bonding of officers and employees of registered management investment companies. (a) Each registered management investment company shall provide and maintain a bond which shall...

Detection of transient infrared absorption of SO3 and 1,3,2-dioxathietane-2,2-dioxide [cyc-(CH2)O(SO2)O] in the reaction CH2OO+SO2

Science.gov (United States)

Wang, Yi-Ying; Dash, Manas Ranjan; Chung, Chao-Yu; Lee, Yuan-Pern

2018-02-01

We recorded time-resolved infrared absorption spectra of transient species produced on irradiation at 308 nm of a flowing mixture of CH2I2/O2/N2/SO2 at 298 K. Bands of CH2OO were observed initially upon irradiation; their decrease in intensity was accompanied by the appearance of an intense band at 1391.5 cm-1 that is associated with the degenerate SO-stretching mode of SO3, two major bands of HCHO at 1502 and 1745 cm-1, and five new bands near >1340, 1225, 1100, 940, and 880 cm-1. The band near 1340 cm-1 was interfered by absorption of SO2 and SO3, so its band maximum might be greater than 1340 cm-1. SO3 in its internally excited states was produced initially and became thermalized at a later period. The rotational contour of the band of thermalized SO3 agrees satisfactorily with the reported spectrum of SO3. These five new bands are tentatively assigned to an intermediate 1,3,2-dioxathietane-2,2-dioxide [cyc-(CH2)O(SO2)O] according to comparison with anharmonic vibrational wavenumbers and relative IR intensities predicted for this intermediate. Observation of a small amount of cyc-(CH2)O(SO2)O is consistent with the expected reaction according to the potential energy scheme predicted previously. SO3+HCHO are the major products of the title reaction. The other predicted product channel HCOOH+SO2 was unobserved and its branching ratio was estimated to be <5%.

Resveratrol Induced Premature Senescence Is Associated with DNA Damage Mediated SIRT1 and SIRT2 Down-Regulation.

Directory of Open Access Journals (Sweden)

Mehtap Kilic Eren

Full Text Available The natural polyphenolic compound resveratrol (3,4,5-trihydroxy-trans-stilbene has broad spectrum health beneficial activities including antioxidant, anti-inflammatory, anti-aging, anti-cancer, cardioprotective, and neuroprotective effects. Remarkably, resveratrol also induces apoptosis and cellular senescence in primary and cancer cells. Resveratrol's anti-aging effects both in vitro and in vivo attributed to activation of a (NAD-dependent histone deacetylase family member sirtuin-1 (SIRT1 protein. In mammals seven members (SIRT1-7 of sirtuin family have been identified. Among those, SIRT1 is the most extensively studied with perceptive effects on mammalian physiology and suppression of the diseases of aging. Yet no data has specified the role of sirtuins, under conditions where resveratrol treatment induces senescence. Current study was undertaken to investigate the effects of resveratrol in human primary dermal fibroblasts (BJ and to clarify the role of sirtuin family members in particular SIRT1 and SIRT2 that are known to be involved in cellular stress responses and cell cycle, respectively. Here, we show that resveratrol decreases proliferation of BJ cells in a time and dose dependent manner. In addition the increase in senescence associated β-galactosidase (SA-β-gal activity and methylated H3K9-me indicate the induction of premature senescence. A significant increase in phosphorylation of γ-H2AX, a surrogate of DNA double strand breaks, as well as in levels of p53, p21CIP1 and p16INK4A is also detected. Interestingly, at concentrations where resveratrol induced premature senescence we show a significant decrease in SIRT1 and SIRT2 levels by Western Blot and quantitative RT-PCR analysis. Conversely inhibition of SIRT1 and SIRT2 via siRNA or sirtinol treatment also induced senescence in BJ fibroblasts associated with increased SA-β-gal activity, γ-H2AX phosphorylation and p53, p21CIP1 and p16INK4A levels. Interestingly DNA damaging

Angiotensin-(1-7): Beyond the Cardio-Renal Actions

DEFF Research Database (Denmark)

Passos-Silva, Danielle G; Verano-Braga, Thiago; Santos, Robson AS

2013-01-01

and lipolysis while decreasing insulin resistance and dyslipidemia. Ang-(1-7) is also able to improve cerebroprotection against ischemic stroke, besides its effects on learning and memory. The reproductive system can also be affected by Ang-(1-7) treatment, with enhanced ovulation, spermatogenesis and sexual...... downstream effectors such as NO, FOXO1 and COX2. Through these mechanisms, Ang-(1-7) is able to improve pathological conditions such as fibrosis and inflammation in organs such as lungs, liver and kidney. In addition, this heptapeptide has positive effects in metabolism, increasing the glucose uptake...

Dicty_cDB: Contig-U15060-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 000227 |pid:none) Bacillus cereus Q1, complete ge... 114 3e-23 B83991( B83991 ) glycolate oxidase subunit BH2730 [imported...ana interm... 56 2e-15 5 ( AF211126 ) Carsonella ruddii natural-host Bactericera cocker....psnkfvpqrlfqq*fvf tiqrkln*vllgnqvkvl*vnsqvqwlksifitfvplisrmfvslslvskvqrrl*isie lqfsissprmlplv*vlllvklgpkkdmi... la... 1074 0.0 1 ( AB000109 ) Dictyostelium discoideum mitochondrial DNA, compl... 1074 0.0 1 ( BJ412759 ) Dictyosteli...7, 3' ... 731 0.0 1 ( DQ336395 ) Dictyostelium citrinum mitochondrion, complete ge... 456 0.0 3 ( BJ387435 ) Dictyosteli

17 CFR 240.17d-1 - Examination for compliance with applicable financial responsibility rules.

Science.gov (United States)

2010-04-01

... cooperation and coordination among self-regulatory organizations, and the development of a national market... with applicable financial responsibility rules. 240.17d-1 Section 240.17d-1 Commodity and Securities... financial responsibility rules. (a) Where a member of SIPC is a member of more than one self-regulatory...

106-17 Telemetry Standards Chapter 1

Science.gov (United States)

2017-07-01

Telemetry Standards, RCC Standard 106-17 Chapter 1, July 2017 1-1 CHAPTER 1 Introduction The Telemetry Standards address the here-to-date...for Federal Radio Frequency Management . Copies of that manual may be obtained from: Executive Secretary, Interdepartmental Radio Advisory Committee

Discovery of a novel canine respiratory coronavirus support genetic recombination among betacoronavirus1.

Science.gov (United States)

Lu, Shuai; Wang, Yanqun; Chen, Yingzhu; Wu, Bingjie; Qin, Kun; Zhao, Jincun; Lou, Yongliang; Tan, Wenjie

2017-06-02

Although canine respiratory coronavirus (CRCoV) is an important respiratory pathogen that is prevalent in many countries, only one complete genome sequence of CRCoV (South Korea strain K37) has been obtained to date. Genome-wide analyses and recombination have rarely been conducted, as small numbers of samples and limited genomic characterization have previously prevented further analyses. Herein, we report a unique CRCoV strain, denoted strain BJ232, derived from a CRCoV-positive dog with a mild respiratory infection. Phylogenetic analysis based on complete genome of all available coronaviruses consistently show that CRCoV BJ232 is most closely related to human coronavirus OC43 (HCoV-OC43) and BCoV, forming a separate clade that split off early from other Betacoronavirus 1. Based on the phylogenetic and SimPlot analysis we propose that CRCoV-K37 was derived from genetic recombination between CRCoV-BJ232 and BCoV. In detail, spike (S) gene of CRCoV-K37 clustered with CRCoV-BJ232. However orf1ab, membrane (M) and nucleocapsid (N) genes were more related to Bovine coronavirus (BCoV) than CRCoV-B232. Molecular epidemic analysis confirmed the prevalence of CRCoV-BJ232 lineage around the world for a long time. Recombinant events among Betacoronavirus 1 may have implications for CRCoV transmissibility. All these findings provide further information regarding the origin of CRCoV. Copyright © 2017. Published by Elsevier B.V.

Mechanistic Scrutiny Identifies a Kinetic Role for Cytochrome b5 Regulation of Human Cytochrome P450c17 (CYP17A1, P450 17A1.

Directory of Open Access Journals (Sweden)

Alexandr N Simonov

Full Text Available Cytochrome P450c17 (P450 17A1, CYP17A1 is a critical enzyme in the synthesis of androgens and is now a target enzyme for the treatment of prostate cancer. Cytochrome P450c17 can exhibit either one or two physiological enzymatic activities differentially regulated by cytochrome b5. How this is achieved remains unknown. Here, comprehensive in silico, in vivo and in vitro analyses were undertaken. Fluorescence Resonance Energy Transfer analysis showed close interactions within living cells between cytochrome P450c17 and cytochrome b5. In silico modeling identified the sites of interaction and confirmed that E48 and E49 residues in cytochrome b5 are essential for activity. Quartz crystal microbalance studies identified specific protein-protein interactions in a lipid membrane. Voltammetric analysis revealed that the wild type cytochrome b5, but not a mutated, E48G/E49G cyt b5, altered the kinetics of electron transfer between the electrode and the P450c17. We conclude that cytochrome b5 can influence the electronic conductivity of cytochrome P450c17 via allosteric, protein-protein interactions.

Ex-Th17 (Nonclassical Th1) Cells Are Functionally Distinct from Classical Th1 and Th17 Cells and Are Not Constrained by Regulatory T Cells.

Science.gov (United States)

Basdeo, Sharee A; Cluxton, Deborah; Sulaimani, Jamal; Moran, Barry; Canavan, Mary; Orr, Carl; Veale, Douglas J; Fearon, Ursula; Fletcher, Jean M

2017-03-15

Th17 cells are an important therapeutic target in autoimmunity. However, it is known that Th17 cells exhibit considerable plasticity, particularly at sites of autoimmune inflammation. Th17 cells can switch to become ex-Th17 cells that no longer produce IL-17 but produce IFN-γ. These ex-Th17 cells are also called nonclassical Th1 cells because of their ability to produce IFN-γ, similar to Th1 cells; however, it is unclear whether they resemble Th1 or Th17 cells in terms of their function and regulation, and whether they have a pathogenic role in autoimmunity. We compared the phenotypic and functional features of human Th17, Th1, and ex-Th17 cell populations. Our data showed that despite their loss of IL-17 expression, ex-Th17 cells were more polyfunctional in terms of cytokine production than either Th1 or bona fide Th17 cells, and produced increased amounts of proinflammatory cytokines. The proliferative brake on Th17 cells appeared to be lifted because ex-Th17 cells proliferated more than Th17 cells after stimulation. In contrast with Th1 and Th17 cells, ex-Th17 cells were highly resistant to suppression of proliferation and cytokines by regulatory T cells. Finally, we showed that ex-Th17 cells accumulated in the joints of rheumatoid arthritis patients. Taken together, these data indicate that human ex-Th17 cells are functionally distinct from Th1 and Th17 cells, and suggest that they may play a pathogenic role at sites of autoimmunity, such as the rheumatoid arthritis joint where they accumulate. These findings have implications for therapeutic strategies that target IL-17, because these may not inhibit pathogenic ex-Th17 cells. Copyright © 2017 by The American Association of Immunologists, Inc.

SO(4,1) as a structure group of a fibre bundle and SO(3,2) as a relativistic spectrum-generating group

International Nuclear Information System (INIS)

Bohm, A.

1979-12-01

A collective model for hadrons is presented that has two aspects: the description of nonlocal objects and the construction of spectrum-generating groups in a relativistic theory. The experimental data for this model are the mass and spin spectrum of hadron towers; each tower is characterized by a system constant α. The mass formula derived is m 2 = lambda 2 (α 2 - 9/4) + lambda 2 s(s+1), where R = 1/lambda is the radius of micro-de Sitter spaces. The subject is treated under the following topics: relativistic spectrum-generating SO(3,2); nonlocal objects and SO(4,1); the SO(4,1) constraint relation for the relativistic spectrum-generating SO(3,2); and generalization of the remarkable representation and generalization of the de Sitter fiber bundle - the general relativistic rotator. 1 figure, 1 table

17 CFR 240.15c3-1d - Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1).

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Satisfactory Subordination...-Counter Markets § 240.15c3-1d Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1). (a) Introduction. (1) This Appendix sets forth minimum and non-exclusive requirements for satisfactory...

26 CFR 1.1502-17 - Methods of accounting.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 12 2010-04-01 2010-04-01 false Methods of accounting. 1.1502-17 Section 1.1502... (CONTINUED) INCOME TAXES Computation of Separate Taxable Income § 1.1502-17 Methods of accounting. (a) General rule. The method of accounting to be used by each member of the group shall be determined in...

Complete Transversal Disc Fracture in a Björk-Shiley Delrin Mitral Valve Prosthesis 43 Years After Implantation.

Science.gov (United States)

González-Santos, Jose María; Arnáiz-García, María Elena; Dalmau-Sorlí, María José; Sastre-Rincón, Jose Alfonso; Hernández-Hernández, Jesús; Pérez-Losada, María Elena; Sagredo-Meneses, Víctor; López-Rodríguez, Javier

2016-10-01

A patient who underwent previous implantation of a mitral valve replacement with a Björk-Shiley Delrin (BSD) mitral valve prosthesis during infancy was admitted to our institution 43 years later after an episode of syncope and cardiac arrest. Under extreme hemodynamic instability, a mitral valve prosthetic dysfunction causing massive mitral regurgitation was identified. The patient underwent an emergent cardiac operation, and a complete disc fracture with partial disc migration was found. Exceptional cases of mechanical prosthetic heart valve fracture exist. We report the first case of complete transversal disc rupture of a BSD mitral valve prosthesis after the longest period of implantation ever reported in that position. Copyright © 2016 The Society of Thoracic Surgeons. Published by Elsevier Inc. All rights reserved.

State Secretary Bjørn Haugstad visiting CERN at the occasion of the 60 years anniversary

CERN Multimedia

Photo, Team

2014-01-01

60 years after the world’s leading scientists gathered around the idea of bringing the world together through science; CERN – the European Organization for Nuclear Research – was celebrated by official delegations from 35 countries on 29 September 2014. State Secretary Bjørn Haugstad from the Ministry of Education and Research represented Norway, one of the twelve founding states, on this special event. The Norwegian delegation included Deputy Director General from the Ministry of Education and Research, delegates to the CERN Council from the University of Oslo and the Norwegian Research Council, representatives from CERN and the ATLAS Collaboration, as well as the Deputy Permanent Representative of the Permanent Mission of Norway. The delegation was given a lecture about CERN, as well as a tour of the ATLAS underground experimental area, where Norway is a contributor, and the LHC (Large Hadron Collider) tunnel.

1 CFR 17.3 - Criteria for emergency publication.

Science.gov (United States)

2010-01-01

... 1 General Provisions 1 2010-01-01 2010-01-01 false Criteria for emergency publication. 17.3..., AND PROCESSING OF DOCUMENTS FILING FOR PUBLIC INSPECTION AND PUBLICATION SCHEDULES Emergency Schedule § 17.3 Criteria for emergency publication. The emergency schedule is designed to provide the fastest...

Habitat heterogeneity and its influence on benthic biodiversity in oxygen minimum zones

Digital Repository Service at National Institute of Oceanography (India)

Gooday, A.J.; Bett, B.J.; Escobar, E.; Ingole, B.S.; Levin, L.A.; Neira, C.; Raman, A.V.; Sellanes, J.

National Oceanography Centre, Southampton, Empress Dock, European Way, Southampton SO14 3ZH, UK 2 Instituto de Ciencias del Mar y Limnología, Universidad Nacional Autonoma de Mexico, A.P. 70-305 Ciudad Universitaria Coyoacan, 04510 Mexico, D.F., Mexico... is mirrored in the change in assemblage composition on the Pakistan Margin, as represented in plots of MDSx versus depth and oxygen (Fig. 7). In samples taken along the axis of the Gulf of California (Mexico), between 740 and 2250 m, the rate of polychaete...

Anti-Aspergillus human host defence relies on type 1 T helper (Th1), rather than type 17 T helper (Th17), cellular immunity

NARCIS (Netherlands)

L.Y.A. Chai (Louis); F. van de Veerdonk (Frank); R.J. Marijnissen (Renoud); S.C. Cheng (Shih-Chin); A.L. Khoo; M. Hectors (Magda); K. Lagrou (Katrien); A.G. Vonk (Alieke); J. Maertens (Johan); L.A.B. Joosten (Leo); B.J. Kullberg (Bart Jan); M.G. Netea (Mihai)

2010-01-01

textabstractSummary Both interferon-γ-producing type 1 T helper (Th1)- and interleukin-17 (IL-17)-producing Th17 cells have been proposed to be involved in anti-fungal host defence. Although invasive aspergillosis is one of the most severe human fungal infections, little is known regarding the

17 CFR 140.1 - Headquarters office.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Headquarters office. 140.1..., FUNCTIONS, AND PROCEDURES OF THE COMMISSION Organization § 140.1 Headquarters office. (a) General. The headquarters office of the Commission is located at Three Lafayette Centre, 1155 21st Street, NW., Washington...

Should patients with Björk-Shiley valves undergo prophylactic replacement?

Science.gov (United States)

Birkmeyer, J D; Marrin, C A; O'Connor, G T

1992-08-29

About 85,000 patients have undergone replacement of diseased heart valves with prosthetic Björk-Shiley convexo-concave (CC) valves. These valves are prone to fracture of the outlet strut, which leads to acute valve failure that is usually fatal. Should patients with these valves undergo prophylactic replacement to avoid fracture? The incidence of strut fracture varies between 0% and 1.5% per year, depending on valve opening angle (60 degrees or 70 degrees), diameter (less than 29 mm or greater than or equal to 29 mm), and location (aortic or mitral). Other factors include the patient's life expectancy and the expected morbidity and mortality associated with reoperation. We have used decision analysis to identify the patients most likely to benefit from prophylactic reoperation. The incidence of outlet strut fracture was estimated from the data of three large studies on CC valves, and stratified by opening angle, diameter, and location. A Markov decision analysis model was used to estimate life expectancy for patients undergoing prophylactic valve replacement and for those not undergoing reoperation. Prophylactic valve replacement does not benefit patients with CC valves that have low strut fracture risks (60 degrees aortic valves and less than 29 mm, 60 degrees mitral valves). For most patients with CC valves that have high strut fracture risks (greater than or equal to 29 mm, 70 degrees CC), prophylactic valve replacement increases life expectancy. However, elderly patients with such valves benefit from prophylactic reoperation only if the risk of operative mortality is low. Patient age and operative risk are most important in recommendations for patients with CC valves that have intermediate strut fracture risks (less than 29 mm, 70 degrees valves and greater than or equal to 29 mm, 60 degrees mitral valves). For all patients and their doctors facing the difficult decision on whether to replace CC valves, individual estimates of operative mortality risk that

Dicty_cDB: Contig-U03991-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available 32 5.2 2 ( AZ306413 ) 1M0007B05R Mouse 10kb plasmid UUGC1M library Mus ... 38 5.2 2 ( BJ824535 ) Misgurnus anguillicaudatu...us visual cortex cDNA, RIKEN full-lengt... 32 6.7 2 ( AZ500970 ) 1M0339B10R Mouse 10kb plasmid UUGC1M library...7 2 ( AZ845402 ) 2M0145M09F Mouse 10kb plasmid UUGC1M library Mus ... 32 1.7 2 ( AZ990102 ) 2M0273L11R Mouse 10kb plasmid UUGC2M libr...07.... 44 2.5 1 ( AP009510 ) Uncultured Termite group 1 bacterium phylotype Rs...... cl... 32 6.5 2 ( AZ364702 ) 1M0110P21R Mouse 10kb plasmid UUGC1M library Mus ... 32 6.5 2 ( BH053767 ) R

Efectos hipotalámicos de la angiotensina-[1-7] en ratas con coartación aórtica

Directory of Open Access Journals (Sweden)

Clara Peña

2005-01-01

Full Text Available Hypothalamic Effects of Angiotensin (1-7 in Rats with Aortic Coarctation Christian Höcht, Javier A. W. Opezzo, Mariela Gironacci, Clara Peña, Carlos A. Taira The objective of the present study was to evaluate the effect of the intrahypothalamic administration of angiotensin-[1-7] (Ang-[1-7] on blood pressure and heart rate and on angiotensin II (Ang-II activity in rats with sham operation (SO and rats with aortic coarctation (ACo in early and chronic stage of hypertension. Wistar rats were used. Seven and 42 days after the corresponding operation one carotid artery was cannulated for the measurement of the mean arterial pressure (MAP in anaesthetized rats and an injection needle was inserted in the anterior hypothalamus by means of a stereotactic frame for the administration of Ang-II (50 ng, Ang-[1-7] (50 ng and Ang-II + Ang-[1-7] (50 + 50 ng. Hypothalamic administration of Ang-II produced an increased MAP in the ACo rats when compared to the control group in the early and chronic stages of hypertension, whereas Ang-[1-7] did not induce significant changes in any experimental group. The co-administration of Ang -[1-7] reduced the pressure activity of the Ang-II in both early and chronic stages of hypertension in the ACo rats, whereas it had no effect on the pressure activity of Ang-II in the normotensive rats. In conclusion, the pressure activity of Ang-II is increased in rats with early and chronic stages of arterial hypertension. The antagonistic effect of Ang-[1-7] may indicate that this peptide could modulate the pressure activity of an already increased Ang-II, since it has been only observed in the hypertensive rats.

Favorable Vascular Actions of Angiotensin-(1-7) in Human Obesity.

Science.gov (United States)

Schinzari, Francesca; Tesauro, Manfredi; Veneziani, Augusto; Mores, Nadia; Di Daniele, Nicola; Cardillo, Carmine

2018-01-01

Obese patients have vascular dysfunction related to impaired insulin-stimulated vasodilation and increased endothelin-1-mediated vasoconstriction. In contrast to the harmful vascular actions of angiotensin (Ang) II, the angiotensin-converting enzyme 2 product Ang-(1-7) has shown to exert cardiovascular and metabolic benefits in experimental models through stimulation of the Mas receptor. We, therefore, examined the effects of exogenous Ang-(1-7) on vasodilator tone and endothelin-1-dependent vasoconstriction in obese patients. Intra-arterial infusion of Ang-(1-7) (10 nmol/min) resulted in significant increase in unstimulated forearm flow ( P =0.03), an effect that was not affected by the Mas receptor antagonist A779 (10 nmol/min; P >0.05). In the absence of hyperinsulinemia, however, forearm flow responses to graded doses of acetylcholine and sodium nitroprusside were not different during Ang-(1-7) administration compared with saline (both P >0.05). During infusion of regular insulin (0.15 mU/kg per minute), by contrast, endothelium-dependent vasodilator response to acetylcholine was significantly enhanced by Ang-(1-7) ( P =0.04 versus saline), whereas endothelium-independent response to sodium nitroprusside was not modified ( P =0.91). Finally, Ang-(1-7) decreased the vasodilator response to endothelin A receptor blockade (BQ-123; 10 nmol/min) compared with saline (6±1% versus 93±17%; P obese patients Ang-(1-7) has favorable effects not only to improve insulin-stimulated endothelium-dependent vasodilation but also to blunt endothelin-1-dependent vasoconstrictor tone. These findings provide support for targeting Ang-(1-7) to counteract the hemodynamic abnormalities of human obesity. © 2017 American Heart Association, Inc.

[Strut fracture of a convex-concave 60 degree Björk-Shiley mitral valve prosthesis 5 years after implantation--metallurgic analysis of the prosthesis strut].

Science.gov (United States)

Lemke, B; Rathmann, J; Wiebe, V; Witzel, U

1991-08-01

Acute mechanical failure of prosthetic heart valves is rare, but associated with high mortality when occurring. For convexo-concave Björk-Shiley prostheses only fractures of the outlet strut are reported. We present a case of lethal mechanical complication 5 years after implantation. By additional metallurgic analysis we were able to identify a sequential course of the outlet strut fracture. This could lead to new approaches for early detection of this complication.

Outlet strut fracture of Björk-Shiley convexo-concave valves: can valve-manufacturing characteristics explain the risk?

Science.gov (United States)

Omar, R Z; Morton, L S; Beirne, M; Blot, W J; Lawford, P V; Hose, R; Taylor, K M

2001-06-01

Björk-Shiley 60 degrees convexo-concave prosthetic heart valves (Shiley, Inc, Irvine, Calif, a subsidiary of Pfizer, Inc) continue to be a concern for approximately 35,000 nonexplanted patients worldwide, with approximately 600 events reported to the manufacturer to date. Fractures of the outlet struts of the valves began to appear in the early 1980s and have continued to the present, but their causes are only partially understood. A matched case-control study was conducted evaluating manufacturing records for 52 valves with outlet strut fractures and 248 control subjects matched for age at implantation, valve size, and valve position. In addition to the risk factors recognized as determinants of outlet strut fracture, the United Kingdom case-control study has observed 7- to 9-fold increased risk with performance of multiple hook deflection tests. This test was performed more than once, usually after rework on the valve. Six valves in this study underwent multiple hook deflection tests, of which 4 experienced an outlet strut fracture. Cracks and further rework were noted for these valves. Significant associations were also observed between outlet strut fracture and disc-to-strut gap measurements taken before the attachment of the sewing ring. It is our view that a combination of factors related to valve design, manufacturing process, and patient characteristics are responsible for outlet strut fractures of Björk-Shiley convexo-concave valves. Multiple hook deflection tests have emerged as a potential new risk factor for outlet strut fracture in both The Netherlands and the United Kingdom. This factor appears to be correlated with the presence of other abnormalities. A further study is needed to investigate the factors correlated with multiple hook deflection tests. On confirmation of risk, the presence of multiple hook deflection tests may be added to equations, quantifying the risk of outlet strut fracture for comparison against risk of mortality and serious

The ternary system K2SO4MgSO4CaSO4

Science.gov (United States)

Rowe, J.J.; Morey, G.W.; Silber, C.C.

1967-01-01

Melting and subsolidus relations in the system K2SO4MgSO4CaSO4 were studied using heating-cooling curves, differential thermal analysis, optics, X-ray diffraction at room and high temperatures and by quenching techniques. Previous investigators were unable to study the binary MgSO4CaSO4 system and the adjacent area in the ternary system because of the decomposition of MgSO4 and CaSO4 at high temperatures. This problem was partly overcome by a novel sealed-tube quenching method, by hydrothermal synthesis, and by long-time heating in the solidus. As a result of this study, we found: (1) a new compound, CaSO4??3MgSO4 (m.p. 1201??C) with a field extending into the ternary system; (2) a high temperature form of MgSO4 with a sluggishly reversible inversion. An X-ray diffraction pattern for this polymorphic form is given; (3) the inversion of ??-CaSO4 (anhydrite) to ??-CaSO4 at 1195??C, in agreement with grahmann; (1) (4) the melting point of MgSO4 is 1136??C and that of CaSO4 is 1462??C (using sealed tube methods to prevent decomposition of the sulphates); (5) calcium langbeinite (K2SO4??2CaSO4) is the only compound in the K2SO4CaSO4 binary system. This resolved discrepancies in the results of previous investigators; (6) a continuous solid solution series between congruently melting K2SOP4??2MgSO4 (langbeinite) and incongruently melting K2SO4??2CaSO4 (calcium langbeinite); (7) the liquidus in the ternary system consists of primary phase fields of K2SO4, MgSO4, CaSO4, langbeinite-calcium langbeinite solid solution, and CaSO4??3MgSO4. The CaSO4 field extends over a large portion of the system. Previously reported fields for the compounds (K2SO4??MgSO4??nCaSO4), K2SO4??3CaSO4 and K2SO4??CaSO4 were not found; (8) a minimum in the ternary system at: 740??C, 25% MgSO4, 6% CaSO4, 69% K2SO4; and ternary eutectics at 882??C, 49% MgSO4, 19% CaSO4, 32% K2SO4; and 880??, 67??5% MgSO4, 5% CaSO4, 27??5% K2SO4. ?? 1967.

[Sudden and fatal malfunction of a Björk-Shiley prosthesis in mitral position due to rupture of the ventricular bracket and disk embolization].

Science.gov (United States)

Casarotto, D; Motta, A; Fabbri, A; Pugliese, P; Muneretto, C; Zanini, M; Sheiban, I

1985-04-01

Mechanical complications of prosthetic valves are increasing. The following report describes a case of fracture of a Björk-Shiley mitral prosthetic strut with dislogment of the valve occluder into the thoracic aorta. At the reoperation a new prosthesis was implanted but the patient died of acute heart failure. The diagnosis of valve disfunction must be made non invasively, because the time required for cardiac catherization usually constitutes a lethal delay. The only hope for survival is prompt surgical treatment.

17 CFR 256.426.1 - Donations.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Donations. 256.426.1 Section... COMPANY ACT OF 1935 Income and Expense Accounts § 256.426.1 Donations. This account shall include all payments or donations for charitable, social or community welfare purposes. ...

Au-Ni nanoparticles: Phase diagram prediction, synthesis, characterization, and thermal stability

Czech Academy of Sciences Publication Activity Database

Sopoušek, J.; Kryštofová, A.; Premovic, M.; Zobač, O.; Postlerová, S.; Brož, P.; Buršík, Jiří

2017-01-01

Roč. 58, SEP (2017), s. 25-33 ISSN 0364-5916 R&D Projects: GA ČR(CZ) GA17-12844S; GA ČR(CZ) GA17-15405S Institutional support: RVO:68081723 Keywords : nanoalloy * CALPHAD * phase diagram Subject RIV: BJ - Thermodynamics OBOR OECD: Thermodynamics Impact factor: 1.600, year: 2016

Incidence of lung tumors in LX mice exposed to (1) free radicals; (2) SO/sub 2/

Energy Technology Data Exchange (ETDEWEB)

Peacock, P R; Spence, J B

1967-01-01

60 to 65 3-month-old LX mice were exposed to either radio frequency-generated free radicals for 3 hr/day, 5 days/week, or 500 ppM SO/sub 2/ for 5 min/day, 5 days/week, for more than 2 yr (results only on mice surviving > 300 days). Incidence of primary neoplasia (adenoma) in mice exposed to SO/sub 2/ increased from 31% (control) to 54% in males and from 17% to 43% in females. Incidence of neoplasia in mice exposed to free radicals increased 10 and 6% above controls for males and females, respectively. The action of SO/sub 2/ was thought to be that of nonspecific inflammation leading to hyperplasia and lymphatic engorgement, which precede and predispose adenoma.

Structural features and dynamic investigations of the membrane-bound cytochrome P450 17A1.

Science.gov (United States)

Cui, Ying-Lu; Xue, Qiao; Zheng, Qing-Chuan; Zhang, Ji-Long; Kong, Chui-Peng; Fan, Jing-Rong; Zhang, Hong-Xing

2015-10-01

Cytochrome P450 (CYP) 17A1 is a dual-function monooxygenase with a critical role in the synthesis of many human steroid hormones. The enzyme is an important target for treatment of breast and prostate cancers that proliferate in response to estrogens and androgens. Despite the crystallographic structures available for CYP17A1, no membrane-bound structural features of this enzyme at atomic level are available. Accumulating evidence has indicated that the interactions between bounded CYPs and membrane could contribute to the recruitment of lipophilic substrates. To this end, we have investigated the effects on structural characteristics in the presence of the membrane for CYP17A1. The MD simulation results demonstrate a spontaneous insertion process of the enzyme to the lipid. Two predominant modes of CYP17A1 in the membrane are captured, characterized by the depths of insertion and orientations of the enzyme to the membrane surface. The measured heme tilt angles show good consistence with experimental data, thereby verifying the validity of the structural models. Moreover, conformational changes induced by the membrane might have impact on the accessibility of the active site to lipophilic substrates. The dynamics of internal aromatic gate formed by Trp220 and Phe224 are suggested to regulate tunnel opening motions. The knowledge of the membrane binding characteristics could guide future experimental and computational works on membrane-bound CYPs so that various investigations of CYPs in their natural, lipid environment rather than in artificially solubilized forms may be achieved. Copyright © 2015. Published by Elsevier B.V.

Measuring Turbulence Mixing in Indonesian Seas Using Microstructure EM-APEX Floats

Science.gov (United States)

2016-04-18

dynamics 16. SECURITY CLASSIFICATION OF: 17. LIMIT A liON OF a. REPORT b. ABSTRACT c. THIS PAGE ABSTRACT N/A N/A N/A SAR 18. NUMBER OF PAGES 3 19a...report) using the research vessel Baruna Jaya 8 (BJ8) in the Banda Sea in August 2016. BPPL has a fish stock assessment program covering the Banda Sea...the BJ8) also a BPPL/KKP fish stock assessment cruise to the Arafura Sea (east of the Banda Sea), invited 2 . . Gordon, N00014-15-1-2307

Spin reorientation and magnetic anisotropy in Y2Co17-xCr x (x 1.17-3.0) compounds

International Nuclear Information System (INIS)

Fuquan, B.; Tegus, O.; Dagula, W.; Brueck, E.; Boer, F.R. de; Buschow, K.H.J.

2005-01-01

Spin reorientation transitions and magnetic anisotropy in Y 2 Co 17-x Cr x (x = 1.17-3.0) compounds have been investigated by means of X-ray diffraction and magnetization measurements. The powder X-ray diffraction patterns show that most samples crystallize as a single phase with the rhombohedral Th 2 Zn 17 -type structure. However, in the compound Y 2 Co 14 Cr 3 the Th 2 Zn 17 phase coexist with the hexagonal Th 2 Ni 17 -type phase. The lattice parameters a and c hardly change and the unit cell volume V increases slightly with increasing Cr content. The X-ray diffraction patterns of the aligned powder of the samples have confirmed that at room temperature the compound with x = 1.17 has planar anisotropy, but the compounds with x = 1.76, 2.34 and 3.00 have uniaxial anisotropy. Spin reorientation phenomena occur in all of the compounds. With increasing Cr content, the Curie temperature, the spin reorientation temperature, the spontaneous magnetization, and the anisotropy constant K 2 of the Y 2 Co 17-x Cr x (x = 1.17-3.0) compounds decrease strongly while the anisotropy constant K 1 increases in the range of x from 1.17 to 2.34 and then decreases in the range of x from 2.34 to 3.00

Counsellors in primary care in Southampton: a questionnaire survey of their qualifications, working arrangements, and casemix.

Science.gov (United States)

Clark, A; Hook, J; Stein, K

1997-01-01

BACKGROUND: There has been an upsurge of interest in counselling in primary care over the past five years. This has been stimulated by a growing demand for non-drug treatment of emotional disorders and by the extension of reimbursement for the costs of counsellors. Continued calls for careful evaluation have been largely unheeded in the face of heady growth. AIM: To establish the prevalence of counselling services in the 67 general practices in the Southampton and South West Hampshire Health District, and to describe in detail their qualifications, working arrangements, and casemix. METHOD: A questionnaire enquiring about counselling services was sent to all the general practices in the district. A second questionnaire was then posted to all the counsellors identified as working in these practices. RESULTS: Twenty-six (39%) practices employed one or more counsellors. Fundholding practices were four times more likely than non-fundholders to employ a counsellor. Most of the counselling work was short term (4-20 sessions). The most common presenting complaints were relationship problems, depression, anxiety, and bereavement. CONCLUSION: This descriptive study highlights the wide variation in the qualifications and training of counsellors. Until the issue of effectiveness is resolved through further research, the best safeguard of quality is to ensure that counsellors meet the appropriate training standards laid down by the British Association of Counsellors. Monitoring standards is a legitimate task for those commissioning health care who are increasingly responsible for reimbursement of a counsellor's salary. Counsellors who meet appropriate training criteria should be encouraged to pursue accreditation with the British Association of Counsellors. Those who do not meet these criteria should be encouraged to undergo additional training. PMID:9474822

Assessment of the thermodynamic properties and phase diagram of the Bi–Pd system

Czech Academy of Sciences Publication Activity Database

Vřešťál, J.; Pinkas, J.; Watson, A.; Scott, A.; Houserová, Jana; Kroupa, Aleš

2006-01-01

Roč. 30, č. 1 (2006), s. 14-17 ISSN 0364-5916 R&D Projects: GA MŠk(CZ) OC 531.002 Institutional research plan: CEZ:AV0Z2041904 Keywords : phase diagram * thermodynamic modelling Subject RIV: BJ - Thermodynamics Impact factor: 1.432, year: 2006

Dietary Blueberry and Bifidobacteria Attenuate Nonalcoholic Fatty Liver Disease in Rats by Affecting SIRT1-Mediated Signaling Pathway

Science.gov (United States)

Ren, Tingting; Huang, Chao; Cheng, Mingliang

2014-01-01

NAFLD model rats were established and divided into NAFLD model (MG group), SIRT1 RNAi (SI group), blueberry juice (BJ group), blueberry juice + bifidobacteria (BJB group), blueberry juice + SIRT1 RNAi (BJSI group), and blueberry juice + bifidobacteria + SIRT1 RNAi groups (BJBSI group). A group with normal rats was a control group (CG). BJB group ameliorated NAFLD, which was better than BJ group (P Blueberry juice and bifidobacteria improve NAFLD by activating SIRTI-mediating signaling pathway. PMID:25544867

17 CFR 37.1 - Scope and definition.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Scope and definition. 37.1 Section 37.1 Commodity and Securities Exchanges COMMODITY FUTURES TRADING COMMISSION DERIVATIVES... any board of trade operating as or applying to become registered as a derivatives transaction...

Osmotic and activity coefficients of {y Na2SO4 + (1 - y) ZnSO4}(aq) at T = 298.15 K

International Nuclear Information System (INIS)

Marjanovic, V.; Ninkovic, R.; Miladinovic, J.; Todorovic, M.; Pavicevic, V.

2005-01-01

The osmotic coefficients of the mixed electrolyte solution {y Na 2 SO 4 + (1 - y) ZnSO 4 }(aq) have been measured by the isopiestic method, at T = 298.5 K. The experimental results were treated by Scatchard's, Pitzer-Kim's and Clegg-Pitzer-Brimblecombe's methods for mixed-electrolyte solutions. By these methods, the activity coefficients for Na 2 SO 4 and ZnSO 4 were calculated and compared. The Scatchard interaction parameters are used for calculation of the excess Gibbs free energy as a function of ionic strength and ionic-strength fraction of Na 2 SO 4 . Also, the Zdanovskii's rule of linearity is tested

TGF-β converts Th1 cells into Th17 cells through stimulation of Runx1 expression.

Science.gov (United States)

Liu, Hou-Pu; Cao, Anthony T; Feng, Ting; Li, Qingjie; Zhang, Wenbo; Yao, Suxia; Dann, Sara M; Elson, Charles O; Cong, Yingzi

2015-04-01

Differentiated CD4(+) T cells preserve plasticity under various conditions. However, the stability of Th1 cells is unclear, as is whether Th1 cells can convert into Th17 cells and thereby contribute to the generation of IFN-γ(+) IL-17(+) CD4(+) T cells, the number of which correlates with severity of colitis. We investigated whether IFN-γ(+) Th1 cells can convert into Th17 cells under intestinal inflammation and the mechanisms involved. IFN-γ(Thy1.1+) Th1 cells were generated by culturing naïve CD4(+) T cells from IFN-γ(Thy1.1) CBir1 TCR-Tg reporter mice, whose TCR is specific for an immunodominant microbiota antigen, CBir1 flagellin, under Th1 polarizing conditions. IFN-γ(Thy1.1+) Th1 cells induced colitis in Rag(-/-) mice after adoptive transfer and converted into IL-17(+) Th17, but not Foxp3(+) Treg cells in the inflamed intestines. TGF-β and IL-6, but not IL-1β and IL-23, regulated Th1 conversion into Th17 cells. TGF-β induction of transcriptional factor Runx1 is crucial for the conversion, since silencing Runx1 by siRNA inhibited Th1 conversion into Th17 cells. Furthermore, TGF-β enhanced histone H3K9 acetylation but inhibited H3K9 trimethylation of Runx1- and ROR-γt-binding sites on il-17 or rorc gene in Th1 cells. We conclude that Th1 cells convert into Th17 cells under inflammatory conditions in intestines, which is possibly mediated by TGF-β induction of Runx1. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

49 CFR 17.1 - What is the purpose of these regulations?

Science.gov (United States)

2010-10-01

... 49 Transportation 1 2010-10-01 2010-10-01 false What is the purpose of these regulations? 17.1 Section 17.1 Transportation Office of the Secretary of Transportation INTERGOVERNMENTAL REVIEW OF DEPARTMENT OF TRANSPORTATION PROGRAMS AND ACTIVITIES § 17.1 What is the purpose of these regulations? (a) The...

17 CFR 1.27 - Record of investments.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Record of investments. 1.27... UNDER THE COMMODITY EXCHANGE ACT Customers' Money, Securities, and Property § 1.27 Record of investments... record showing the following: (1) The date on which such investments were made; (2) The name of the...

Mechanical stretching stimulates collagen synthesis via down-regulating SO2/AAT1 pathway

Science.gov (United States)

Liu, Jia; Yu, Wen; Liu, Yan; Chen, Selena; Huang, Yaqian; Li, Xiaohui; Liu, Cuiping; Zhang, Yanqiu; Li, Zhenzhen; Du, Jie; Tang, Chaoshu; Du, Junbao; Jin, Hongfang

2016-01-01

The aim of the study was to investigate the role of endogenous sulfur dioxide (SO2)/ aspartate aminotransferase 1 (AAT1) pathway in stretch-induced excessive collagen expression and its mechanism. The mechanical stretch downregulated SO2/AAT1 pathway and increased collagen I and III protein expression. Importantly, AAT1 overexpression blocked the increase in collagen I and III expression, transforming growth factor-β1 (TGF- β1) expression and phosphorylation of Smad2/3 induced by stretch, but AAT1 knockdown mimicked the increase in collagen I and III expression, TGF- β1 expression and phosphorylation of Smad2/3 induced by stretch. Mechanistically, SB431542, a TGF-β1/Smad2/3 inhibitor, eliminated excessive collagen I and III accumulation induced by AAT1 knockdown, stretch or stretch plus AAT1 knockdown. In a rat model of high pulmonary blood flow-induced pulmonary vascular collagen accumulation, AAT1 expression and SO2 content in lung tissues of rat were reduced in shunt rats with high pulmonary blood flow. Supplement of SO2 derivatives inhibited activation of TGF- β1/Smad2/3 pathway and alleviated the excessive collagen accumulation in lung tissues of shunt rats. The results suggested that deficiency of endogenous SO2/AAT1 pathway mediated mechanical stretch-stimulated abnormal collagen accumulation via TGF-β1/Smad2/3 pathway. PMID:26880260

A constitutional translocation t(1;17(p36.2;q11.2 in a neuroblastoma patient disrupts the human NBPF1 and ACCN1 genes.

Directory of Open Access Journals (Sweden)

Karl Vandepoele

Full Text Available The human 1p36 region is deleted in many different types of tumors, and so it probably harbors one or more tumor suppressor genes. In a Belgian neuroblastoma patient, a constitutional balanced translocation t(1;17(p36.2;q11.2 may have led to the development of the tumor by disrupting or activating a gene. Here, we report the cloning of both translocation breakpoints and the identification of a novel gene that is disrupted by this translocation. This gene, named NBPF1 for Neuroblastoma BreakPoint Family member 1, belongs to a recently described gene family encoding highly similar proteins, the functions of which are unknown. The translocation truncates NBPF1 and gives rise to two chimeric transcripts of NBPF1 sequences fused to sequences derived from chromosome 17. On chromosome 17, the translocation disrupts one of the isoforms of ACCN1, a potential glioma tumor suppressor gene. Expression of the NBPF family in neuroblastoma cell lines is highly variable, but it is decreased in cell lines that have a deletion of chromosome 1p. More importantly, expression profiling of the NBPF1 gene showed that its expression is significantly lower in cell lines with heterozygous NBPF1 loss than in cell lines with a normal 1p chromosome. Meta-analysis of the expression of NBPF and ACCN1 in neuroblastoma tumors indicates a role for the NBPF genes and for ACCN1 in tumor aggressiveness. Additionally, DLD1 cells with inducible NBPF1 expression showed a marked decrease of clonal growth in a soft agar assay. The disruption of both NBPF1 and ACCN1 genes in this neuroblastoma patient indicates that these genes might suppress development of neuroblastoma and possibly other tumor types.

Oxidation of SO{sub 2} in a trickle bed reactor packed with activated carbon at low liquid flow rates

Energy Technology Data Exchange (ETDEWEB)

Suyadal, Y.; Oguz, H. [Ankara Univ. (Turkey). Dept. of Chemical Engineering

2000-07-01

In this study, the oxidation of SO{sub 2} on activated carbon (AcC) by using distilled water and air was carried out in a laboratory scale trickle bed reactor (TBR). Distilled water and air containing 1.7% (v/v) SO{sub 2} were fed co-currently downward through a fixed bed of AcC particles in a range of 1-7 cm{sup 3}/s and 10-27 cm{sup 3}/s, respectively. H{sub 2}SO{sub 3}/H{sub 2}SO{sub 4} solutions were the products obtained in the liqiuid phase. Steady-state experiments were performed in a column of 0.15 m packing height and 0.047 m column diameter at 20 C and atmospheric pressure. (orig.)

17 CFR 1.60 - Pending legal proceedings.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Pending legal proceedings. 1... REGULATIONS UNDER THE COMMODITY EXCHANGE ACT Miscellaneous § 1.60 Pending legal proceedings. (a) Every... section to be submitted to the Commission as to matters pending on the effective date of the section (May...

Phenomenological analysis of supersymmetric σ-models on coset spaces SO(10)/U(5) and E6/[SO(10)xU(1)

International Nuclear Information System (INIS)

Nyawelo, T.S.

2004-12-01

We discuss some phenomenological aspects of gauged supersymmetric σ-models on homogeneous coset-spaces E 6 /[SO(10)xU(1)] and SO(10)/U(5) which are some of the most interesting for phenomenology. We investigate in detail the vacuum configurations of these models, and study the resulting consequences for supersymmetry breaking and breaking of the internal symmetry. Some supersymmetric minima for both models with gauged full isometry groups E 6 and SO(10) are physically problematic as the Kaehler metric becomes singular ad hence the kinetic terms of the Goldstone boson multiplets vanish. This leads us to introduce recently proposed soft supersymmetry-breaking mass terms which displace the minimum away from the singulax point. A non-singular Kaehler metric breaks the linear subgroup SO(10)xU(1) of the E 6 model spontaneously. The particle spectrum of all these different models is computed. (author)

WESTINGHOUSE 17X17 MOX PWR ASSEMBLY - WASTE PACKAGE CRITICALITY ANALYSIS (SCPB: N/A)

International Nuclear Information System (INIS)

J.W. Davis

1996-01-01

This analysis is prepared by the Mined Geologic Disposal System (MGDS) Waste Package Development Department (WPDD) to compare the criticality potential of Westinghouse 17 x 17 mixed oxide (MOX) PWR fuel with the Design Basis spent nuclear fuel (SNF) analyzed previously (Ref. 5.1, 5.2). The basis of comparison will be the conceptual design Multi-Purpose Canister (MPC) PWR waste package concepts. The objectives of this evaluation are to show that the criticality potential of the MOX fuel is equal to or lower than the DBF or, if necessary, indicate what additional measures are required to make it so

Monitoring so2 emission at the Soufriere Hills volcano: Implications for changes in eruptive conditions

Science.gov (United States)

Young, S.R.; Francis, P.W.; Barclay, J.; Casadevall, T.J.; Gardner, C.A.; Darroux, B.; Davies, M.A.; Delmelle, P.; Norton, G.E.; Maciejewski, A.J.H.; Oppenheimer, C.M.M.; Stix, J.; Watson, I.M.

1998-01-01

Correlation spectrometer measurements of sulfur dioxide (SO2) emission rates during the current eruption of the Soufriere Hills volcano, Montserrat, have contributed towards identifying different phases of volcanic activity. SO2 emission rate has increased from 550 td-1 (>6.4 kgs-1) after July 1996, with the uncertainty associated with any individual measurement ca. 30%. Significantly enhanced SO2 emission rates have been identified in association with early phreatic eruptions (800 td-1 (9.3 kgs-1)) and episodes of vigorous dome collapse and pyroclastic flow generation (900 to 1500 td-1 (10.4 to 17.4 kgs-1)). SO2 emission rate has proved a useful proxy measurement for magma production rate. Observed SO2 emission rates are significantly higher than those inferred from analyses of glass inclusions in phenocrysts, implying the existence of a S-rich magmatic vapour phase.

Transgenic tobacco overexpressing Brassica juncea HMG-CoA synthase 1 shows increased plant growth, pod size and seed yield.

Directory of Open Access Journals (Sweden)

Pan Liao

Full Text Available Seeds are very important not only in the life cycle of the plant but they represent food sources for man and animals. We report herein a mutant of 3-hydroxy-3-methylglutaryl-coenzyme A synthase (HMGS, the second enzyme in the mevalonate (MVA pathway that can improve seed yield when overexpressed in a phylogenetically distant species. In Brassica juncea, the characterisation of four isogenes encoding HMGS has been previously reported. Enzyme kinetics on recombinant wild-type (wt and mutant BjHMGS1 had revealed that S359A displayed a 10-fold higher enzyme activity. The overexpression of wt and mutant (S359A BjHMGS1 in Arabidopsis had up-regulated several genes in sterol biosynthesis, increasing sterol content. To quickly assess the effects of BjHMGS1 overexpression in a phylogenetically more distant species beyond the Brassicaceae, wt and mutant (S359A BjHMGS1 were expressed in tobacco (Nicotiana tabacum L. cv. Xanthi of the family Solanaceae. New observations on tobacco OEs not previously reported for Arabidopsis OEs included: (i phenotypic changes in enhanced plant growth, pod size and seed yield (more significant in OE-S359A than OE-wtBjHMGS1 in comparison to vector-transformed tobacco, (ii higher NtSQS expression and sterol content in OE-S359A than OE-wtBjHMGS1 corresponding to greater increase in growth and seed yield, and (iii induction of NtIPPI2 and NtGGPPS2 and downregulation of NtIPPI1, NtGGPPS1, NtGGPPS3 and NtGGPPS4. Resembling Arabidopsis HMGS-OEs, tobacco HMGS-OEs displayed an enhanced expression of NtHMGR1, NtSMT1-2, NtSMT2-1, NtSMT2-2 and NtCYP85A1. Overall, increased growth, pod size and seed yield in tobacco HMGS-OEs were attributed to the up-regulation of native NtHMGR1, NtIPPI2, NtSQS, NtSMT1-2, NtSMT2-1, NtSMT2-2 and NtCYP85A1. Hence, S359A has potential in agriculture not only in improving phytosterol content but also seed yield, which may be desirable in food crops. This work further demonstrates HMGS function in plant

β1 subunit stabilises sodium channel Nav1.7 against mechanical stress.

Science.gov (United States)

Körner, Jannis; Meents, Jannis; Machtens, Jan-Philipp; Lampert, Angelika

2018-06-01

The voltage-gated sodium channel Nav1.7 is a key player in neuronal excitability and pain signalling. In addition to voltage sensing, the channel is also modulated by mechanical stress. Using whole-cell patch-clamp experiments, we discovered that the sodium channel subunit β1 is able to prevent the impact of mechanical stress on Nav1.7. An intramolecular disulfide bond of β1 was identified to be essential for stabilisation of inactivation, but not activation, against mechanical stress using molecular dynamics simulations, homology modelling and site-directed mutagenesis. Our results highlight the role of segment 6 of domain IV in fast inactivation. We present a candidate mechanism for sodium channel stabilisation against mechanical stress, ensuring reliable channel functionality in living systems. Voltage-gated sodium channels are key players in neuronal excitability and pain signalling. Precise gating of these channels is crucial as even small functional alterations can lead to pathological phenotypes such as pain or heart failure. Mechanical stress has been shown to affect sodium channel activation and inactivation. This suggests that stabilising components are necessary to ensure precise channel gating in living organisms. Here, we show that mechanical shear stress affects voltage dependence of activation and fast inactivation of the Nav1.7 channel. Co-expression of the β1 subunit, however, protects both gating modes of Nav1.7 against mechanical shear stress. Using molecular dynamics simulation, homology modelling and site-directed mutagenesis, we identify an intramolecular disulfide bond of β1 (Cys21-Cys43) which is partially involved in this process: the β1-C43A mutant prevents mechanical modulation of voltage dependence of activation, but not of fast inactivation. Our data emphasise the unique role of segment 6 of domain IV for sodium channel fast inactivation and confirm previous reports that the intracellular process of fast inactivation can be

37 CFR 1.17 - Patent application and reexamination processing fees.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Patent application and reexamination processing fees. 1.17 Section 1.17 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE GENERAL RULES OF PRACTICE IN PATENT CASES General Provisions Fees...

Immersion francaise precoce: Arts plastiques 1-7 (Early French Immersion: Plastic Arts for Grades 1-7).

Science.gov (United States)

Burt, Andy; And Others

This curriculum guide in art education is intended for use in grades 1-7 in the early French immersion program. An introductory chapter describes the educational objectives of the art program, the role of art education in child development, general and terminal objectives, methodology, the steps in graphic evolution, and an outline of the program.…

SoCRocket: A Virtual Platform for SoC Design

Science.gov (United States)

Fossati, Luca; Schuster, Thomas; Meyer, Rolf; Berekovic, Mladen

2013-08-01

approach in this sense, enabling embedded software developers to start development earlier in the system design cycle, and cutting the dependency on the physical system hardware. In order to successfully implement the described methodologies, it is requested to have access to the a wide selection of IP-Cores (and related SystemC/TLM models) and access to the latest Electronic Design Automation (EDA, [17]) tools. On the one hand, for what concerns the European Space landscape, such IP-Cores are provided by the European Space Agency [4] and a few other suppliers (e.g Aeroflex Gaisler with GRLIB [2]). On the other hand, for what concerns the related high abstraction models and related design methodologies (partly depicted in Figure 1), the European Space Agency, through the Braunschweig Technische Universitat, has started the development of the SoCRocket Virtual Platform [8]. Together with the Virtual Platform infrastructure SoCRocket contains a library of IP-Core models. The SoCRocket library has been built around the TrapGen LEON instruction set simulator [15]. The library contains a variety of SystemC simulation models such as caches, memory management unit, AMBA interconnect, memory controller, memories, interrupt controller, timer and more. All models are TLM2.0 compliant and come in both loosely-timed and approximately timed coding styles. As later-on presented more in detail, the runtime reconfiguration, the completeness of tools and models, as well as the fact that all simulation IPs have a freely available RTL counterpart differentiates SoCRocket from other commercially available Virtual Platforms. Moreover, due to their TLM2.0 compliance the provided models are not bound to the SoCRocket environment but they can be used with alternative tools, such as Cadence Virtual Platform [3] or Synopsys Platform Architect [10]. The paper is organized as follows: Section 2 presents the architecture of SoCRocket and the related library of SystemC models. Finally Section 3 shows

THE DEVELOPMENT OF A 1990 GLOBAL INVENTORY FOR SO(X) AND NO(X) ON A 1(DEGREE) X 1(DEGREE) LATITUDE-LONGITUDE GRID

International Nuclear Information System (INIS)

VAN HEYST, B.J.

1999-01-01

Sulfur and nitrogen oxides emitted to the atmosphere have been linked to the acidification of water bodies and soils and perturbations in the earth's radiation balance. In order to model the global transport and transformation of SO(sub x) and NO(sub x), detailed spatial and temporal emission inventories are required. Benkovitz et al. (1996) published the development of an inventory of 1985 global emissions of SO(sub x) and NO(sub x) from anthropogenic sources. The inventory was gridded to a 1(degree) x 1(degree) latitude-longitude grid and has served as input to several global modeling studies. There is now a need to provide modelers with an update of this inventory to a more recent year, with a split of the emissions into elevated and low level sources. This paper describes the development of a 1990 update of the SO(sub x) and NO(sub x) global inventories that also includes a breakdown of sources into 17 sector groups. The inventory development starts with a gridded global default EDGAR inventory (Olivier et al, 1996). In countries where more detailed national inventories are available, these are used to replace the emissions for those countries in the global default. The gridded emissions are distributed into two height levels (0-100m and and gt;100m) based on the final plume heights that are estimated to be typical for the various sectors considered. The sources of data as well as some of the methodologies employed to compile and develop the 1990 global inventory for SO(sub x) and NO(sub x) are discussed. The results reported should be considered to be interim since the work is still in progress and additional data sets are expected to become available

Corrosion characteristics of the Sm2(Fe0.9Co0.1)17N2.9 magnets stabilized by zinc-coating

International Nuclear Information System (INIS)

Arlot, R.; Machida, K.; Adachi, G.; Rango, P. de; Fruchart, D.

1998-01-01

The effect of powder particle size and of zinc coatings ( 2 (Fe 0.9 Co 0.1 ) 17 N 2.9 magnets has been investigated and compared to those obtained for Sm 2 Fe 17 N 3 and Nd 2 Fe 14 B magnets. Potentiokinetic polarisation behaviour in 0.5 N H 2 SO 4 and in Ringer's solution was studied. It was found that in 0.5 N H 2 SO 4 solution, the corrosion resistance is very weak, whereas in Ringer's solution, Zn coating and epoxy embedding provided a very efficient protection to the magnet. This result is quite unexpected as regarding the very weak amount of Zn (0.73 wt%) and epoxy (2.5-5 wt%) used to stabilize those very reactive ground powders which easily burn in air. Also, we characterized the magnetic properties of severely corroded magnets. (orig.)

The effect of angiotensin 1-7 on tyrosine kinases activity in rat anterior pituitary

International Nuclear Information System (INIS)

Rebas, Elzbieta; Zabczynska, Joanna; Lachowicz, Agnieszka

2006-01-01

Angiotensin 1-7 (Ang 1-7) is a peptide originated from Ang II. It is known that in vessels Ang 1-7 shows opposite effects to Ang II. Ang 1-7 can modify processes of proliferation. However, Ang 1-7 action in pituitary gland cells was never studied. Moreover, the specific binding sites for Ang 1-7 are still unknown. The aim of this study was to examine the effects of Ang 1-7 on tyrosine kinases (PTKs) activity in the anterior pituitary. The reaction of phosphorylation was carrying out in presence of different concentration of Ang 1-7 and losartan (antagonist of AT1 receptor) and PD123319 (antagonist of AT2). Our results show that Ang 1-7 inhibited activity of PTK to 60% of basic activity. Losartan did not change the Ang 1-7-induced changes in PTKs activity. The presence of PD123319 together with Ang 1-7 caused stronger inhibition PTKs activity than Ang 1-7 alone. These observations suggest that Ang 1-7 binds to the novel, unknown, specific for this peptide receptor

Prickle1 mutation causes planar cell polarity and directional cell migration defects associated with cardiac outflow tract anomalies and other structural birth defects

Directory of Open Access Journals (Sweden)

Brian C. Gibbs

2016-03-01

Full Text Available Planar cell polarity (PCP is controlled by a conserved pathway that regulates directional cell behavior. Here, we show that mutant mice harboring a newly described mutation termed Beetlejuice (Bj in Prickle1 (Pk1, a PCP component, exhibit developmental phenotypes involving cell polarity defects, including skeletal, cochlear and congenital cardiac anomalies. Bj mutants die neonatally with cardiac outflow tract (OFT malalignment. This is associated with OFT shortening due to loss of polarized cell orientation and failure of second heart field cell intercalation mediating OFT lengthening. OFT myocardialization was disrupted with cardiomyocytes failing to align with the direction of cell invasion into the outflow cushions. The expression of genes mediating Wnt signaling was altered. Also noted were shortened but widened bile ducts and disruption in canonical Wnt signaling. Using an in vitro wound closure assay, we showed Bj mutant fibroblasts cannot establish polarized cell morphology or engage in directional cell migration, and their actin cytoskeleton failed to align with the direction of wound closure. Unexpectedly, Pk1 mutants exhibited primary and motile cilia defects. Given Bj mutant phenotypes are reminiscent of ciliopathies, these findings suggest Pk1 may also regulate ciliogenesis. Together these findings show Pk1 plays an essential role in regulating cell polarity and directional cell migration during development.

Elevated Ratio of Th17 Cell-Derived Th1 Cells (CD161(+)Th1 Cells) to CD161(+)Th17 Cells in Peripheral Blood of Early-Onset Rheumatoid Arthritis Patients.

Science.gov (United States)

Kotake, Shigeru; Nanke, Yuki; Yago, Toru; Kawamoto, Manabu; Kobashigawa, Tsuyoshi; Yamanaka, Hisashi

2016-01-01

Rheumatoid arthritis (RA) is a chronic inflammatory disease characterized by the destruction of articular cartilage and bone with elevated levels of proinflammatory cytokines. It has been reported that IL-17 and Th17 cells play important roles in the pathogenesis of RA. Recently, plasticity in helper T cells has been demonstrated; Th17 cells can convert to Th1 cells. It remains to be elucidated whether this conversion occurs in the early phase of RA. Here, we tried to identify Th17 cells, Th1 cells, and Th17 cell-derived Th1 cells (CD161(+)Th1 cells) in the peripheral blood of early-onset RA patients. We also evaluated the effect of methotrexate on the ratio of Th17 cells in early-onset RA patients. The ratio of Th17 cell-derived Th1 cells to CD161(+)Th17 cells was elevated in the peripheral blood of early-onset RA patients. In addition, MTX reduced the ratio of Th17 cells but not Th1 cells. These findings suggest that IL-17 and Th17 play important roles in the early phase of RA; thus, anti-IL-17 antibodies should be administered to patients with RA in the early phase.

1+1-dimensional quantum electrodynamics as an illustration of the hypothetical structure of quark field theory

International Nuclear Information System (INIS)

Becher, P.; Joos, H.

1977-07-01

It is the aim of the main part of these lectures to show how most of the expected dynamical properties of quantum chromodynamics are realised in 1+1 dimensional quantum electrodynamics. Asymptotic freedom, the infrared limit, quark confinement and bag approximation are discussed in detail. (BJ) [de

Nav1.7 expression is increased in painful human dental pulp

Directory of Open Access Journals (Sweden)

Levinson S Rock

2008-04-01

Full Text Available Abstract Background Animal studies and a few human studies have shown a change in sodium channel (NaCh expression after inflammatory lesions, and this change is implicated in the generation of pain states. We are using the extracted human tooth as a model system to study peripheral pain mechanisms and here examine the expression of the Nav1.7 NaCh isoform in normal and painful samples. Pulpal sections were labeled with antibodies against: 1 Nav1.7, N52 and PGP9.5, and 2 Nav1.7, caspr (a paranodal protein used to identify nodes of Ranvier, and myelin basic protein (MBP, and a z-series of optically-sectioned images were obtained with the confocal microscope. Nav1.7-immunofluorescence was quantified in N52/PGP9.5-identified nerve fibers with NIH ImageJ software, while Nav1.7 expression in myelinated fibers at caspr-identified nodal sites was evaluated and further characterized as either typical or atypical as based on caspr-relationships. Results Results show a significant increase in nerve area with Nav1.7 expression within coronal and radicular fiber bundles and increased expression at typical and atypical caspr-identified nodal sites in painful samples. Painful samples also showed an augmentation of Nav1.7 within localized areas that lacked MBP, including those associated with atypical caspr-identified sites, thus identifying NaCh remodeling within demyelinating axons as the basis for a possible pulpal pain mechanism. Conclusion This study identifies the increased axonal expression and augmentation of Nav1.7 at intact and remodeling/demyelinating nodes within the painful human dental pulp where these changes may contribute to constant, increased evoked and spontaneous pain responses that characterize the pain associated with toothache.

Immersion francaise precoce: Sciences de la nature 1-7 (Early French Immersion: Natural Sciences for Grades 1-7).

Science.gov (United States)

Burt, Andy; And Others

This curriculum guide for the natural sciences is intended for use in grades 1-7 in the early French immersion program. The guide presents the following topics: (1) a list of general objectives; (2) a list of simple skills for children aged 5-8 and for children aged 8-12; (3) activities dealing with matter and its properties, space-time, and human…

Gaseous (DMS, MSA, SO2, H2SO4 and DMSO and particulate (sulfate and methanesulfonate sulfur species over the northeastern coast of Crete

Directory of Open Access Journals (Sweden)

H. Bardouki

2003-01-01

Full Text Available A detailed study of the levels, the temporal and diurnal variability of the main compounds involved in the biogenic sulfur cycle was carried out in Crete (Eastern Mediterranean during the Mediterranean Intensive Oxidant Study (MINOS field experiment in July-August 2001. Intensive measurements of gaseous dimethylsulfide (DMS, dimethylsulfoxide (DMSO, sulfur dioxide (SO2, sulfuric (H2SO4 and methanesulfonic acids (MSA and particulate sulfate (SO42- and methanesulfonate (MS- have been performed during the campaign. Dimethylsulfide (DMS levels ranged from 2.9 to 136 pmol·mol-1 (mean value of 21.7 pmol·mol-1 and showed a clear diurnal variation with daytime maximum. During nighttime DMS levels fall close or below the detection limit of 2 pmol·mol-1. Concurrent measurements of OH and NO3 radicals during the campaign indicate that NO3 levels can explain most of the observed diurnal variation of DMS. Dimethylsulfoxide (DMSO ranged between 0.02 and 10.1 pmol·mol-1 (mean value of 1.7 pmol·mol-1 and presents a diurnal variation similar to that of DMS. SO2 levels ranged from 220 to 2970 pmol·mol-1 (mean value of 1030 pmol·mol-1, while nss-SO42- and MS- ranged from 330 to 7100 pmol·mol-1, (mean value of 1440 pmol·mol-1 and 1.1 to 37.5 pmol·mol-1 (mean value of 11.5 pmol·mol-1 respectively. Of particular interest are the measurements of gaseous MSA and H2SO4. MSA ranged from below the detection limit (3x104 to 3.7x107 molecules cm-3, whereas H2SO4 ranged between 1x105 and 9.0x107 molecules cm-3. The measured H2SO4 maxima are among the highest reported in literature and can be attributed to high insolation, absence of precipitation and increased SO2 levels in the area. From the concurrent SO2, OH, and H2SO4 measurements a sticking coefficient of 0.52±0.28 was calculated for H2SO4. From the concurrent MSA, OH, and DMS measurements the yield of gaseous MSA from the OH-initiated oxidation of DMS was calculated to range between 0.1-0.4%. This low MSA

Reliability and Validity of the Beijing Version of the Montreal Cognitive Assessment in the Evaluation of Cognitive Function of Adult Patients with OSAHS.

Science.gov (United States)

Chen, Xiong; Zhang, Rui; Xiao, Ying; Dong, Jiaqi; Niu, Xun; Kong, Weijia

2015-01-01

The patients with obstructive sleep apnea hypopnea syndrome (OSAHS) tend to develop cognitive deficits, which usually go unrecognized, and can affect their daily life. The Beijing version of the Montreal cognitive assessment (MoCA-BJ), a Chinese version of MoCA, has been used for the assessment of cognitive functions of OSAHS patients in clinical practice. So far, its reliability and validity have not been tested. This study examined the reliability and validity of MoCA-BJ in a cohort of adult OSAHS patients. 152 OSAHS patients, ranging from mild, moderate to severe, 49 primary snoring subjects and 40 normal controls were evaluated for cognitive functions by employing both MoCA-BJ and the Mini Mental State Examination (MMSE). Forty of them were re-tested by MoCA-BJ 14 days after the first test. Internal consistency, test-retest reliability, discriminate and concurrent validity of MoCA-BJ were analyzed. Internal consistency reliability by Cronbach's alpha was adequate (0.73). Intra-class correlation coefficient (ICC), an measure of test-retest reliability, was 0.87 (Preliable and stable. The MoCA-BJ was capable of detecting cognitive dysfunction by visuospatial and total MoCA-BJ score.

[Directions for reoperation of patients with Björk-Shiley convexo-concave valve prosthesis, based on long-term experience].

Science.gov (United States)

Yamaki, F; Nakano, K; Endo, M; Hashimoto, A; Koyanagi, H

1994-02-01

Although a high incidence of strut fracture of the Björk-Shiley convexo-concave (C-C) valve prosthesis has been reported, it is still controversial whether the prosthesis functioning normally should be replaced electively. To clarify our policy for this issue, we reviewed 28 patients who had undergone mitral valve replacement with a C-C valve prosthesis, and evaluated long-term results according to STS guidelines. The incidence of valve-related complications expressed as % patient-year were; structural deterioration 0.30, nonstructural dysfunction 0.30, thromboembolism 1.20. There were no thrombosed valves, anticoagulant-related hemorrhage or prosthetic valve endocarditis. The actuarial free rate after valve replacement with the C-C at 10 years, constructed by the Kaplan-Meier method, were compared with those with St. Jude Medical (SJM) valve prosthesis. (1) Actuarial survival: 77.9 vs 87.3 (NS), (2) Reoperation-free: 91.6 vs 98.0 (p valve-related complications: 71.2 vs 77.7 (NS). The long-term results with the C-C were compatible to those with a SJM valve prosthesis. However, if a strut fracture occurs, it is very difficult to save the patient's life. The hospital mortality of re-replacement of valve prosthesis during the last 10 years, at our institute, was 2.6%, which is almost equal to the cumulative risk of strut fracture of the C-C valve after 10 years (3.0%).(ABSTRACT TRUNCATED AT 250 WORDS)

Strut fracture with Björk-Shiley 70 degrees convexo-concave valve. An international multi-institutional follow-up study.

Science.gov (United States)

Ericsson, A; Lindblom, D; Semb, G; Huysmans, H A; Thulin, L I; Scully, H E; Bennett, J G; Ostermeyer, J; Grunkemeier, G L

1992-01-01

Between 1980 and 1983, 831 Björk-Shiley 70 degrees convexo-concave prosthetic heart valves were implanted at five institutions in Sweden, Germany. The Netherlands, and Canada. As of January 1991, there were 34 outlet strut fractures occurring from 0.2 to 10.1 years (median = 4.6 years) after implantation. In addition, there were 28 sudden, unexplained deaths. The mortality after strut fracture was 84%. The mortality after emergency valve replacement for strut fracture was 50%. The 10-year actuarial fracture rate (standard error) was 10.5 (2.4)% for large (29-33 mm) valves vs. 3.3 (1.2)% for 21-27 mm valves (P less than 0.001). Within valve size groups, fracture rates for aortic and mitral valves were similar. Cox regression analysis found only valve size to be significantly associated with strut fracture. There is a further subgrouping of the valves according to the manufacturer: group I are the earlier large 29-33 mm) valves; group II are the later large valves; group III are the small size (21-27 mm) valves. The risk of strut fracture was highest in group I (12.3% at 10 years) with an approximatively constant hazard (1.4% per year). A comparison was made with a statistical model incorporating all cases reported to the manufacturer. This model estimates fracture rates approximately 63%-73% of those found in the present study. These findings lead us to recommend that group I patients should be considered for elective reoperation on an individual basis, giving careful attention to risk factors and contraindications.

17 CFR 240.16c-1 - Brokers.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Brokers. 240.16c-1 Section 240... Act of 1934 Exemption of Certain Transactions from Section 16(c) § 240.16c-1 Brokers. Any transaction... a broker of an order for an account in which the broker has no direct or indirect interest. ...

Decreased expression of 17β-hydroxysteroid dehydrogenase type 1 is associated with DNA hypermethylation in colorectal cancer located in the proximal colon

International Nuclear Information System (INIS)

Rawłuszko, Agnieszka Anna; Horbacka, Karolina; Krokowicz, Piotr; Jagodziński, Paweł Piotr

2011-01-01

The importance of 17β-estradiol (E2) in the prevention of large bowel tumorigenesis has been shown in many epidemiological studies. Extragonadal E2 may form by the aromatase pathway from androstenedione or the sulfatase pathway from estrone (E1) sulfate followed by E1 reduction to E2 by 17-β-hydroxysteroid dehydrogenase (HSD17B1), so HSD17B1 gene expression may play an important role in the production of E2 in peripheral tissue, including the colon. HSD17B1 expression was analyzed in colorectal cancer cell lines (HT29, SW707) and primary colonic adenocarcinoma tissues collected from fifty two patients who underwent radical colon surgical resection. Histopathologically unchanged colonic mucosa located at least 10-20 cm away from the cancerous lesions was obtained from the same patients. Expression level of HSD17B1 using quantitative PCR and western blot were evaluated. DNA methylation level in the 5' flanking region of HSD17B1 CpG rich region was assessed using bisulfite DNA sequencing and HRM analysis. The influence of DNA methylation on HSD17B1 expression was further evaluated by ChIP analysis in HT29 and SW707 cell lines. The conversion of estrone (E1) in to E2 was determined by electrochemiluminescence method. We found a significant decrease in HSD17B1 transcript (p = 0.0016) and protein (p = 0.0028) levels in colorectal cancer (CRC) from the proximal but not distal colon and rectum. This reduced HSD17B1 expression was associated with significantly increased DNA methylation (p = 0.003) in the CpG rich region located in the 5' flanking sequence of the HSD17B1 gene in CRC in the proximal but not distal colon and rectum. We also showed that 5-dAzaC induced demethylation of the 5' flanking region of HSD17B1, leading to increased occupation of the promoter by Polymerase II, and increased transcript and protein levels in HT29 and SW707 CRC cells, which contributed to the increase in E2 formation. Our results showed that reduced HSD17B1 expression can

Analysis of Th17 and Tc17 Frequencies and Antiviral Defenses in Gut-Associated Lymphoid Tissue of Chronic HIV-1 Positive Patients.

Science.gov (United States)

d'Ettorre, Gabriella; Ceccarelli, Giancarlo; Andreotti, Mauro; Selvaggi, Carla; Giustini, Noemi; Serafino, Sara; Schietroma, Ivan; Nunnari, Giuseppe; Antonelli, Guido; Vullo, Vincenzo; Scagnolari, Carolina

2015-01-01

The complex relationship between both the Th1/Th17 and Tc1/Tc17 axis and innate defences in the intestinal mucosa during HIV-1 infection has not been well characterized. This study examined the frequency, phenotype, and functional status of T cell populations in the gut-associated lymphoid tissue and peripheral blood of virologically suppressed HIV-1-infected patients on therapy, focusing on the Th1, Th17, Tc1, and Tc17 cell subsets. We found a persistent immune cell activation (CD38 and HLADR expression) into the GALT despite the higher levels of Th17 and Tc17 in respect to peripheral blood. An upregulation of type I IFN response in GALT compared to the peripheral blood compartment was also recorded. Furthermore, IFN-α/β levels were negatively related to the frequencies of Th1 naïve cells and Tc1 cell subsets (naïve, central memory, and effector memory) in the GALT. In contrast, no relationships between type I IFN response and Th1 or Tc1 cell subsets in peripheral blood compartment and between IFN-α/β and Th17/Tc17 in both GALT and peripheral blood district were recorded. These data indicate that prolonged antiretroviral treatment improves GALT immune function despite the persistence of immune activation and type I IFN response in chronic HIV-1 positive patients.

Analysis of Th17 and Tc17 Frequencies and Antiviral Defenses in Gut-Associated Lymphoid Tissue of Chronic HIV-1 Positive Patients

Directory of Open Access Journals (Sweden)

Gabriella d’Ettorre

2015-01-01

Full Text Available The complex relationship between both the Th1/Th17 and Tc1/Tc17 axis and innate defences in the intestinal mucosa during HIV-1 infection has not been well characterized. This study examined the frequency, phenotype, and functional status of T cell populations in the gut-associated lymphoid tissue and peripheral blood of virologically suppressed HIV-1-infected patients on therapy, focusing on the Th1, Th17, Tc1, and Tc17 cell subsets. We found a persistent immune cell activation (CD38 and HLADR expression into the GALT despite the higher levels of Th17 and Tc17 in respect to peripheral blood. An upregulation of type I IFN response in GALT compared to the peripheral blood compartment was also recorded. Furthermore, IFN-α/β levels were negatively related to the frequencies of Th1 naïve cells and Tc1 cell subsets (naïve, central memory, and effector memory in the GALT. In contrast, no relationships between type I IFN response and Th1 or Tc1 cell subsets in peripheral blood compartment and between IFN-α/β and Th17/Tc17 in both GALT and peripheral blood district were recorded. These data indicate that prolonged antiretroviral treatment improves GALT immune function despite the persistence of immune activation and type I IFN response in chronic HIV-1 positive patients.

Assessment of the thermodynamic properties and phase diagram of the Bi-Pd system

Czech Academy of Sciences Publication Activity Database

Vřešťál, Jan; Pinkas, J.; Watson, A.; Scott, A.; Houserová, Jana; Kroupa, Aleš

2006-01-01

Roč. 30, č. 1 (2006), s. 14-17 ISSN 0364-5916 R&D Projects: GA MŠk OC 531.001; GA MŠk OC 531.002 Institutional research plan: CEZ:AV0Z20410507 Keywords : phase diagram * ab initio calculations * calorimetry Subject RIV: BJ - Thermodynamics Impact factor: 1.432, year: 2006

27 CFR 17.131 - Formulas on TTB Form 5154.1.

Science.gov (United States)

2010-04-01

... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Formulas on TTB Form 5154.1. 17.131 Section 17.131 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... preparations, food products, flavors, flavoring extracts, or perfume which are unfit for beverage purposes and...

Dicty_cDB: Contig-U11964-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available .. 42 0.87 4 ( EK022497 ) 1092955341513 Global-Ocean-Sampling_GS-31-01-01-1... 48 1.1 1 ( EL474594 ) CHUL2538.b1_C12.ab1 CHU(LMS) puz...zle sunflower Hel... 48 1.1 1 ( BJ370153 ) Dictyostelium

76 FR 61098 - Guidance for 1-Hour SO2

Science.gov (United States)

2011-10-03

...Notice is hereby given that the EPA has posted its draft non- binding guidance titled, ``Guidance for 1-Hour SO2 NAAQS SIP Submissions'' on its Web site. The EPA invites public comments on this guidance document during the comment period specified below, and plans to issue an updated version of the guidance after reviewing timely submitted comments.

T-cell clones from Th1, Th17 or Th1/17 lineages and their signature cytokines have different capacity to activate endothelial cells or synoviocytes.

Science.gov (United States)

Lavocat, Fabien; Maggi, Laura; Annunziato, Francesco; Miossec, Pierre

2016-12-01

To compare the direct effect of cytokines on synoviocytes and endothelial cells to the effects of supernatants from Th1, Th17 and Th1/17 clones and the direct cell-cell interactions with the same clones. Th17 and Th1/17 clones were obtained from the CD161+CCR6+ fraction and Th1 clones from the CD161-CCR6- fraction of human CD4+ T-cells. Endothelial cells or synoviocytes were cultured in the presence of either isolated pro-inflammatory cytokines (IL-17 and/or TNF-α) or supernatants from the T-cell clones or co-cultured with T-cell clones themselves. IL-6 and IL-8 expression and production were analyzed. IL-17 and TNF-α induced IL-6 and IL-8 expression, although IL-17 alone had a limited effect on endothelial cells compared to synoviocytes. Supernatants from activated T-helper clones also induced IL-6 and IL-8 expression but with discrepancies between endothelial cells and synoviocytes. Endothelial cells were mostly activated by Th1 clone supernatants whereas synoviocytes were activated by all T-cell subtypes. Finally, cell-cell contact experiments showed a great heterogeneity among cell clones, even from the same lineage. IL-6 expression was mostly induced by contact with Th1 clones both in endothelial and mesenchymal cells whereas IL-8 expression was induced by all T-cell clones whatever their phenotype. We showed that endothelial cells were much more sensitive to Th1 activation whereas synoviocytes were activated by all T-helper lineages. This work highlights the heterogeneity of interactions between T-cells and stromal cells through soluble factors or direct cell contact. Copyright © 2016 Elsevier Ltd. All rights reserved.

Neuroprotective Mechanisms of the ACE2-Angiotensin-(1-7)-Mas Axis in Stroke

DEFF Research Database (Denmark)

Bennion, Douglas M; Haltigan, Emily; Regenhardt, Robert W

2015-01-01

The discovery of beneficial neuroprotective effects of the angiotensin converting enzyme 2-angiotensin-(1-7)-Mas axis [ACE2-Ang-(1-7)-Mas] in ischemic and hemorrhagic stroke has spurred interest in a more complete characterization of its mechanisms of action. Here, we summarize findings that desc......The discovery of beneficial neuroprotective effects of the angiotensin converting enzyme 2-angiotensin-(1-7)-Mas axis [ACE2-Ang-(1-7)-Mas] in ischemic and hemorrhagic stroke has spurred interest in a more complete characterization of its mechanisms of action. Here, we summarize findings...... that describe the protective role of the ACE2-Ang-(1-7)-Mas axis in stroke, along with a focused discussion on the potential mechanisms of neuroprotective effects of Ang-(1-7) in stroke. The latter incorporates evidence describing the actions of Ang-(1-7) to counter the deleterious effects of angiotensin II...... complete understanding of the mechanisms of action of Ang-(1-7) to elicit neuroprotection will serve as an essential step toward research into potential targeted therapeutics in the clinical setting....

Th1-Th17 Ratio as a New Insight in Rheumatoid Arthritis Disease.

Science.gov (United States)

Bazzazi, Hadi; Aghaei, Mehrdad; Memarian, Ali; Asgarian-Omran, Hossein; Behnampour, Nasser; Yazdani, Yaghoub

2018-02-01

The Th17, Th1 and dual Th17/Th1 cells are important players in rheumatoid arthritis (RA) disease. To assess their roles, the frequency and impact of these cells were investigated in patients with different disease activity. In 14 new cases and 41 established RA patients in comparison with 22 healthy controls, the percentages of Th17, Th1 and dual Th17/Th1 cells were determined by flow-cytometry and their correlations were investigated with disease activity score (DAS28). Moreover, serum levels of IL-6 and IL-17 as inducer and functional cytokines for Th17 were investigated. Finally, serum levels of anti citrullinated protein antibody (ACPA) and rheumatoid factor (RF) were assessed. Percentage of Th17 cells in RA patients were increased in comparison with healthy controls (pTh1 cells in RA patients were less than healthy group (pTh17/Th1 cell only in new cases of RA were more than healthy control groups (pTh1/Th17 ratio in RA patients is statistically different with healthy control group (pTh1/Th17 ratio in RA patient suggested a new paradigm in the field of autoimmune disease and indicated that imbalance or plasticity between these subsets can be important in progress, diagnosis and therapy of RA disease.

Isopiestic Investigation of the Osmotic and Activity Coefficients of {yMgCl2 + (1 - y)MgSO4}(aq) and the Osmotic Coefficients of Na2SO4.MgSO4(aq) at 298.15 K

Energy Technology Data Exchange (ETDEWEB)

Miladinovic, J; Ninkovic, R; Todorovic, M; Rard, J A

2007-06-06

Isopiestic vapor pressure measurements were made for {l_brace}yMgCl{sub 2} + (1-y)MgSO{sub 4}{r_brace}(aq) solutions with MgCl{sub 2} ionic strength fractions of y = 0, 0.1997, 0.3989, 0.5992, 0.8008, and (1) at the temperature 298.15 K, using KCl(aq) as the reference standard. These measurements for the mixtures cover the ionic strength range I = 0.9794 to 9.4318 mol {center_dot} kg{sup -1}. In addition, isopiestic measurements were made with NaCl(aq) as reference standard for mixtures of {l_brace}xNa{sub 2}SO{sub 4} + (1-x)MgSO{sub 4}{r_brace}(aq) with the molality fraction x = 0.50000 that correspond to solutions of the evaporite mineral bloedite (astrakanite), Na{sub 2}Mg(SO{sub 4}){sub 2} {center_dot} 4H{sub 2}O(cr). The total molalities, m{sub T} = m(Na{sub 2}SO{sub 4}) + m(MgSO{sub 4}), range from m{sub T} = 1.4479 to 4.4312 mol {center_dot} kg{sup -1} (I = 5.0677 to 15.509 mol {center_dot} kg{sup -1}), where the uppermost concentration is the highest oversaturation molality that could be achieved by isothermal evaporation of the solvent at 298.15 K. The parameters of an extended ion-interaction (Pitzer) model for MgCl2(aq) at 298.15 K, which were required for an analysis of the {l_brace}yMgCl{sub 2} + (1-y)MgSO{sub 4}{r_brace}(aq) mixture results, were evaluated up to I = 12.025 mol {center_dot} kg{sup -1} from published isopiestic data together with the six new osmotic coefficients obtained in this study. Osmotic coefficients of {l_brace}yMgCl{sub 2} + (1-y)MgSO{sub 4}{r_brace}(aq) solutions from the present study, along with critically-assessed values from previous studies, were used to evaluate the mixing parameters of the extended ion-interaction model.

Sequence analysis of 17 NRXN1 deletions

DEFF Research Database (Denmark)

Hoeffding, Louise Kristine Enggaard; Hansen, Thomas; Ingason, Andrés

2014-01-01

into the molecular mechanisms governing such genomic rearrangements may increase our understanding of disease pathology and evolutionary processes. Here we analyse 17 carriers of non-recurrent deletions in the NRXN1 gene, which have been associated with neurodevelopmental disorders, e.g. schizophrenia, autism...

VizieR Online Data Catalog: Stellar encounters with long-period comets (Feng+, 2015)

Science.gov (United States)

Feng, F.; Bailer-Jones, C. A. L.

2016-07-01

We have conducted simulations of the perturbation of the Oort cloud in order to estimate the significance of known encounters in generating long-period comets. We collected the data of stellar encounters from three sources: (Bailer-Jones, 2015, Cat. J/A+A/575/A35, hereafter BJ15), Dybczynski & Berski (2015MNRAS.449.2459D), and Mamajek et al. (2015ApJ...800L..17M). Following BJ15, we use the term 'object' to refer to each encountering star in our catalogue. A specific star may appear more than once but with different data, thus leading to a different object. (1 data file).

The role of Th1 and Th17 cells in glomerulonephritis.

Science.gov (United States)

Azadegan-Dehkordi, Fatemeh; Bagheri, Nader; Shirzad, Hedayatollah; Rafieian-Kopaei, Mahmoud

2015-04-01

T helper (Th) cells as an important part of the immune is responsible for elimination of invading pathogens. But, if Th cell responses are not regulated effectively, the autoimmune diseases might develop. The Th17 subset usually produces interleukin-17A which in experimental models of organ-specific autoimmune inflammation is very important. Directory of open access journals (DOAJ), Google Scholar, Embase, Scopus, PubMed and Web of Science have been searched. Fifty-six articles were found and searched. In the present review article, we tried to summarize the recently published data about characteristics and role of Th1 and Th17 cells and discuss in detail, the potential role of these T helpers immune responses in renal inflammation and renal injury, focusing on glomerulonephritis. Published papers in animal and human studies indicated that autoimmune diseases such as rheumatoid arthritis and multiple sclerosis, classically believed to be Th1-mediated, are mainly derived from a Th17 immune response. Identification of the Th17 subgroup has explained seemingly paradoxical observations and improved our understanding of immune-mediated inflammatory responses. Secretion of IL-17A, as well as IL-17F, IL-21, IL-22, suggests that Th17 subset may play a crucial role as a pleiotropic pro-inflammatory Th subset. There is experimental evidence to support the notion that Th1 and Th17 cells contribute to kidney injury in renal inflammatory diseases like glomerulonephritis.

Microdeletion in distal 17p13.1

DEFF Research Database (Denmark)

Zeesman, Susan; Kjaergaard, Susanne; Hove, Hanne Buciek

2012-01-01

Array comparative genomic hybridization has led to the identification of new syndromes by identifying genomic imbalances not detectable by standard karyotyping methods and by allowing correlations with physical findings. Deletions in the 17p13.1 region have been reported in patients with dysmorphic...

Structural Characterization of 1,1,3,3-Tetramethylguanidinium Chloride Ionic Liquid by Reversible SO2 Gas Absorption

DEFF Research Database (Denmark)

Berg, Rolf W.; Harris, Pernille; Riisager, Anders

2013-01-01

A unique new ionic liquid−gas adduct solid state compound formed between 1,1,3,3-tetramethylguanidinium chloride ([tmgH]Cl) and sulfur dioxide has been characterized by X-ray diffraction and Raman spectroscopy. The structure contains SO2 molecules of near normal structure kept at their positions ...... with bromide and iodide are discussed. Some of these salts may prove useful as reversible absorbents of SO2 in industrial flue gases....

Ang-(1-7) exerts protective role in blood-brain barrier damage by the balance of TIMP-1/MMP-9.

Science.gov (United States)

Wu, Jitao; Zhao, Duo; Wu, Shuang; Wang, Dan

2015-02-05

Cerebrovascular disease (CVD) ranks as the top three health risks, specially cerebral ischemia characterized with the damage of blood-brain barrier (BBB). The angiotensin Ang-(1-7) was proven to have a protective effect on cerebrovascular diseases. However, its role on blood-brain barrier and the underlying molecular mechanism remains unclear. In this study, Ang-(1-7) significantly relieved damage of ischemia reperfusion injury on blood-brain barrier in cerebral ischemia reperfusion injury (IRI) rats. Furthermore, its treatment attenuated BBB permeability and brain edema. Similarly, Ang-(1-7) also decreased the barrier permeability of brain endothelial cell line RBE4. Further analysis showed that Ang-(1-7) could effectively restore tight junction protein (claudin-5 and zonula occludens ZO-1) expression levels both in IRI-rats and hypoxia-induced RBE4 cells. Furthermore, Ang-(1-7) stimulation down-regulated hypoxia-induced matrix metalloproteinase-9 (MMP-9) levels, whose silencing with (matrix metalloproteinase-9 hemopexin domain) MMP9-PEX inhibitor significantly increased the expression of claudin-5 and ZO-1. Further mechanism analysis demonstrated that Ang-(1-7) might junction protein levels by tissue inhibitor of metalloproteinase 1 (TIMP1)-MMP9 pathway, because Ang-(1-7) enhanced TIMP1 expression, whose silencing obviously attenuated the inhibitor effect of Ang-(1-7) on MMP-9 levels and decreased Ang-(1-7)-triggered increase in claudin-5 and ZO-1. Together, this study demonstrated a protective role of Ang-(1-7) in IRI-induced blood-brain barrier damage by TIMP1-MMP9-regulated tight junction protein expression. Accordingly, Ang-(1-7) may become a promising therapeutic agent against IRI and its complications. Copyright © 2014 Elsevier B.V. All rights reserved.

Low-Temperature and High-Pressure p-rho-T Relation for 1-(2-Methoxyethyl)-1-methylpyrrolidinium Bis(trifluoromethylsulfonyl)imide and 1-C-n-3-methylimidazolium Thiocyanate with n=2 and 4

Czech Academy of Sciences Publication Activity Database

Klomfar, Jaroslav; Součková, Monika; Pátek, Jaroslav

2015-01-01

Roč. 60, č. 6 (2015), s. 1855-1867 ISSN 0021-9568 R&D Projects: GA ČR GA13-00145S Institutional support: RVO:61388998 Keywords : ionic liquid * 1-(2-Methoxyethyl)-1-methylpyrrolidinium bis(trifluoromethylsulfonyl)imide * thiocyanate anion * experimental pvT data Subject RIV: BJ - Thermodynamics Impact factor: 1.835, year: 2015

Angiotensin-(1-7) attenuates hyposmolarity-induced ANP secretion via the Na+-K+ pump.

Science.gov (United States)

Shah, Amin; Oh, Young-Bin; Shan, Gao; Song, Chang Ho; Park, Byung-Hyun; Kim, Suhn Hee

2010-09-01

The alteration in osmolarity challenges cell volume regulation, a vital element for cell survival. Hyposmolarity causes an increase in cell volume. Recently, it has been reported that the renin-angiotensin system (RAS) plays a role in cell volume regulation. We investigated the effect of angiotensin-(1-7) [Ang-(1-7)] on hyposmolarity-induced atrial natriuretic peptide (ANP) secretion in normal and diabetic (DM) rat atria and modulation of the effect of Ang-(1-7) by the Na(+)-K(+) pump. Using isolated control rat atria, we observed that perfusion of hyposmotic solution into the atria increased ANP secretion. When Ang-(1-7) [0.1 microM or 1 microM] was perfused in a hyposmolar solution, it decreased the hyposmolarity-induced ANP secretion in a dose-dependent manner. This effect of Ang-(1-7) could be mediated by the Na(+)-K(+) pump, since ouabain, an Na(+)-K(+) pump inhibitor, significantly decreased the effect of Ang-(1-7) on hyposmolarity-induced ANP secretion. In contrast, N(omega) Nitro-l-arginine methyl ester hydrochloride (l-NAME) did not modify the effect of Ang-(1-7) on the hyposmolarity-induced ANP secretion. Interestingly, the ANP secretion was increased robustly by the perfusion of the hyposmolar solution in the DM atria, as compared to the control atria. However, the inhibitory effect of Ang-(1-7) on the hyposmolarity-induced ANP secretion was not observed in the DM atria. In the DM atria, atrial contractility was significantly increased. Taken together, we concluded that Ang-(1-7) attenuated hyposmolarity-induced ANP secretion via the Na(+)-K(+) pump and a lack of Ang-(1-7) response in DM atria may partly relate to change in Na(+)-K(+) pump activity. Copyright 2010 Elsevier Inc. All rights reserved.

The Parity of Set Systems under Random Restrictions with Applications to Exponential Time Problems

DEFF Research Database (Denmark)

Björklund, Andreas; Dell, Holger; Husfeldt, Thore

2015-01-01

problems. We find three applications of our reductions: 1. An exponential-time algorithm: We show how to decide Hamiltonicity in directed n-vertex graphs with running time 1.9999^n provided that the graph has at most 1.0385^n Hamiltonian cycles. We do so by reducing to the algorithm of Björklund...

1H and 2H NMR relaxation study on the phase transitions of (NH4)3H(SO4)2 and (ND4)3D(SO4)2 single crystals

International Nuclear Information System (INIS)

Lim, Ae Ran; Jeong, Se-Young

2006-01-01

T 1 , T 1ρ and T 2 for the 1 H and 2 H nuclei in (NH 4 ) 3 H(SO 4 ) 2 and (ND 4 ) 3 D(SO 4 ) 2 single crystals grown using the slow evaporation method were measured for phases I, II, III, IV and V. The 1 H T 1 , T 1ρ , and T 2 values were found to exhibit different trends in phases II and III: T 1 , T 1ρ and T 2 for 1 H do not change significantly near the phase transition at 265 K, whereas near 413 K they change discontinuously. We conclude that the NH 4 + and H(SO 4 ) 2 - ions do not play an important role in the III-II phase transition, but do play important roles in the II-I phase transition. The liquid-like nature of the 1 H T 1ρ and T 2 above 413 K is indicative of the destruction and reconstruction of hydrogen bonds. Moreover, the phase transitions of the (NH 4 ) 3 H(SO 4 ) 2 crystal are accompanied by changes in the molecular motion of the (NH 4 ) + ions. The variations with temperature of the 2 H T 1 and T 2 of (ND 4 ) 3 D(SO 4 ) 2 crystals are not similar to those observed for the 1 H T 1 and T 2 . Our comparison of the results for (NH 4 ) 3 H(SO 4 ) 2 and (ND 4 ) 3 D(SO 4 ) 2 crystals indicates the following: the 1 H T 1ρ and T 2 of the (NH 4 ) + and H(SO 4 ) 2 - ions above T C1 are characteristic of fast, liquid-like motion, which is not the case for (ND 4 ) 3 D(SO 4 ) 2 ; and the 2 H T 1 of D(SO 4 ) 2 - in (ND 4 ) 3 D(SO 4 ) 2 is longer than the 2 H T 1 of (ND 4 ) + in contrast to the results for (NH 4 ) 3 H(SO 4 ) 2 crystals

Diffractive Dijet Production in $\\bar{p}p$ Collisions at $\\sqrt{s}=1.96$ TeV

Energy Technology Data Exchange (ETDEWEB)

Aaltonen, T.; /Helsinki Inst. of Phys.; Albrow, M.; /Fermilab; Alvarez Gonzalez, B.; /Oviedo U. /Cantabria Inst. of Phys.; Amerio, S.; /INFN, Padua; Amidei, D.; /Michigan U.; Anastassov, A.; /Northwestern U. /Fermilab; Annovi, A.; /Frascati; Antos, J.; /Comenius U.; Apollinari, G.; /Fermilab; Appel, J.A.; /Fermilab; Arisawa, T.; /Waseda U. /Dubna, JINR

2012-06-01

We report on a study of diffractive dijet production in {bar p}p collisions at {radical}s = 1.96 TeV using the CDF II detector at the Fermilab Tevatron {bar p}p collider. A data sample from 310 pb{sup -1} of integrated luminosity collected by triggering on a high transverse energy jet, E{sub T}{sup jet}, in coincidence with a recoil antiproton detected in a Roman pot spectrometer is used to measure the ratio of single-diffractive to inclusive-dijet event rates as a function of x{sup {bar p}} of the interacting parton in the antiproton, the Bjorken-x, x{sub Bj}{sup {bar p}}, and a Q{sup 2} {approx} (E{sub T}{sup jet}){sup 2} in the ranges 10{sup -3} < x{sub Bj}{sup {bar p}} < 10{sup -1} and 10{sup 2} < Q{sup 2} < 10{sup 4} GeV{sup 2}, respectively. Results are presented for the region of {bar p}-momentum-loss fraction 0.03 < {zeta}{sub {bar p}} < 0.09 and a four-momentum transfer squared t{sub {bar p}} > -4 GeV{sup 2}. The t{sub {bar p}} dependence is measured as a function of Q{sup 2} and x{sub Bj}{sup {bar p}} and compared with that of inclusive single diffraction dissociation. We find weak x{sub Bj}{sup bar p}} and Q{sup 2} dependencies in the ratio of single diffractive to inclusive event rates, and no significant Q{sup 2} dependence in the diffractive t{sub {bar p}} distributions.

Strut fracture of Björk-Shiley convexo-concave valve in Japan--risk of small valve size--.

Science.gov (United States)

Watarida, S; Shiraishi, S; Nishi, T; Imura, M; Yamamoto, Y; Hirokawa, R; Fujita, M

2001-08-01

The Björk-Shiley convexo-concave (BSCC) prosthetic valve was introduced in 1979. Between 1979 and 1986, approximately 86,000 BSCC valves were implanted. By December 31, 1994, 564 complete strut fractures had been reported to the manufacture. We experienced a case of an outlet strut fracture and investigated the risk of BSCC prosthetic valve fractures in Japan. To investigate the risk factor of a strut fracture in Japan, we investigated published cases of strut fractures. Between 1979 and 1986, 2021 BSCC valves were implanted in Japan. By January 31, 2000, 11 complete strut fractures of 60-degree BSCC valves including our case had occurred. The patients were eight males and three females. The average age at valve replacement was 42.4+/-8.1 years, and nine of eleven (81.8%) were patients valve fractured was 47.7+/-6.4 years, and eight of eleven (72.7%) were patients valve were 27 mm (n=5) (45.5%), 29 mm (n=3) (27.2%), and 31 mm (n=3) (27.2%). Four patients died and seven patients survived. Although only 11 BSCC valve struts fractured and statistical analysis could not be performed, our findings suggest that the high risk group for a strut fracture in Japan is young male patients with a mitral valve, >= 27 mm in size with BSCC models manufactured before March 1982. When following-up patients with BSCC models manufactured before March 1982, the possibility of a strut fracture in all BSCC valve sizes should be kept in mind.

Thioredoxin-1 Negatively Modulates ADAM17 Activity Through Direct Binding and Indirect Reductive Activity.

Science.gov (United States)

Granato, Daniela C; E Costa, Rute A P; Kawahara, Rebeca; Yokoo, Sami; Aragão, Annelize Z; Domingues, Romênia R; Pauletti, Bianca A; Honorato, Rodrigo V; Fattori, Juliana; Figueira, Ana Carolina M; Oliveira, Paulo S L; Consonni, Silvio R; Fernandes, Denise; Laurindo, Francisco; Hansen, Hinrich P; Paes Leme, Adriana F

2018-02-27

A disintegrin and metalloprotease 17 (ADAM17) modulates signaling events by releasing surface protein ectodomains such as TNFa and the EGFR-ligands. We have previously characterized cytoplasmic thioredoxin-1 (Trx-1) as a partner of ADAM17 cytoplasmic domain. Still, the mechanism of ADAM17 regulation by Trx-1 is unknown, and it has become of paramount importance to assess the degree of influence that Trx-1 has on metalloproteinase ADAM17. Combining discovery and targeted proteomic approaches, we uncovered that Trx-1 negatively regulates ADAM17 by direct and indirect effect. We performed cell-based assays with synthetic peptides and site-directed mutagenesis, and we demonstrated that the interaction interface of Trx-1 and ADAM17 is important for the negative regulation of ADAM17 activity. However, both Trx-1 K72A and catalytic site mutant Trx-1 C32/35S rescued ADAM17 activity, although the interaction with Trx-1 C32/35S was unaffected, suggesting an indirect effect of Trx-1. We confirmed that the Trx-1 C32/35S mutant showed diminished reductive capacity, explaining this indirect effect on increasing ADAM17 activity through oxidant levels. Interestingly, Trx-1 K72A mutant showed similar oxidant levels to Trx-1 C32/35S , even though its catalytic site was preserved. We further demonstrated that the general reactive oxygen species inhibitor, Nacetylcysteine (NAC), maintained the regulation of ADAM17 dependent of Trx-1 reductase activity levels; whereas the electron transport chain modulator, rotenone, abolished Trx-1 effect on ADAM17 activity. We show for the first time that the mechanism of ADAM17 regulation, Trx-1 dependent, can be by direct interaction and indirect effect, bringing new insights into the cross-talk between isomerases and mammalian metalloproteinases. This unexpected Trx-1 K72A behavior was due to more dimer formation and, consequently, the reduction of its Trx-1 reductase activity, evaluated through dimer verification, by gel filtration and mass

47 CFR 17.1 - Basis and purpose.

Science.gov (United States)

2010-10-01

... antenna structure owners. The standards are referenced from two Federal Aviation Administration (FAA... STRUCTURES General Information § 17.1 Basis and purpose. (a) The rules in this part are issued pursuant to the authority contained in Title III of the Communications Act of 1934, as amended, which vest...

Enhanced activity of an angiotensin-(1-7) neuropeptidase in glucocorticoid-induced fetal programming.

Science.gov (United States)

Marshall, Allyson C; Shaltout, Hossam A; Pirro, Nancy T; Rose, James C; Diz, Debra I; Chappell, Mark C

2014-02-01

We previously identified angiotensin converting enzyme (ACE) and an endopeptidase activity that degraded angiotensin-(1-7) [Ang-(1-7)] to Ang-(1-5) and Ang-(1-4), respectively, in the cerebrospinal fluid (CSF) of 6-month old male sheep. The present study undertook a more comprehensive analysis of the CSF peptidase that converts Ang-(1-7) to Ang-(1-4) in control and in utero betamethasone-exposed sheep (BMX). Characterization of the Ang-(1-7) peptidase revealed that the thiol agents 4-aminophenylmercuric acetate (APMA) and p-chloromercuribenzoic acid (PCMB), as well as the metallo-chelators o-phenanthroline and EDTA essentially abolished the enzyme activity. Additional inhibitors for serine, aspartyl, and cysteine proteases, as well as selective inhibitors against the endopeptidases neprilysin, neurolysin, prolyl and thimet oligopeptidases did not attenuate enzymatic activity. Competition studies against the peptidase revealed similar IC50s for Ang-(1-7) (5μM) and Ang II (3μM), but lower values for Ala(1)-Ang-(1-7) and Ang-(2-7) of 1.8 and 2.0μM, respectively. In contrast, bradykinin exhibited a 6-fold higher IC50 (32μM) than Ang-(1-7) while neurotensin was a poor competitor. Mean arterial pressure (78±1 vs. 94±2mmHg, N=4-5, Pfetal programming. Copyright © 2013 Elsevier Inc. All rights reserved.

17 CFR 259.0-1 - Availability of forms.

Science.gov (United States)

2010-04-01

... may inspect the forms at this address and at the Commission's regional and district offices. (See... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Availability of forms. 259.0-1 Section 259.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS...

47 CFR 17.17 - Existing structures.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 1 2010-10-01 2010-10-01 false Existing structures. 17.17 Section 17.17... STRUCTURES Federal Aviation Administration Notification Criteria § 17.17 Existing structures. (a) The requirements found in § 17.23 relating to painting and lighting of antenna structures shall not apply to those...

17 CFR 239.0-1 - Availability of forms.

Science.gov (United States)

2010-04-01

... F Street, NE, Washington, DC 20549. Any persons may inspect the forms at this address and at the... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Availability of forms. 239.0-1 Section 239.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION FORMS PRESCRIBED...

Design of a MCoTI-Based Cyclotide with Angiotensin (1-7-Like Activity

Directory of Open Access Journals (Sweden)

Teshome Aboye

2016-01-01

Full Text Available We report for the first time the design and synthesis of a novel cyclotide able to activate the unique receptor of angiotensin (1-7 (AT1-7, the MAS1 receptor. This was accomplished by grafting an AT1-7 peptide analog onto loop 6 of cyclotide MCoTI-I using isopeptide bonds to preserve the α-amino and C-terminal carboxylate groups of AT1-7, which are required for activity. The resulting cyclotide construct was able to adopt a cyclotide-like conformation and showed similar activity to that of AT1-7. This cyclotide also showed high stability in human serum thereby providing a promising lead compound for the design of a novel type of peptide-based in the treatment of cancer and myocardial infarction.

18 CFR 1.102 - Words denoting number, gender and so forth.

Science.gov (United States)

2010-04-01

... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Words denoting number... Rules of Construction § 1.102 Words denoting number, gender and so forth. In determining the meaning of...) Words of one gender include the other gender. [Order 225, 47 FR 19022, May 3, 1982] ...

17 CFR 249.0-1 - Availability of forms.

Science.gov (United States)

2010-04-01

..., 100 F Street, NE, Washington, DC 20549. Any person may inspect the forms at this address and at the... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Availability of forms. 249.0-1 Section 249.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) FORMS...

17 CFR 209.0-1 - Availability of forms.

Science.gov (United States)

2010-04-01

... may inspect the forms at this address and at the Commission's regional offices. (See § 200.11 of this... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Availability of forms. 209.0-1 Section 209.0-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION FORMS PRESCRIBED...

[Effects of T helper 1 cells and T helper 17 cells secreting cytokines on rat models of experimental periodontitis].

Science.gov (United States)

Wang, Z X; Yang, L; Tan, J Y; Chen, L L

2017-12-09

Objectvie: To investigate the effects of secreting cytokines interferon-gamma (IFN-γ) and interleukin-17 (IL-17) of T helper 1 cells (Th1) and T helper 17 cells (Th17) on the peripheral blood and alveolar bone destruction, so as to provide a new explanation for cellular immunity-mediated alveolar bone destruction. Methods: Eighteen eight-week-old male Sprague-Dawley rats were divided, randomly and equally, into 3 groups: lipopolysaccharide (LPS) group, ligation group and normal control group. In the LPS group, Escherichia coli LPS was injected into the alveolar mucosa on the buccalmedian site of the left upper first molar, while the right upper first molar was injected with equal volume of physiological saline as self-controls. The injections were performed every other day for four times totally. In the ligation group, the left upper first molars were ligatured with 0.2 mm orthodontic cords, while the right upper first molars were left untreated as self-controls, and supplemented with high-sugar diet to promote the periodontitis status. The rats in normal control group were fed normally. The concentrations of IFN-γ and IL-17 in peripheral blood were measured using enzyme linked immunosorbent assay (ELISA) method at the fourth week after the start of injection and at the eighth week after ligation. The histological of periodontal tissues were observed after hematoxylin-eosin (HE) staining and osteoclast count was performed under light microscope. The histological of osteoclasts were observed after tartrate-resistant acid phosphatase (TRAP) staining. Expression of IFN-γ and IL-17 were detected by immunohistochemical assay. Results: The concentrations of IFN-γ in peripheral blood of LPS group [(185.0±50.7) ng/L] and ligation group [(202.9±60.4) ng/L] were significantly higher than that of normal control group [(106.3±17.2) ng/L]( Pperiodontitis and alveolar bone resorption could be successfully established by means of ligationand LPS injection, respectively

Magnetic anisotropy of some R2CO17 compounds

International Nuclear Information System (INIS)

Khan, W.I.; Melville, D.

1978-01-01

The singular-point detection technique, in which the second derivative of the magnetization with respect to field is examined, has been used to determine the anisotropy field Bsub(A) = (2/Msub(s)) (K 1 + 2K 2 ) for Sm 2 Co 17 , Er 2 Co 17 , and Tm 2 Co 17 over the temperature range 77 - 300 K. Exrapolation of the initial part of the hard-direction magnetization curve for aligned powders enables K 1 and K 2 to be estimated. For Er 2 Co 17 and Tm 2 Co 17 the rare-earth (R) and cobalt sublattices are oppositely aligned, so that the onset of ordering of the R sublattice leads to a decrease in saturation magnetization as the temperature is lowered. This is in sharp contrast to the rapid increase in K 1 at low temperatures. By subtracting the corresponding Msub(s) values from that of Y 2 Co 17 the temperature dependence of the R sublattice can be determined. It is found that K 1 is directly proportional to the cube of this quantity, indicating the dominance of the rare-earth sublattice in determining the anisotropic properties of these compounds. For Sm 2 Co 17 the anisotropy constant varies very strongly with the reduced magnetization. (author)

Inflammasome and Fas-Mediated IL-1β Contributes to Th17/Th1 Cell Induction in Pathogenic Bacterial Infection In Vivo.

Science.gov (United States)

Uchiyama, Ryosuke; Yonehara, Shin; Taniguchi, Shun'ichiro; Ishido, Satoshi; Ishii, Ken J; Tsutsui, Hiroko

2017-08-01

CD4 + Th cells play crucial roles in orchestrating immune responses against pathogenic microbes, after differentiating into effector subsets. Recent research has revealed the importance of IFN-γ and IL-17 double-producing CD4 + Th cells, termed Th17/Th1 cells, in the induction of autoimmune and inflammatory diseases. In addition, Th17/Th1 cells are involved in the regulation of infection caused by the intracellular bacterium Mycobacterium tuberculosis in humans. However, the precise mechanism of Th17/Th1 induction during pathogen infection is unclear. In this study, we showed that the inflammasome and Fas-dependent IL-1β induces Th17/Th1 cells in mice, in response to infection with the pathogenic intracellular bacterium Listeria monocytogenes In the spleens of infected wild-type mice, Th17/Th1 cells were induced, and expressed T-bet and Rorγt. In Pycard -/- mice, which lack the adaptor molecule of the inflammasome (apoptosis-associated speck-like protein containing a caspase recruitment domain), Th17/Th1 induction was abolished. In addition, the Fas-mediated IL-1β production was required for Th17/Th1 induction during bacterial infection: Th17/Th1 induction was abolished in Fas -/- mice, whereas supplementation with recombinant IL-1β restored Th17/Th1 induction via IL-1 receptor 1 (IL-1R1), and rescued the mortality of Fas -/- mice infected with Listeria IL-1R1, but not apoptosis-associated speck-like protein containing a caspase recruitment domain or Fas on T cells, was required for Th17/Th1 induction, indicating that IL-1β stimulates IL-1R1 on T cells for Th17/Th1 induction. These results indicate that IL-1β, produced by the inflammasome and Fas-dependent mechanisms, contributes cooperatively to the Th17/Th1 induction during bacterial infection. This study provides a deeper understanding of the molecular mechanisms underlying Th17/Th1 induction during pathogenic microbial infections in vivo. Copyright © 2017 by The American Association of Immunologists

76 FR 66925 - Guidance for 1-Hour SO2

Science.gov (United States)

2011-10-28

...The EPA is announcing an extension of the public comment period for its draft non-binding guidance titled, ``Guidance for 1-Hour SO2 SIP Submissions.'' The draft of the guidance document is currently on the EPA's Web site. The EPA is extending the comment period for an additional 30-day period and invites public comments on this guidance during this period. The EPA plans to issue an updated version of the guidance after reviewing timely submitted comments.

Novel Guanidinium-Based Ionic Liquids for Highly Efficient SO2 Capture.

Science.gov (United States)

Lu, Xiaoxing; Yu, Jing; Wu, Jianzhou; Guo, Yongsheng; Xie, Hujun; Fang, Wenjun

2015-06-25

The application of ionic liquids (ILs) for acidic gas absorption has long been an interesting and challenging issue. In this work, the ethyl sulfate ([C2OSO3](-)) anion has been introduced into the structure of guanidinium-based ILs to form two novel low-cost ethyl sulfate ILs, namely 2-ethyl-1,1,3,3-tetramethylguanidinium ethyl sulfate ([C2(2)(C1)2(C1)2(3)gu][C2OSO3]) and 2,2-diethyl-1,1,3,3-tetramethylguanidinium ethyl sulfate ([(C2)2(2)(C1)2(C1)2(3)gu][C2OSO3]). The ethyl sulfate ILs, together with 2-ethyl-1,1,3,3-tetramethylguanidinium bis(trifluoromethylsulfonyl)imide ([C2(2)(C1)2(C1)2(3)gu][NTf2]) and 2,2-diethyl-1,1,3,3-tetramethylguanidinium bis(trifluoromethylsulfonyl)imide ([(C2)2(2)(C1)2(C1)2(3)gu][NTf2]), are employed to evaluate the SO2 absorption and desorption performance. The recyclable ethyl sulfate ILs demonstrate high absorption capacities of SO2. At a low pressure of 0.1 bar and at 20 °C, 0.71 and 1.08 mol SO2 per mole of IL can be captured by [C2(2)(C1)2(C1)2(3)gu][C2OSO3] and [(C2)2(2)(C1)2(C1)2(3)gu][C2OSO3], respectively. The absorption enthalpy for SO2 absorption with [C2(2)(C1)2(C1)2(3)gu][C2OSO3] and [(C2)2(2)(C1)2(C1)2(3)gu][C2OSO3] are -3.98 and -3.43 kcal mol(-1), respectively. While those by [C2(2)(C1)2(C1)2(3)gu][NTf2] and [(C2)2(2)(C1)2(C1)2(3)gu][NTf2] turn out to be only 0.17 and 0.24 mol SO2 per mole of IL under the same conditions. It can be concluded that the guanidinium ethyl sulfate ILs show good performance for SO2 capture. Quantum chemistry calculations reveal nonbonded weak interactions between the ILs and SO2. The anionic moieties of the ILs play an important role in SO2 capture on the basis of the consistently experimental and computational results.

Angiotensin-(1-7): A Novel Peptide to Treat Hypertension and Nephropathy in Diabetes?

Science.gov (United States)

Padda, Ranjit Singh; Shi, Yixuan; Lo, Chao-Sheng; Zhang, Shao-Ling; Chan, John S D

2015-10-14

The renin-angiotensin system (RAS) plays a pivotal role in mammalian homeostasis physiology. The RAS can be delineated into a classical RAS (the pressor arm) including angiotensinogen (Agt), renin, angiotensin-converting enzyme (ACE), angiotensin II (Ang II) and angiotensin type 1 receptor (AT1R), and a counterbalancing novel RAS (the depressor arm) including Agt, renin, angiotensin-converting enzyme-2 (ACE-2), angiotensin-(1-7) (Ang 1-7) and Ang 1-7 receptor (or Mas receptor (MasR)). Hyperglycemia (diabetes) induces severe tissue oxidative stress, which stimulates the pressor arm of the renal RAS axis and leads to an increase in ACE/ACE-2 ratio, with excessive formation of Ang II. There is a growing body of evidence for beneficial effects of the depressor arm of RAS (ACE-2/Ang 1-7/MasR) axis in diabetes, hypertension and several other diseased conditions. Evidence from in vitro, in vivo and clinical studies reflects anti-oxidant, anti-fibrotic, and anti-inflammatory properties of Ang 1-7. Most of the currently available therapies only target suppression of the pressor arm of RAS with angiotensin receptor blockers (ARBs) and ACE inhibitors (ACEi). However, it is time to consider simultaneous activation of the depressor arm for more effective outcomes. This review summarizes the recent updates on the protective role of Ang 1-7 in hypertension and kidney injury in diabetes, as well as the possible underlying mechanism(s) of Ang 1-7 action, suggesting that the ACE-2/Ang 1-7/MasR axis can be developed as a therapeutic target for the treatment of diabetes-induced hypertension and renal damage.

Small intestinal eosinophils regulate Th17 cells by producing IL-1 receptor antagonist.

Science.gov (United States)

Sugawara, Reiko; Lee, Eun-Jung; Jang, Min Seong; Jeun, Eun-Ji; Hong, Chun-Pyo; Kim, Jung-Hwan; Park, Areum; Yun, Chang Ho; Hong, Sung-Wook; Kim, You-Me; Seoh, Ju-Young; Jung, YunJae; Surh, Charles D; Miyasaka, Masayuki; Yang, Bo-Gie; Jang, Myoung Ho

2016-04-04

Eosinophils play proinflammatory roles in helminth infections and allergic diseases. Under steady-state conditions, eosinophils are abundantly found in the small intestinal lamina propria, but their physiological function is largely unexplored. In this study, we found that small intestinal eosinophils down-regulate Th17 cells. Th17 cells in the small intestine were markedly increased in the ΔdblGATA-1 mice lacking eosinophils, and an inverse correlation was observed between the number of eosinophils and that of Th17 cells in the small intestine of wild-type mice. In addition, small intestinal eosinophils suppressed the in vitro differentiation of Th17 cells, as well as IL-17 production by small intestinal CD4(+)T cells. Unlike other small intestinal immune cells or circulating eosinophils, we found that small intestinal eosinophils have a unique ability to constitutively secrete high levels of IL-1 receptor antagonist (IL-1Ra), a natural inhibitor of IL-1β. Moreover, small intestinal eosinophils isolated from IL-1Ra-deficient mice failed to suppress Th17 cells. Collectively, our results demonstrate that small intestinal eosinophils play a pivotal role in the maintenance of intestinal homeostasis by regulating Th17 cells via production of IL-1Ra. © 2016 Sugawara et al.

Angiotensina-(1-7 durante o processo inicial na cascata da ovulação em bovinos Angiotensin-(1-7 during the initial process of ovulatory cascade in cattle

Directory of Open Access Journals (Sweden)

Joabel Tonellotto dos Santos

2012-10-01

Full Text Available O presente estudo teve como objetivo avaliar o efeito da Ang-(1-7 e de seu receptor (MAS na regulação da ovulação. No experimento I, utilizando um modelo in vitro de cultivo de células foliculares, foi avaliado o efeito do tratamento com Ang-(1-7 ou do bloqueio do receptor MAS através do inibidor d-Ala7-Ang-(1-7 (A-779 na expressão de RNAm para epirregulina (Ereg; um marcador inicial do processo de ovulação em células da granulosa. No experimento II, foi utilizado um modelo in vivo de injeção intrafolicular no qual vinte vacas tiveram o ciclo estral sincronizado e, quando os folículos atingiram um diâmetro mínimo de 12mm, foi realizada a injeção intrafolicular de A-779 ou solução salina 0,9%. No momento da injeção intrafolicular, foi realizada uma aplicação IM de análogo de GnRH. A suplementação com Ang-(1-7 ou o bloqueio de seu receptor MAS em sistema de cultivo de células da granulosa não alteraram o padrão de expressão de RNAm para Ereg. A aplicação intrafolicular de A-779 (10-5M não bloqueou a ovulação quando realizada antes do início do pico esperado de LH (100% das vacas ovularam nos grupos A-779 e controle, sugerindo que a Ang-(1-7 não possui papel relevante no início da cascata ovulatória em bovinos.This study aimed to evaluate the effect of Ang-(1-7 and its receptor (MAS in the regulation of the ovulatory cascade. In the experiment I, the effect of Ang-(1-7 or d-Ala7-Ang-(1-7 (A-779; Ang-(1-7 antagonist on the epirregulin (Ereg; initial marker of ovulation process mRNA expression in granulosa cells was assessed using an in vitro model of follicular cell culture. In experiment II, it was used an in vivo intrafollicular injection model, in which twenty cows had their follicular waves synchronized and the ovarian follicular size was daily monitored by ultrasound. Follicles that reached a minimum diameter of 12mm were injected with A-779 or saline 0.9%. At the time of the intrafollicular injection

17 CFR 240.17a-1 - Recordkeeping rule for national securities exchanges, national securities associations...

Science.gov (United States)

2010-04-01

... national securities exchanges, national securities associations, registered clearing agencies and the... Certain Stabilizing Activities § 240.17a-1 Recordkeeping rule for national securities exchanges, national...) Every national securities exchange, national securities association, registered clearing agency and the...

Modelling of phase diagrams of nanoalloys with complex metallic phases: application to Ni–Sn

Czech Academy of Sciences Publication Activity Database

Kroupa, Aleš; Káňa, Tomáš; Buršík, Jiří; Zemanová, Adéla; Šob, Mojmír

2015-01-01

Roč. 17, č. 42 (2015), s. 28200-28210 ISSN 1463-9076 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0068; GA ČR GA14-15576S; GA MŠk LD11024 Institutional support: RVO:68081723 Keywords : application to Ni–Sn * CALPHAD method * ab initio calculations Subject RIV: BJ - Thermodynamics Impact factor: 4.449, year: 2015

An Exploratory Study of the Use of an Inexpensive Cordless Telephone as a Part of a Data Communications Link.

Science.gov (United States)

1983-08-26

BJ, p. 3. 15. Brabb, GJ, p.5 - 8. 16. Kotler , Ps Principles of Marketing , Prentice Hall, Englewood Cliffs, NJ, 1980, p. 49. 17. Whittemore, BJ, p...15). Utility is defined as the abilityj to satisfyj a need or desire. The marketing discipline recognizes the four categories of utilityj listed...data. Since information posesses the characteristics of goods in the market place and data is the raw material from which information is derived, it is

Functionalized Fullerene Targeting Human Voltage-Gated Sodium Channel, hNav1.7.

Science.gov (United States)

Hilder, Tamsyn A; Robinson, Anna; Chung, Shin-Ho

2017-08-16

Mutations of hNa v 1.7 that cause its activities to be enhanced contribute to severe neuropathic pain. Only a small number of hNa v 1.7 specific inhibitors have been identified, most of which interact with the voltage-sensing domain of the voltage-activated sodium ion channel. In our previous computational study, we demonstrated that a [Lys 6 ]-C 84 fullerene binds tightly (affinity of 46 nM) to Na v Ab, the voltage-gated sodium channel from the bacterium Arcobacter butzleri. Here, we extend this work and, using molecular dynamics simulations, demonstrate that the same [Lys 6 ]-C 84 fullerene binds strongly (2.7 nM) to the pore of a modeled human sodium ion channel hNa v 1.7. In contrast, the fullerene binds only weakly to a mutated model of hNa v 1.7 (I1399D) (14.5 mM) and a model of the skeletal muscle hNa v 1.4 (3.7 mM). Comparison of one representative sequence from each of the nine human sodium channel isoforms shows that only hNa v 1.7 possesses residues that are critical for binding the fullerene derivative and blocking the channel pore.

Dendritic Cell-Induced Th1 and Th17 Cell Differentiation for Cancer Therapy

Directory of Open Access Journals (Sweden)

Julia Terhune

2013-11-01

Full Text Available The success of cellular immunotherapies against cancer requires the generation of activated CD4+ and CD8+ T-cells. The type of T-cell response generated (e.g., Th1 or Th2 will determine the efficacy of the therapy, and it is generally assumed that a type-1 response is needed for optimal cancer treatment. IL-17 producing T-cells (Th17/Tc17 play an important role in autoimmune diseases, but their function in cancer is more controversial. While some studies have shown a pro-cancerous role for IL-17, other studies have shown an anti-tumor function. The induction of polarized T-cell responses can be regulated by dendritic cells (DCs. DCs are key regulators of the immune system with the ability to affect both innate and adaptive immune responses. These properties have led many researchers to study the use of ex vivo manipulated DCs for the treatment of various diseases, such as cancer and autoimmune diseases. While Th1/Tc1 cells are traditionally used for their potent anti-tumor responses, mounting evidence suggests Th17/Tc17 cells should be utilized by themselves or for the induction of optimal Th1 responses. It is therefore important to understand the factors involved in the induction of both type-1 and type-17 T-cell responses by DCs.

Acquired resistance to 17-allylamino-17-demethoxygeldanamycin (17-AAG, tanespimycin) in glioblastoma cells.

Science.gov (United States)

Gaspar, Nathalie; Sharp, Swee Y; Pacey, Simon; Jones, Chris; Walton, Michael; Vassal, Gilles; Eccles, Suzanne; Pearson, Andrew; Workman, Paul

2009-03-01

Heat shock protein 90 (HSP90) inhibitors, such as 17-allylamino-17-demethoxygeldanamycin (17-AAG, tanespimycin), which is currently in phase II/phase III clinical trials, are promising new anticancer agents. Here, we explored acquired resistance to HSP90 inhibitors in glioblastoma (GB), a primary brain tumor with poor prognosis. GB cells were exposed continuously to increased 17-AAG concentrations. Four 17-AAG-resistant GB cell lines were generated. High-resistance levels with resistance indices (RI = resistant line IC(50)/parental line IC(50)) of 20 to 137 were obtained rapidly (2-8 weeks). After cessation of 17-AAG exposure, RI decreased and then stabilized. Cross-resistance was found with other ansamycin benzoquinones but not with the structurally unrelated HSP90 inhibitors, radicicol, the purine BIIB021, and the resorcinylic pyrazole/isoxazole amide compounds VER-49009, VER-50589, and NVP-AUY922. An inverse correlation between NAD(P)H/quinone oxidoreductase 1 (NQO1) expression/activity and 17-AAG IC(50) was observed in the resistant lines. The NQO1 inhibitor ES936 abrogated the differential effects of 17-AAG sensitivity between the parental and resistant lines. NQO1 mRNA levels and NQO1 DNA polymorphism analysis indicated different underlying mechanisms: reduced expression and selection of the inactive NQO1*2 polymorphism. Decreased NQO1 expression was also observed in a melanoma line with acquired resistance to 17-AAG. No resistance was generated with VER-50589 and NVP-AUY922. In conclusion, low NQO1 activity is a likely mechanism of acquired resistance to 17-AAG in GB, melanoma, and, possibly, other tumor types. Such resistance can be overcome with novel HSP90 inhibitors.

Dectin-1 isoforms contribute to distinct Th1/Th17 cell activation in mucosal candidiasis

Science.gov (United States)

Carvalho, Agostinho; Giovannini, Gloria; De Luca, Antonella; D'Angelo, Carmen; Casagrande, Andrea; Iannitti, Rossana G; Ricci, Giovanni; Cunha, Cristina; Romani, Luigina

2012-01-01

The recognition of β-glucans by dectin-1 has been shown to mediate cell activation, cytokine production and a variety of antifungal responses. Here, we report that the functional activity of dectin-1 in mucosal immunity to Candida albicans is influenced by the genetic background of the host. Dectin-1 was required for the proper control of gastrointestinal and vaginal candidiasis in C57BL/6, but not BALB/c mice; in fact, the latter showed increased resistance in the absence of dectin-1. The susceptibility of dectin-1-deficient C57BL/6 mice to infection was associated with defects in IL-17A and aryl hydrocarbon receptor-dependent IL-22 production and in adaptive Th1 responses. In contrast, the resistance of dectin-1-deficient BALB/c mice was associated with increased IL-17A and IL-22 production and the skewing towards Th1/Treg immune responses that provide immunological memory. Disparate canonical/noncanonical NF-κB signaling pathways downstream of dectin-1 were activated in the two different mouse strains. Thus, the net activity of dectin-1 in antifungal mucosal immunity is dependent on the host's genetic background, which affects both the innate cytokine production and the adaptive Th1/Th17 cell activation upon dectin-1 signaling. PMID:22543832

Brachypodium distachyon line Bd3-1 resistance is elicited by the barley stripe mosaic virus triple gene block 1 movement protein

NARCIS (Netherlands)

Lee, M.Y.; Yan, L.J.; Gorter, F.A.; Kim, B.Y.T.; Cui, Y.; Hu, Y.; Yuan, C.; Grindheim, J.; Ganesan, U.; Liu, Z.Y.; Han, C.G.; Yu, J.L.; Li, D.W.; Jackson, A.O.

2012-01-01

Barley stripe mosaic virus North Dakota 18 (ND18), Beijing (BJ), Xinjiang (Xi), Type (TY) and CV21 strains are unable to infect the Brachypodium distachyon Bd3-1 inbred line, which harbours a resistance gene designated Bsr1, but the Norwich (NW) strain is virulent on Bd3-1. Analysis of ND18 and NW

Angiotensin-(1-7) augments endothelium-dependent relaxations of porcine coronary arteries to bradykinin by inhibiting angiotensin-converting enzyme 1.

Science.gov (United States)

Raffai, Gábor; Khang, Gilson; Vanhoutte, Paul M

2014-05-01

Angiotensin-converting enzyme 2 (ACE2) converts angiotensin II to angiotensin-(1-7) that activates Mas receptors, inhibits ACE1, and modulates bradykinin receptor sensitivity. This in vitro study compared the direct and indirect effects of angiotensin-(1-7), the ACE1 inhibitor captopril, and diminazene aceturate (DIZE) an alleged ACE2 activator in rings of porcine coronary arteries, by measuring changes of isometric tension. Angiotensin-(1-7), captopril, and DIZE did not cause significant changes in tension before or after desensitization of bradykinin receptors in preparations contracted with U46619. Bradykinin caused concentration-dependent and endothelium-dependent relaxations that were not affected by DIZE but were potentiated to a similar extent by angiotensin-(1-7) and captopril, given alone or in combination. Bradykinin responses potentiated by angiotensin-(1-7) and captopril were not affected by the BK1 antagonist SSR240612 and remained augmented in the presence of either N-nitro-L-arginine methyl ester hydrochloride plus indomethacin or TRAM-34 plus UCL-1684. ACE2 was identified in the coronary endothelium by immunofluorescence, but its basal activity was not influenced by DIZE. These results suggest that in coronary arteries, angiotensin-(1-7) and captopril both improves NO bioavailability and enhances endothelium-dependent hyperpolarization to bradykinin solely by ACE1 inhibition. Endothelial ACE2 activity cannot be increased by DIZE to produce local adequate amounts of angiotensin-(1-7) to influence vascular tone.

17 CFR 200.1 - General statement and statutory authority.

Science.gov (United States)

2010-04-01

...) Investigation of securities frauds, manipulations, and other violations, and the imposition and enforcement of... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false General statement and statutory authority. 200.1 Section 200.1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...

Kodak film type SO-394-4-1 mottling and hypersensitization test

Science.gov (United States)

Weinstein, M. S.

1972-01-01

A number of tests were conducted to show the effects of various environmental conditions in terms of mottling and hypersensitization on Kodak Film type SO-394-4-1. The first two weeks of environmental testing is described, along with the test plan and matrix.

The KYxxL motif in Rad17 protein is essential for the interaction with the 9–1–1 complex

Energy Technology Data Exchange (ETDEWEB)

Fukumoto, Yasunori, E-mail: fukumoto@faculty.chiba-u.jp [Laboratory of Molecular Cell Biology, Graduate School of Pharmaceutical Sciences, Chiba University, Chiba 260-8675 (Japan); Ikeuchi, Masayoshi; Nakayama, Yuji [Department of Biochemistry & Molecular Biology, Kyoto Pharmaceutical University, Kyoto 607-8414 (Japan); Yamaguchi, Naoto, E-mail: nyama@faculty.chiba-u.jp [Laboratory of Molecular Cell Biology, Graduate School of Pharmaceutical Sciences, Chiba University, Chiba 260-8675 (Japan)

2016-09-02

ATR-dependent DNA damage checkpoint is the major DNA damage checkpoint against UV irradiation and DNA replication stress. The Rad17–RFC and Rad9–Rad1–Hus1 (9–1–1) complexes interact with each other to contribute to ATR signaling, however, the precise regulatory mechanism of the interaction has not been established. Here, we identified a conserved sequence motif, KYxxL, in the AAA+ domain of Rad17 protein, and demonstrated that this motif is essential for the interaction with the 9–1–1 complex. We also show that UV-induced Rad17 phosphorylation is increased in the Rad17 KYxxL mutants. These data indicate that the interaction with the 9–1–1 complex is not required for Rad17 protein to be an efficient substrate for the UV-induced phosphorylation. Our data also raise the possibility that the 9–1–1 complex plays a negative regulatory role in the Rad17 phosphorylation. We also show that the nucleotide-binding activity of Rad17 is required for its nuclear localization. - Highlights: • We have identified a conserved KYxxL motif in Rad17 protein. • The KYxxL motif is crucial for the interaction with the 9–1–1 complex. • The KYxxL motif is dispensable or inhibitory for UV-induced Rad17 phosphorylation. • Nucleotide binding of Rad17 is required for its nuclear localization.

17 CFR 404.1 - Application of part to registered brokers and dealers.

Science.gov (United States)

2010-04-01

... registered brokers and dealers. 404.1 Section 404.1 Commodity and Securities Exchanges DEPARTMENT OF THE... PRESERVATION OF RECORDS § 404.1 Application of part to registered brokers and dealers. Compliance by a registered broker or dealer with § 240.17a-3 of this title (pertaining to records to be made), § 240.17a-4 of...

Th17 Cells Induce Dopaminergic Neuronal Death via LFA-1/ICAM-1 Interaction in a Mouse Model of Parkinson's Disease.

Science.gov (United States)

Liu, Zhan; Huang, Yan; Cao, Bei-Bei; Qiu, Yi-Hua; Peng, Yu-Ping

2017-12-01

T helper (Th)17 cells, a subset of CD4 + T lymphocytes, have strong pro-inflammatory property and appear to be essential in the pathogenesis of many inflammatory diseases. However, the involvement of Th17 cells in Parkinson's disease (PD) that is characterized by a progressive degeneration of dopaminergic (DAergic) neurons in the nigrostriatal system is unclear. Here, we aimed to demonstrate that Th17 cells infiltrate into the brain parenchyma and induce neuroinflammation and DAergic neuronal death in 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP)- or 1-methyl-4-phenylpyridinium (MPP + )-induced PD models. Blood-brain barrier (BBB) disruption in the substantia nigra (SN) was assessed by the signal of FITC-labeled albumin that was injected into blood circulation via the ascending aorta. Live cell imaging system was used to observe a direct contact of Th17 cells with neurons by staining these cells using the two adhesion molecules, leukocyte function-associated antigen (LFA)-1 and intercellular adhesion molecule (ICAM)-1, respectively. Th17 cells invaded into the SN where BBB was disrupted in MPTP-induced PD mice. Th17 cells exacerbated DAergic neuronal loss and pro-inflammatory/neurotrophic factor disorders in MPP + -treated ventral mesencephalic (VM) cell cultures. A direct contact of LFA-1-stained Th17 cells with ICAM-1-stained VM neurons was dynamically captured. Either blocking LFA-1 in Th17 cells or blocking ICAM-1 in VM neurons with neutralizing antibodies abolished Th17-induced DAergic neuronal death. These results establish that Th17 cells infiltrate into the brain parenchyma of PD mice through lesioned BBB and exert neurotoxic property by promoting glial activation and importantly by a direct damage to neurons depending on LFA-1/ICAM-1 interaction.

75 FR 18090 - Changes in Flood Elevation Determinations

Science.gov (United States)

2010-04-09

...] 0 2. The tables published under the authority of Sec. 65.4 are amended as follows: Date and name of... modification Community notice was published of community No. New York: Suffolk Town of Southampton March 4... Austin (09-06- March 10, 2010; The Honorable Lee July 15, 2010 480624 3398P). March 17, 2010; Leffingwell...

Revelation 1:7 − A roadmap of God’s τέλοςfor his creation

Directory of Open Access Journals (Sweden)

Kobus de Smidt

2013-11-01

Full Text Available Revelation 1:7 points to an anticipated final appearance of Jesus at the consummation. This κηρύσσω developed from the late Jewish apocalyptic eschatology. This apocalyptic end time dawned with Jesus. The present time is thus simultaneously the end time, though the consummation is still in the future. As Jesus appeared on earth with his resurrection, so will he appear at the consummation − his resurrection appearance is a simile of his appearance at the consummation. He will appear in a corporeal form. The writer encourages the second-generation marginalised Christians. The Roman emperor is not the victor − Jesus is the axis mundi of God’s final purpose for his creation. The final appearance of Jesus will bring redemption for the believers and mourning for the unbelievers. The κηρύσσω of Revelation 1:7 is diametrically the opposite of the chiliasts. The country of Israel and her present inhabitants have no eschatological role to fulfil at the consummation. Openbaring 1:7 dui op ’n geantisipeerde finale verskyning van Jesus met die voleinding. Hierdie κηρύσσω het uit die Joodse laat-apokaliptiese eskatologie ontwikkel. Die apokaliptiese eindtyd het met Jesus se opstanding plaasgevind en die Nuwe-Testamentiese hede is dus alreeds die eindtyd. Die voleinding is egter nog in die toekoms. Jesus se verskyning met sy opstanding is ’n metafoor vir sy koms by die voleinding. Hy sal liggaamlik verskyn. Die skrywer bemoedig die gemarginaliseerde tweede generasie Christene. Die Romeinse keiser is nie die oorwinnaar nie − Jesus is die axis mundi van God se finale plan vir sy skepping. Die finale verskyning van Jesus sal vir die gelowiges ewige verlossing bewerk, maar die ongelowiges sal in rou gedompel word. Die κηρύσσω van Openbaring 1:7 is die teenoorgestelde van die standpunt van die chiliasme. Die land en huidige volk van Israel vervul geen eskatologiese rol by die voleinding nie.

17 CFR 256.930.1 - General advertising expenses.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false General advertising expenses... UTILITY HOLDING COMPANY ACT OF 1935 2. Expense § 256.930.1 General advertising expenses. This account shall include the cost of materials used and expenses incurred in advertising and related activities...

Dicty_cDB: Contig-U12991-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ( AF272150 ) Dictyostelium discoideum deliriumA (dlrA) gene, c... 2022 0.0 3 ( BJ...39594 ) TT1EP48TV Tetrahymena thermophila SB210 cDNA libr... 38 10.0 2 >( AF272150 ) Dictyostelium discoideum delirium

Representation of SO(4,1) group and Hawking effect in the de-Sitter space

International Nuclear Information System (INIS)

Bogush, A.A.; Otchik, V.S.

1983-01-01

Expression relating the solution of the equation for particles with spin 1/2 to matrix elements of group SO(4, 1), is obtained. When using the relation of the Dirac equation solutions in the de Sitter space with matrix elements of representations of group SO(4, 1) the presence of the Hawking effect in the space is established. The de Sitter space is considered as 4-dimensional hyperboloid, inserted into 5-dimensional pseudo-Euclidean space. It is established, that the average number of emitted spinor particles obeys the Fermi-Dirac distribution

17 CFR 1.22 - Use of customer funds restricted.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Use of customer funds... REGULATIONS UNDER THE COMMODITY EXCHANGE ACT Customers' Money, Securities, and Property § 1.22 Use of customer funds restricted. No futures commission merchant shall use, or permit the use of, the customer funds of...

CCR6 and NK1.1 distinguish between IL-17A and IFN-gamma-producing gammadelta effector T cells.

Science.gov (United States)

Haas, Jan D; González, Frano H Malinarich; Schmitz, Susanne; Chennupati, Vijaykumar; Föhse, Lisa; Kremmer, Elisabeth; Förster, Reinhold; Prinz, Immo

2009-12-01

Gammadelta T cells are a potent source of innate IL-17A and IFN-gamma, and they acquire the capacity to produce these cytokines within the thymus. However, the precise stages and required signals that guide this differentiation are unclear. Here we show that the CD24(low) CD44(high) effector gammadelta T cells of the adult thymus are segregated into two lineages by the mutually exclusive expression of CCR6 and NK1.1. Only CCR6+ gammadelta T cells produced IL-17A, while NK1.1+ gammadelta T cells were efficient producers of IFN-gamma but not of IL-17A. Their effector phenotype correlated with loss of CCR9 expression, particularly among the NK1.1+ gammadelta T cells. Accordingly, both gammadelta T-cell subsets were rare in gut-associated lymphoid tissues, but abundant in peripheral lymphoid tissues. There, they provided IL-17A and IFN-gamma in response to TCR-specific and TCR-independent stimuli. IL-12 and IL-18 induced IFN-gamma and IL-23 induced IL-17A production by NK1.1+ or CCR6+ gammadelta T cells, respectively. Importantly, we show that CCR6+ gammadelta T cells are more responsive to TCR stimulation than their NK1.1+ counterparts. In conclusion, our findings support the hypothesis that CCR6+ IL-17A-producing gammadelta T cells derive from less TCR-dependent selection events than IFN-gamma-producing NK1.1+ gammadelta T cells.

In Situ Proteolysis for Crystallization of Membrane Bound Cytochrome P450 17A1 and 17A2 Proteins from Zebrafish.

Science.gov (United States)

Lei, Li; Egli, Martin

2016-04-01

Fish and human cytochrome P450 (P450) 17A1 catalyze both steroid 17α-hydroxylation and 17α,20-lyase reactions. Fish P450 17A2 catalyzes only 17α-hydroxylation. Both enzymes are microsomal-type P450s, integral membrane proteins that bind to the membrane through their N-terminal hydrophobic segment, the signal anchor sequence. The presence of this N-terminal region renders expression of full-length proteins challenging or impossible. For some proteins, variable truncation of the signal anchor sequence precludes expression or results in poor expression levels. To crystallize P450 17A1 and 17A2 in order to gain insight into their different activities, we used an alternative N-terminal sequence to boost expression together with in situ proteolysis. Key features of our approach to identify crystallizable P450 fragments were the use of an N-terminal leader sequence, a screen composed of 12 proteases to establish optimal cleavage, variations of protease concentration in combination with an SDS-PAGE assay, and analysis of the resulting fragments using Edman sequencing. Described in this unit are protocols for vector preparation, expression, purification, and in situ proteolytic crystallization of two membrane-bound P450 proteins. Copyright © 2016 John Wiley & Sons, Inc.

Cell division and endoreduplication play important roles in stem swelling of tuber mustard (Brassica juncea Coss. var. tumida Tsen et Lee).

Science.gov (United States)

Shi, H; Wang, L L; Sun, L T; Dong, L L; Liu, B; Chen, L P

2012-11-01

We investigated spatio-temporal variations in cell division and the occurrence of endoreduplication in cells of tuber mustard stems during development. Cells in the stem had 8C nuclei (C represents DNA content of a two haploid genome), since it is an allotetraploid species derived from diploid Brassica rapa (AA) and B. nigra (BB), thus indicating the occurrence of endoreduplication. Additionally, we observed a dynamic change of cell ploidy in different regions of the swollen stems, with a decrease in 4C proportion in P4-1 and a sharp increase in 8C cells that became the dominant cell type (86.33% at most) in the inner pith cells. Furthermore, cDNAs of 14 cell cycle genes and four cell expansion genes were cloned and their spatial transcripts analysed in order to understand their roles in stem development. The expression of most cell cycle genes peaked in regions of the outer pith (P2 or P3), some genes regulating S/G2 and G2/M (BjCDKB1;2, BjCYCB1;1 and BjCYCB1;2) significantly decrease in P5 and P6, while G1/S regulators (BjE2Fa, BjE2Fb and BjE2Fc) showed a relative high expression level in the inner pith (P5) where cells were undergoing endoreduplication. Coincidentally, BjXTH1and BjXTH2 were exclusively expressed in the endoreduplicated cells. Our results suggest that cells of outer pith regions (P2 and P3) mainly divide for cell proliferation, while cells of the inner pith expand through endoreduplication. Endoreduplication could trigger expression of BjXTH1 and BjXTH2 and thus function in cell expansion of the pith tissue. © 2012 German Botanical Society and The Royal Botanical Society of the Netherlands.

Oxidative stress modulates the cytokine response of differentiated Th17 and Th1 cells.

Science.gov (United States)

Abimannan, Thiruvaimozhi; Peroumal, Doureradjou; Parida, Jyoti R; Barik, Prakash K; Padhan, Prasanta; Devadas, Satish

2016-10-01

Reactive oxygen species (ROS) signaling is critical in T helper (Th) cell differentiation; however its role in differentiated Th cell functions is unclear. In this study, we investigated the role of oxidative stress on the effector functions of in vitro differentiated mouse Th17 and Th1 cells or CD4 + T cells from patients with Rheumatoid Arthritis using pro-oxidants plumbagin (PB) and hydrogen peroxide. We found that in mouse Th cells, non-toxic concentration of pro-oxidants inhibited reactivation induced expression of IL-17A in Th17 and IFN-γ in Th1 cells by reducing the expression of their respective TFs, RORγt and T-bet. Interestingly, in both the subsets, PB increased the expression of IL-4 by enhancing reactivation induced ERK1/2 phosphorylation. We further investigated the cytokine modulatory effect of PB on CD4 + T cells isolated from PBMCs of patients with Rheumatoid Arthritis, a well-known Th17 and or Th1 mediated disease. In human CD4 + T cells from Rheumatoid Arthritis patients, PB reduced the frequencies of IL-17A + (Th17), IFN - γ + (Th1) and IL-17A + /IFN - γ + (Th17/1) cells and also inhibited the production of pro-inflammatory cytokines TNF-α and IL-6. N-Acetyl Cysteine (NAC) an antioxidant completely reversed PB mediated cytokine modulatory effects in both mouse and human cells indicating a direct role for ROS. Together our data suggest that oxidative microenvironment can alter cytokine response of terminally differentiated cells and thus altering intracellular ROS could be a potential way to target Th17 and Th1 cells in autoimmune disorders. Copyright © 2016. Published by Elsevier Inc.

Surface tension and 0.1 MPa density of 1-alkyl-3-methylimidazolium tetrafluoroborates in a homologous series perspective

Czech Academy of Sciences Publication Activity Database

Součková, Monika; Klomfar, Jaroslav; Pátek, Jaroslav

2016-01-01

Roč. 100, September (2016), s. 79-88 ISSN 0021-9614 R&D Projects: GA ČR GA13-00145S Institutional support: RVO:61388998 Keywords : 1-Cn-3-methylimidazolium cation * tetrafluoroborate anion * density–temperature relation * surface tension–temperature relation * recommended property values Subject RIV: BJ - Thermodynamics Impact factor: 2.726, year: 2016

Temperature Dependence of the Surface Tension and Density at 0.1 MPa for 1-Ethyl- and 1-Butyl-3-methylimidazolium Dicyanamide

Czech Academy of Sciences Publication Activity Database

Klomfar, Jaroslav; Součková, Monika; Pátek, Jaroslav

2011-01-01

Roč. 56, č. 8 (2011), s. 3454-3462 ISSN 0021-9568 R&D Projects: GA ČR GA101/09/0010; GA AV ČR IAA200760701 Institutional research plan: CEZ:AV0Z20760514 Keywords : surface tension * density * dicyanamide * experimental data Subject RIV: BJ - Thermodynamics Impact factor: 1.693, year: 2011 http://pubs.acs.org/doi/abs/10.1021/je200502j

p53 inhibits autophagy by interacting with the human ortholog of yeast Atg17, RB1CC1/FIP200.

Science.gov (United States)

Morselli, Eugenia; Shen, Shensi; Ruckenstuhl, Christoph; Bauer, Maria Anna; Mariño, Guillermo; Galluzzi, Lorenzo; Criollo, Alfredo; Michaud, Mickael; Maiuri, Maria Chiara; Chano, Tokuhiro; Madeo, Frank; Kroemer, Guido

2011-08-15

The tumor suppressor protein p53 tonically suppresses autophagy when it is present in the cytoplasm. This effect is phylogenetically conserved from mammals to nematodes, and human p53 can inhibit autophagy in yeast, as we show here. Bioinformatic investigations of the p53 interactome in relationship to the autophagy-relevant protein network underscored the possible relevance of a direct molecular interaction between p53 and the mammalian ortholog of the essential yeast autophagy protein Atg17, namely RB1-inducible coiled-coil protein 1 (RB1CC1), also called FAK family kinase-interacting protein of 200 KDa (FIP200). Mutational analyses revealed that a single point mutation in p53 (K382R) abolished its capacity to inhibit autophagy upon transfection into p53-deficient human colon cancer or yeast cells. In conditions in which wild-type p53 co-immunoprecipitated with RB1CC1/FIP200, p53 (K382R) failed to do so, underscoring the importance of the physical interaction between these proteins for the control of autophagy. In conclusion, p53 regulates autophagy through a direct molecular interaction with RB1CC1/FIP200, a protein that is essential for the very apical step of autophagy initiation.

Intensive chemotherapy for acute myeloid leukemia differentially affects circulating TC1, TH1, TH17 and TREG cells

Directory of Open Access Journals (Sweden)

Gjertsen Bjørn

2010-07-01

Full Text Available Abstract Background Several observations suggest that immunological events early after chemotherapy, possibly during the period of severe treatment-induced cytopenia, are important for antileukemic immune reactivity in acute myeloid leukemia (AML. We therefore investigated the frequencies of various T cell subsets (TC1, TH1, TH17 and CD25+ FoxP3+ TREG cells in AML patients with untreated disease and following intensive chemotherapy. Results Relative levels of circulating TC1 and TH1 cells were decreased in patients with severe chemotherapy-induced cytopenia, whereas TH17 levels did not differ from healthy controls. Increased levels of regulatory CD25+ FoxP3+ T cells were detected in AML patients with untreated disease, during chemotherapy-induced cytopenia and during regeneration after treatment. TH17 and TH1 levels were significantly higher in healthy males than females, but this gender difference was not detected during chemotherapy-induced cytopenia. Finally, exogenous IL17-A usually had no or only minor effects on proliferation of primary human AML cells. Conclusions We conclude that the effect of intensive AML chemotherapy differ between circulating T cell subsets, relative frequencies of TH17 cells are not affected by chemotherapy and this subset may affect AML cells indirectly through their immunoregulatory effects but probably not through direct effects of IL17-A.

Estudio del Sistema Li2SO4 – Na2SO4. Diagrama de fases y caracterización del LiNaSO4

Directory of Open Access Journals (Sweden)

Font-Bardia, M.

2004-08-01

Full Text Available An exhaustive study of the phase diagram of binary system Li2SO4-Na2SO4 is presented. Phase diagram was determined using thermo-X-ray diffraction in powder samples and calorimetry ATD. A new phase with formula Li2-xNaxSO4 has been obtained, with 1 ≤ x ≤ 1.22. The crystal structure of β-LiNaSO4 was determined from single-crystal X-ray diffraction. This study shows that the crystals usually become twinned when the growth is by solution; which explains the poor spontaneous polarization. The Raman dispersion of Li2SO4, Na2SO4 and LiNaSO4 compounds is explained from the structural data. The measurements have been made at different heating and cooling rate.Se presenta un estudio exhaustivo del diagrama de fase del sistema binario Li2SO4-Na2SO4. El diagrama de fases se determinó mediante termo-difractometría de rayos-X en muestras de polvo y calorimetría ATD. Se obtiene una nueva fase de fórmula Li2-xNaxSO4, con 1 ≤ x ≤ 1.22. La estructura cristalina de β-LiNaSO4 se determinó por difracción de rayos-X sobre un monocristal. Este estudio muestra que los cristales usualmente se maclan cuando el crecimiento es por solución, lo cual explica la baja polarización espontánea. Se explica la dispersión Raman de los compuestos Li2SO4, Na2SO4 y LiNaSO4, a partir de los datos estructurales. Las medidas experimentales se han efectuado a diferentes velocidades de calentamiento y enfriamiento.

The contribution of residential coal combustion to atmospheric PM2. 5 in northern China during winter

Directory of Open Access Journals (Sweden)

P. Liu

2017-09-01

Full Text Available A vast area in northern China, especially during wintertime, is currently suffering from severe haze events due to the high levels of atmospheric PM2. 5. To recognize the reasons for the high levels of PM2. 5, daily samples of PM2. 5 were simultaneously collected at the four sampling sites of Beijing city (BJ, Baoding city (BD, Wangdu county (WD and Dongbaituo (DBT during the winter and spring of 2014–2015. The concentrations of the typical water-soluble ions (WSIs, such as Cl−, NO3−, SO42− and NH4+ at DBT were found to be remarkably higher than those at BJ in the two winters, but almost the same as those at BJ in the two springs. The evidently greater concentrations of OC, EC and secondary inorganic ions (NO3−, SO42−, NH4+ and Cl− at DBT than at WD, BD and BJ during the winter of 2015 indicated that the pollutants in the rural area were not due to transportation from neighbouring cities but dominated by local emissions. As the distinct source of atmospheric OC and EC in the rural area, the residential coal combustion also made a contribution to secondary inorganic ions through the emissions of their precursors (NOx, SO2, NH3 and HCl as well as heterogeneous or multiphase reactions on the surface of OC and EC. The average mass proportions of OC, EC, NO3− and SO42− at BD and WD were found to be very close to those at DBT, but were evidently different from those at BJ, implying that the pollutants in the cities of WD and BD, which are fully surrounded by the countryside, were strongly affected by the residential coal combustion. The OC ∕ EC ratios at the four sampling sites were almost the same value (4.8 when the concentrations of PM2. 5 were greater than 150 µg m−3, suggesting that the residential coal combustion could also make a dominant contribution to atmospheric PM2. 5 at BJ during the severe pollution period when the air parcels were usually from southwest–south regions, where a high density of

Notch1 Signaling Regulates the Th17/Treg Immune Imbalance in Patients with Psoriasis Vulgaris.

Science.gov (United States)

Ma, Lei; Xue, HaiBo; Gao, Tianqin; Gao, MeiLan; Zhang, YuJie

2018-01-01

To evaluate the regulating effect of Notch1 signaling on Th17/Treg immune imbalance in psoriasis vulgaris (PV). Notch1, Hes-1, ROR γ t, Foxp3, IL-17, and IL-10 mRNA expression, as well as Th17 and Treg cell percentages in peripheral CD4 + T cells, were detected by real-time quantitative RT-PCR and flow cytometry, and serum concentrations of IL-17 and IL-10 were detected by ELISA in 36 PV patients and 32 healthy controls. Additionally, CD4 + T cells from 12 PV patients were treated with γ -secretase inhibitor DAPT, and the above indexes were measured. PV patients presented distinct Th17/Treg immune imbalance and highly expressed Notch1 and Hes-1 mRNA levels, which were positively correlated with psoriasis area and severity index (PASI) and the ratios of Th17/Treg and ROR γ t/Foxp3. DAPT treatment resulted in the obvious downregulation of Th17 cell percentage in cocultured CD4 + T cells, ROR γ t and IL-17 mRNA levels, and IL-17 concentration in cell-free supernatant from cocultured CD4 + T cells of PV patients in a dose-dependent manner, while there was no significant influence on Treg cell percentage, Foxp3, and IL-10 expression, therefore leading to the recovery of Th17/Treg immune imbalance. Notch1 signaling may contribute to the pathogenesis of PV by regulating Th17/Treg immune imbalance.

IL-1β promotes the differentiation of polyfunctional human CCR6+CXCR3+ Th1/17 cells that are specific for pathogenic and commensal microbes1

Science.gov (United States)

Duhen, Thomas; Campbell, Daniel J

2014-01-01

In humans, Th1/17 cells, identified by co-expression of the chemokine receptors CCR6 and CXCR3, have been proposed to be highly pathogenic in several autoimmune disorders due in part to their expression of the pro-inflammatory cytokines IL-17, IFN-γ and GM-CSF. However, their developmental requirements, relationship with “classic” Th17 and Th1 cells and physiological role in normal immune responses are not well understood. Here, we examined CCR6+CXCR3+ Th1/17 cells from healthy individuals, and found that ex vivo those cells produced the effector cytokines IL-17, IL-22 and IFN-γ in all possible combinations, and were highly responsive to both IL-12 and IL-23. Moreover, although the antigen specificity of CCR6+CXCR3+ Th1/17 cells showed substantial overlap with that of Th1 and Th17 cells, this population was enriched in cells recognizing certain extracellular bacteria and expressing the intestinal homing receptor integrin β7. Finally, we identified IL-1β as a key cytokine that renders Th17 cells sensitive to IL-12, and both cytokines together potently induced the differentiation of cells that produce IL-17, IFN-γ and GM-CSF. Therefore, interfering with IL-1β and IL-12 signaling in Th17 cells during inflammation may be a promising therapeutic approach to reduce their differentiation into “pathogenic” CCR6+CXCR3+ Th1/17 cells in patients with autoimmune diseases. PMID:24890729

Angiotensin-(1-7)/Mas axis integrity is required for the expression of object recognition memory.

Science.gov (United States)

Lazaroni, Thiago L N; Raslan, Ana Cláudia S; Fontes, Walkiria R P; de Oliveira, Marilene L; Bader, Michael; Alenina, Natalia; Moraes, Márcio F D; Dos Santos, Robson A; Pereira, Grace S

2012-01-01

It has been shown that the brain has its own intrinsic renin-angiotensin system (RAS) and angiotensin-(1-7) (Ang-(1-7)) is particularly interesting, because it appears to counterbalance most of the Ang II effects. Ang-(1-7) exerts its biological function through activation of the G-protein-coupled receptor Mas. Interestingly, hippocampus is one of the regions with higher expression of Mas. However, the role of Ang-(1-7)/Mas axis in hippocampus-dependent memories is still poorly understood. Here we demonstrated that Mas ablation, as well as the blockade of Mas in the CA1-hippocampus, impaired object recognition memory (ORM). We also demonstrated that the blockade of Ang II receptors AT1, but not AT2, recovers ORM impairment of Mas-deficient mice. Considering that high concentrations of Ang-(1-7) may activate AT1 receptors, nonspecifically, we evaluate the levels of Ang-(1-7) and its main precursors Ang I and Ang II in the hippocampus of Mas-deficient mice. The Ang I and Ang II levels are unaltered in the whole hipocampus of MasKo. However, Ang-(1-7) concentration is increased in the whole hippocampus of MasKo mice, as well as in the CA1 area. Taken together, our findings suggest that the functionality of the Ang-(1-7)/Mas axis is essential for normal ORM processing. Copyright © 2011 Elsevier Inc. All rights reserved.

The effects of “Beijing grass” in diets on growth performance, humoral antibody and carcass characteristics in quails

Directory of Open Access Journals (Sweden)

Chethanond, U.

2005-08-01

Full Text Available Pharmacological study on Beijing grass (Bj. grass: Murdannia loriformis showed immunomodulator and anticancer activities. Thus, the effect of Bj. grass in diets was investigated in Japanese quails (aged 0-6 weeks on growth performances, humoral immunity and carcass characteristics. 708 1-day-old quails (Corturnix type which had no vaccination program were used in this study. They were experimented using completely randomized design and were divided into 6 treatments consisted of 4 replications with 27-31 heads each. The treatments were assigned as follows: Treatment 1 (T1 no vaccination and no Bj.grass, Treatment 2 (T2 vaccination and no Bj.grass, Treatment 3 (T3 vaccination and 3% Bj.grass, Treatment 4 (T4 vaccination and 6% Bj.grass, Treatment 5 (T5 vaccination and 9% Bj.grass and Treatment 6 (T6 vaccination and 10% Bj.grass juice (w/v. Vaccination program by 1 Newcastle disease + Infectious Bronchitis and 2 Pox were given at 1 and 3 weeks. Approximately 25% of quails were bled for determination of packed cell volume, gamma globulin levels and ND-HI titers. All male quails were put to sleep at 6 weeks. The results showed weight gain in the 3rd week was different in treatments using Bj. grass and treatments using control diet which body weight gain reduced when the level of Bj. grass increased (p 0.05. It was noted that not more than 6% Bj. grass could be used in quail diet without abnormal clinical signs. However, the more grass showed the tendency of poor weight gain. There were no differences in packed cell volume or gamma IgG level and ND-HI titers did not reach protection level. For carcass characteristics, Bj. grass 3% in diet gave the best carcass characteristics. (p < 0.05 In addition there was a dose-related reduction of abdominal fat (P=0.001.

Updated SO2 emission estimates over China using OMI/Aura observations

Science.gov (United States)

Elissavet Koukouli, Maria; Theys, Nicolas; Ding, Jieying; Zyrichidou, Irene; Mijling, Bas; Balis, Dimitrios; van der A, Ronald Johannes

2018-03-01

The main aim of this paper is to update existing sulfur dioxide (SO2) emission inventories over China using modern inversion techniques, state-of-the-art chemistry transport modelling (CTM) and satellite observations of SO2. Within the framework of the EU Seventh Framework Programme (FP7) MarcoPolo (Monitoring and Assessment of Regional air quality in China using space Observations) project, a new SO2 emission inventory over China was calculated using the CHIMERE v2013b CTM simulations, 10 years of Ozone Monitoring Instrument (OMI)/Aura total SO2 columns and the pre-existing Multi-resolution Emission Inventory for China (MEIC v1.2). It is shown that including satellite observations in the calculations increases the current bottom-up MEIC inventory emissions for the entire domain studied (15-55° N, 102-132° E) from 26.30 to 32.60 Tg annum-1, with positive updates which are stronger in winter ( ˜ 36 % increase). New source areas were identified in the southwest (25-35° N, 100-110° E) as well as in the northeast (40-50° N, 120-130° E) of the domain studied as high SO2 levels were observed by OMI, resulting in increased emissions in the a posteriori inventory that do not appear in the original MEIC v1.2 dataset. Comparisons with the independent Emissions Database for Global Atmospheric Research, EDGAR v4.3.1, show a satisfying agreement since the EDGAR 2010 bottom-up database provides 33.30 Tg annum-1 of SO2 emissions. When studying the entire OMI/Aura time period (2005 to 2015), it was shown that the SO2 emissions remain nearly constant before the year 2010, with a drift of -0.51 ± 0.38 Tg annum-1, and show a statistically significant decline after the year 2010 of -1.64 ± 0.37 Tg annum-1 for the entire domain. Similar findings were obtained when focusing on the greater Beijing area (30-40° N, 110-120° E) with pre-2010 drifts of -0.17 ± 0.14 and post-2010 drifts of -0.47 ± 0.12 Tg annum-1. The new SO2 emission inventory is publicly available and forms

76 FR 19661 - Response to Petition From New Jersey Regarding SO2

Science.gov (United States)

2011-04-07

...In this action, EPA proposes to make a finding that the coal- fired Portland Generating Station (Portland Plant) in Upper Mount Bethel Township, Northampton County, Pennsylvania, is emitting air pollutants in violation of the interstate transport provisions of the Clean Air Act (CAA or Act). Specifically, EPA is proposing to find that emissions of sulfur dioxide (SO2) from the Portland Plant significantly contribute to nonattainment and interfere with maintenance of the 1-hour SO2 national ambient air quality standard (NAAQS) in New Jersey. This finding is proposed in response to a petition submitted by the State of New Jersey Department of Environmental Protection (NJDEP) on September 17, 2010. In this action, EPA is also proposing emission limitations and compliance schedules to ensure that the Portland Plant will no longer significantly contribute to nonattainment, and no longer interfere with maintenance of the 1- hour SO2 NAAQS, thereby permitting continued operation of the Portland Plant beyond the 3-month limit established by the CAA for sources subject to such a finding.

Structure and stability of the spinach aquaporin SoPIP2;1 in detergent micelles and lipid membranes.

Directory of Open Access Journals (Sweden)

Inés Plasencia

Full Text Available BACKGROUND: SoPIP2;1 constitutes one of the major integral proteins in spinach leaf plasma membranes and belongs to the aquaporin family. SoPIP2;1 is a highly permeable and selective water channel that has been successfully overexpressed and purified with high yields. In order to optimize reconstitution of the purified protein into biomimetic systems, we have here for the first time characterized the structural stability of SoPIP2;1. METHODOLOGY/PRINCIPAL FINDING: We have characterized the protein structural stability after purification and after reconstitution into detergent micelles and proteoliposomes using circular dichroism and fluorescence spectroscopy techniques. The structure of SoPIP2;1 was analyzed either with the protein solubilized with octyl-β-D-glucopyranoside (OG or reconstituted into lipid membranes formed by E. coli lipids, diphytanoylphosphatidylcholine (DPhPC, or reconstituted into lipid membranes formed from mixtures of 1-palmitoyl-2-oleoyl-phosphatidylcholine (POPE, 1-palmitoyl-2oleoyl-phosphatidylethanolamine (POPE, 1-palmitoyl-2-oleoyl-phosphatidylserine (POPS, and ergosterol. Generally, SoPIP2;1 secondary structure was found to be predominantly α-helical in accordance with crystallographic data. The protein has a high thermal structural stability in detergent solutions, with an irreversible thermal unfolding occurring at a melting temperature of 58°C. Incorporation of the protein into lipid membranes increases the structural stability as evidenced by an increased melting temperature of up to 70°C. CONCLUSION/SIGNIFICANCE: The results of this study provide insights into SoPIP2;1 stability in various host membranes and suggest suitable choices of detergent and lipid composition for reconstitution of SoPIP2;1 into biomimetic membranes for biotechnological applications.

Human Blood CD1c+ Dendritic Cells Promote Th1 and Th17 Effector Function in Memory CD4+ T Cells.

Science.gov (United States)

Leal Rojas, Ingrid M; Mok, Wai-Hong; Pearson, Frances E; Minoda, Yoshihito; Kenna, Tony J; Barnard, Ross T; Radford, Kristen J

2017-01-01

Dendritic cells (DC) initiate the differentiation of CD4 + helper T cells into effector cells including Th1 and Th17 responses that play an important role in inflammation and autoimmune disease pathogenesis. In mice, Th1 and Th17 responses are regulated by different conventional (c) DC subsets, with cDC1 being the main producers of IL-12p70 and inducers of Th1 responses, while cDC2 produce IL-23 to promote Th17 responses. The role that human DC subsets play in memory CD4 + T cell activation is not known. This study investigated production of Th1 promoting cytokine IL-12p70, and Th17 promoting cytokines, IL-1β, IL-6, and IL-23, by human blood monocytes, CD1c + DC, CD141 + DC, and plasmacytoid DC and examined their ability to induce Th1 and Th17 responses in memory CD4 + T cells. Human CD1c + DC produced IL-12p70, IL-1β, IL-6, and IL-23 in response to R848 combined with LPS or poly I:C. CD141 + DC were also capable of producing IL-12p70 and IL-23 but were not as proficient as CD1c + DC. Activated CD1c + DC were endowed with the capacity to promote both Th1 and Th17 effector function in memory CD4 + T cells, characterized by high production of interferon-γ, IL-17A, IL-17F, IL-21, and IL-22. These findings support a role for CD1c + DC in autoimmune inflammation where Th1/Th17 responses play an important role in disease pathogenesis.

Middle infrared (wavelength range: 8 μm-14 μm) 2-dimensional spectroscopy (total weight with electrical controller: 1.7 kg, total cost: less than 10,000 USD) so-called hyperspectral camera for unmanned air vehicles like drones

Science.gov (United States)

Yamamoto, Naoyuki; Saito, Tsubasa; Ogawa, Satoru; Ishimaru, Ichiro

2016-05-01

We developed the palm size (optical unit: 73[mm]×102[mm]×66[mm]) and light weight (total weight with electrical controller: 1.7[kg]) middle infrared (wavelength range: 8[μm]-14[μm]) 2-dimensional spectroscopy for UAV (Unmanned Air Vehicle) like drone. And we successfully demonstrated the flights with the developed hyperspectral camera mounted on the multi-copter so-called drone in 15/Sep./2015 at Kagawa prefecture in Japan. We had proposed 2 dimensional imaging type Fourier spectroscopy that was the near-common path temporal phase-shift interferometer. We install the variable phase shifter onto optical Fourier transform plane of infinity corrected imaging optical systems. The variable phase shifter was configured with a movable mirror and a fixed mirror. The movable mirror was actuated by the impact drive piezo-electric device (stroke: 4.5[mm], resolution: 0.01[μm], maker: Technohands Co.,Ltd., type:XDT50-45, price: around 1,000USD). We realized the wavefront division type and near common path interferometry that has strong robustness against mechanical vibrations. Without anti-mechanical vibration systems, the palm-size Fourier spectroscopy was realized. And we were able to utilize the small and low-cost middle infrared camera that was the micro borometer array (un-cooled VOxMicroborometer, pixel array: 336×256, pixel pitch: 17[μm], frame rate 60[Hz], maker: FLIR, type: Quark 336, price: around 5,000USD). And this apparatus was able to be operated by single board computer (Raspberry Pi.). Thus, total cost was less than 10,000 USD. We joined with KAMOME-PJ (Kanagawa Advanced MOdule for Material Evaluation Project) with DRONE FACTORY Corp., KUUSATSU Corp., Fuji Imvac Inc. And we successfully obtained the middle infrared spectroscopic imaging with multi-copter drone.

T helper 17.1 cells associate with multiple sclerosis disease activity: perspectives for early intervention.

Science.gov (United States)

van Langelaar, Jamie; van der Vuurst de Vries, Roos M; Janssen, Malou; Wierenga-Wolf, Annet F; Spilt, Isis M; Siepman, Theodora A; Dankers, Wendy; Verjans, Georges M G M; de Vries, Helga E; Lubberts, Erik; Hintzen, Rogier Q; van Luijn, Marvin M

2018-05-01

Interleukin-17-expressing CD4+ T helper 17 (Th17) cells are considered as critical regulators of multiple sclerosis disease activity. However, depending on the species and pro-inflammatory milieu, Th17 cells are functionally heterogeneous, consisting of subpopulations that differentially produce interleukin-17, interferon-gamma and granulocyte macrophage colony-stimulating factor. In the current study, we studied distinct effector phenotypes of human Th17 cells and their correlation with disease activity in multiple sclerosis patients. T helper memory populations single- and double-positive for C-C chemokine receptor 6 (CCR6) and CXC chemokine receptor 3 (CXCR3) were functionally assessed in blood and/or cerebrospinal fluid from a total of 59 patients with clinically isolated syndrome, 35 untreated patients and 24 natalizumab-treated patients with relapsing-remitting multiple sclerosis, and nine patients with end-stage multiple sclerosis. Within the clinically isolated syndrome group, 23 patients had a second attack within 1 year and 26 patients did not experience subsequent attacks during a follow-up of >5 years. Low frequencies of T helper 1 (Th1)-like Th17 (CCR6+CXCR3+), and not Th17 (CCR6+CXCR3-) effector memory populations in blood strongly associated with a rapid diagnosis of clinically definite multiple sclerosis. In cerebrospinal fluid of clinically isolated syndrome and relapsing-remitting multiple sclerosis patients, Th1-like Th17 effector memory cells were abundant and showed increased production of interferon-gamma and granulocyte macrophage colony-stimulating factor compared to paired CCR6+ and CCR6-CD8+ T cell populations and their blood equivalents after short-term culturing. Their local enrichment was confirmed ex vivo using cerebrospinal fluid and brain single-cell suspensions. Across all pro-inflammatory T helper cells analysed in relapsing-remitting multiple sclerosis blood, Th1-like Th17 subpopulation T helper 17.1 (Th17.1; CCR6+CXCR3+CCR4

Twenty-five-year experience with the Björk-Shiley convexoconcave heart valve: a continuing clinical concern.

Science.gov (United States)

Blot, William J; Ibrahim, Michel A; Ivey, Tom D; Acheson, Donald E; Brookmeyer, Ron; Weyman, Arthur; Defauw, Joseph; Smith, J Kermit; Harrison, Donald

2005-05-31

The first Björk-Shiley convexoconcave (BSCC) prosthetic heart valves were implanted in 1978. The 25th anniversary provided a stimulus to summarize the research data relevant to BSCC valve fracture, patient management, and current clinical options. Published and unpublished data on the risks of BSCC valve fracture and replacement were compiled, and strategies for identifying candidates for prophylactic valve reoperation were summarized. By December 2003, outlet strut fractures (OSFs), often with fatal outcomes, had been reported in 633 BSCC valves (0.7% of 86,000 valves implanted). Fractures still continue to occur, but average rates of OSFs in 60 degrees valves are now valve characteristics, especially valve angle and size, with weaker effects associated with other manufacturing variables. OSF risks are mildly lower among women than men but decline sharply with advancing age. The risks of valve replacement typically greatly exceed those of OSF. By comparing individualized estimated risks of OSF versus valve replacement, guidelines have been developed to identify the small percentage of BSCC patients (mostly younger men) who would be expected to have a gain in life expectancy should reoperative surgery be performed. Twenty-five years after the initial BSCC valve implants, fractures continue to occur. Continued monitoring of BSCC patients is needed to track and quantify risks and enable periodic updating of guidelines for patients and their physicians.

[Congenital adrenal hyperplasia due to lack of 17α-hydroxylase: a report of a new mutation in the gene CYP17A1].

Science.gov (United States)

Perales Martínez, J I; Pina Marqués, B; de Arriba Muñoz, A; Mayayo Dehesa, E; Labarta Aizpún, J I; Loidi Fernández, L

2015-01-01

P450c17 enzyme catalyses two different reactions: the 17α-hydroxylation of progesterone and pregnenolone, and segmenting the carbon 17-20 binding from the 17,20lyase producing adrenal androgens. This enzyme is coded by the CYP17A1 gene. The case is presented of a 14 year old patient with delayed pubertal development and a high blood pressure for height and age. 46,XX karyotype. Hormonal studies highlighted hypergonadotropic hypogonadism, adrenal insufficiency and mineralocorticoid excess. Subsequent genetic studies showed a homozygous mutation in the CYP17A1 gene (c.753+G>A), not previously described, which is responsible for the pathophysiology of 17α-hydroxylase deficiency. This entity is a rare form of congenital adrenal hyperplasia. The disease often goes unnoticed until adolescence or early adult life, and should be suspected in 46,XY individuals with ambiguous genitalia or 46,XX with delayed puberty associated with hypertension and/or hypokalaemia. Copyright © 2013 Asociación Española de Pediatría. Published by Elsevier Espana. All rights reserved.

The Cs2SO4-Ce2(SO4)3-H2SO4-H2O system at 150 and 200 deg C

International Nuclear Information System (INIS)

Bondar', S.A.; Belokoskov, V.I.; Trofimov, G.V.

1982-01-01

Solubility in the system Cs 2 SO 4 -Ce 2 (SO 4 ) 3 -H 2 SO 4 -H 2 O using the isothermal method at 150 and 200 deg C at molar ratios Cs 2 SO 4 :Ce 2 (SO 4 ) 3 =1:5 and conditions of sulfate crystallization Cs 2 SO 4 xCe 2 (SO 4 ) 3 , Ce 2 (SO 4 ) 3 x0.5H 2 SO 4 xnH 2 O (n=2-3) and Ce 2 (SO 4 ) 3 x3H 2 SO 4 are determined. Double sulfate Cs 2 SO 4 xCe 2 (SO 4 ) 3 is studied using the methods of crystallooptical, thermal, X-ray phase analyses and IR spectroscopy

Recommended vapor pressures for aniline, nitromethane, 2-aminoethanol, and 1-methyl-2-pyrrolidone

Czech Academy of Sciences Publication Activity Database

Růžička, K.; Fulem, Michal; Mahnel, T.; Červinka, C.

2015-01-01

Roč. 406, Nov (2015), 34-46 ISSN 0378-3812 Institutional support: RVO:68378271 Keywords : recommended vapor pressure equations * heat capacity * ideal - gas thermodynamic properties * aniline * nitromethane Subject RIV: BJ - Thermodynamics Impact factor: 1.846, year: 2015

Promising Tools in Prostate Cancer Research: Selective Non-Steroidal Cytochrome P450 17A1 Inhibitors

Science.gov (United States)

Bonomo, Silvia; Hansen, Cecilie H.; Petrunak, Elyse M.; Scott, Emily E.; Styrishave, Bjarne; Jørgensen, Flemming Steen; Olsen, Lars

2016-07-01

Cytochrome P450 17A1 (CYP17A1) is an important target in the treatment of prostate cancer because it produces androgens required for tumour growth. The FDA has approved only one CYP17A1 inhibitor, abiraterone, which contains a steroidal scaffold similar to the endogenous CYP17A1 substrates. Abiraterone is structurally similar to the substrates of other cytochrome P450 enzymes involved in steroidogenesis, and interference can pose a liability in terms of side effects. Using non-steroidal scaffolds is expected to enable the design of compounds that interact more selectively with CYP17A1. Therefore, we combined a structure-based virtual screening approach with density functional theory (DFT) calculations to suggest non-steroidal compounds selective for CYP17A1. In vitro assays demonstrated that two such compounds selectively inhibited CYP17A1 17α-hydroxylase and 17,20-lyase activities with IC50 values in the nanomolar range, without affinity for the major drug-metabolizing CYP2D6 and CYP3A4 enzymes and CYP21A2, with the latter result confirmed in human H295R cells.

MAP17 and SGLT1 protein expression levels as prognostic markers for cervical tumor patient survival.

Directory of Open Access Journals (Sweden)

Marco Perez

Full Text Available MAP17 is a membrane-associated protein that is overexpressed in human tumors. Because the expression of MAP17 increases reactive oxygen species (ROS generation through SGLT1 in cancer cells, in the present work, we investigated whether MAP17 and/or SGLT1 might be markers for the activity of treatments involving oxidative stress, such as cisplatin or radiotherapy. First, we confirmed transcriptional alterations in genes involved in the oxidative stress induced by MAP17 expression in HeLa cervical tumor cells and found that Hela cells expressing MAP17 were more sensitive to therapies that induce ROS than were parental cells. Furthermore, MAP17 increased glucose uptake through SGLT receptors. We then analyzed MAP17 and SGLT1 expression levels in cervical tumors treated with cisplatin plus radiotherapy and correlated the expression levels with patient survival. MAP17 and SGLT1 were expressed in approximately 70% and 50% of cervical tumors of different types, respectively, but they were not expressed in adenoma tumors. Furthermore, there was a significant correlation between MAP17 and SGLT1 expression levels. High levels of either MAP17 or SGLT1 correlated with improved patient survival after treatment. However, the patients with high levels of both MAP17 and SGLT1 survived through the end of this study. Therefore, the combination of high MAP17 and SGLT1 levels is a marker for good prognosis in patients with cervical tumors after cisplatin plus radiotherapy treatment. These results also suggest that the use of MAP17 and SGLT1 markers may identify patients who are likely to exhibit a better response to treatments that boost oxidative stress in other cancer types.

Annotation Method (AM): SE17_AM1 [Metabolonote[Archive

Lifescience Database Archive (English)

Full Text Available abase search. Peaks with no hit to these databases are then selected to secondary s...earch using exactMassDB and Pep1000 databases. After the database search processes, each database hits are m...SE17_AM1 PowerGet annotation A1 In annotation process, KEGG, KNApSAcK and LipidMAPS are used for primary dat

Theoretical understanding on the v(1)-SO4(2-) band perturbed by the formation of magnesium sulfate ion pairs.

Science.gov (United States)

Zhang, Hao; Zhang, Yun-Hong; Wang, Feng

2009-02-01

The factors determining the spectroscopic characteristics of the v(1)-SO4(2-) band of the MgSO4 ion pairs are discussed via ab initio calculation, including coupling effect, hydrogen bonding effect, and direct contact effect of Mg2+ with SO4(2-). With the calculation of the heavy water hydrated contact ion pairs (CIP), the overlap between the librations of water and the v(1)-SO4(2-) band can be separated, and thus the coupling effect is abstracted, and this coupling effect leads to a blue shift for the v(1)-SO4(2-) band of 5.6 cm(-1) in the monodentate CIP and 3.6 cm(-1) in the bidentate CIP. The hydrogen bonding between each water molecule without relation to Mg2+ and the sulfate ion makes the v(1)-SO4(2-) band blue shift of 3.7 cm(-1). When the outer-sphere water around Mg2+ are hydrogen bonded between SO4(2-) and Mg2+, it will make the largest disturbance to the v(1)-SO4(2-) band. Moreover, the inner-sphere water can affect the v(1)-SO4(2-) band conjunct with the direct contact of Mg2+ with SO4(2-), showing a blue shift of 14.4 cm(-1) in the solvent-shared ion pair, 22.6 cm(-1) in the monodentate CIP, 4.3 cm(-1) in the bidentate CIP, and 21.4 cm(-1) in the tridentate CIP. At last, the Raman spectral evolution in the efflorescence production process is tried to be rationalized. The shoulder at 995 cm(-1) is attributed to the monodentate CIP with 2-3 outer-sphere water molecules, whereas the new peak at 1021 cm(-1) at high concentration is assigned to the formation of aqueous triple ion.

Neurotransmission of the Bezold-Jarisch reflex in the nucleus tractus solitarii of sino-aortic deafferentated rats.

OpenAIRE

Chianca Júnior, Deoclécio Alves; Bonagamba, Leni Gomes Heck; Machado, Beniro Honório

1997-01-01

The Bezold-Jarisch _B-J. reflex was activated by serotonin _5-HT, i.v.. before and 10 min after bilateral microinjection of increasing doses of kynurenic acid, a non-selective antagonist of excitatory amino acid _EAA. receptors, into the commissural nucleus tractus solitarii _NTS. of sino-aortic deafferentated _SAD. and sham-operated _SO. unanesthetized rats. Increasing doses of kynurenic acid produced a dose-dependent blockade of the bradycardic and hypotensive responses to B-J reflex activa...

SO2 pollution of heavy oil-fired steam power plants in Iran

International Nuclear Information System (INIS)

Nazari, S.; Shahhoseini, O.; Sohrabi-Kashani, A.; Davari, S.; Sahabi, H.; Rezaeian, A.

2012-01-01

Steam power plants using heavy oil provided about 17.4%, equivalent to 35.49 TWh, of electricity in Iran in 2007. However, having 1.55–3.5 weight percentage of sulfur, heavy oil produces SO 2 pollutant. Utilization of Flue Gas Desulfurization systems (FGD) in Iran's steam power plants is not common and thereby, this pollutant is dispersed in the atmosphere easily. In 2007, the average emission factor of SO 2 pollutant for steam power plants was 15.27 g/kWh, which means regarding the amount of electricity generated by steam power plants using heavy oil, 541,000 Mg of this pollutant was produced. In this study, mass distribution of SO 2 in terms of Mg/yr is considered and dispersion of this pollutant in each of the 16 steam power plants under study is modeled using Atmospheric Dispersion Modeling System (ADMS). Details of this study are demonstrated using Geographical Information System (GIS) software, ArcGIS. Finally, the average emission factor of SO 2 and the emission of it in Iran's steam power plants as well as SO 2 emission reduction programs of this country are compared with their alternatives in Turkey and China.

Journal of Mining and Geology - Vol 42, No 1 (2006)

African Journals Online (AJOL)

Hydrocarbon charge in petroleum systems of the Niger Delta, Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. BJ Katz, RC Haack, 1-14. http://dx.doi.org/10.4314/jmg.v42i1.18839 · Management approaches for Nigeria's water resources · EMAIL FULL TEXT EMAIL FULL ...

Increased Th1/Th17 Responses Contribute to Low-Grade Inflammation in Age-Related Macular Degeneration.

Science.gov (United States)

Chen, Jiajia; Wang, Wenzhan; Li, Qiuming

2017-01-01

Age-related macular degeneration (AMD) is the primary cause of senior blindness in developed countries. Mechanisms underlying initiation and development of AMD remained known. We examined the CD4+ T cell compartments and their functions in AMD patients. AMD patients presented significantly higher frequencies of interferon (IFN)-γ-expressing and interleukin (IL)-17-expressing CD4+ T cells than healthy controls. The levels of IFN-γ and IL-17 expression by CD4+ T cells were significantly higher in AMD patients. These IFN-γ-expressing Th1 cells and IL-17-expressing Th17 cells could be selectively enriched by surface CCR3+ and CCR4+CCR6+ expression, respectively. Th1 and Th17 cells from AMD patients promoted the differentiation of monocytes toward M1 macrophages, which were previously associated with retinal damage. Th1 and Th17 cells also increased the level of MHC class I expression in human retinal pigment epithelial (RPE)-1 cells, while Th1 cells increased the frequency of MHC class II-expressing RPE-1 cells. These proinflammatory effects were partly, but not entirely, induced by the secretion of IFN-γ and IL-17. This study demonstrated an enrichment of Th1 cells and Th17 cells in AMD patients. These Th1 and Th17 cells possessed proinflammatory roles in an IFN-γ- and IL-17-dependent fashion, and could potentially serve as therapeutic targets. © 2017 The Author(s). Published by S. Karger AG, Basel.

Dicty_cDB: SFC123 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available SF (Link to library) SFC123 (Link to dictyBase) - - - Contig-U16368-1 SFC123E (Link...) Clone ID SFC123 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16368-1 Ori...CVPHHDGCGNIQCPWGHYCVNEHGKCRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICT...CRCVPHRPPPRPPVDQCRNQHCPH GYSCRVIKGCATCVRDARPPHNLCRGFGCPEGSHCEVLEKHPVCVRNHVPPHPPPPPQIC GSVNCGPGYICTIINGHPTCIR...(bits) Value N D13973 |D13973.1 Dictyostelium discoideum DNA for Dp87 protein, complete cds. 1643 0.0 5 BJ17

Improved network monitoring using UTC detector data 'RAID'

OpenAIRE

Cherrett, Tom; Waterson, Ben; McDonald, Mike; Clarke, Russell; Bangert, Alex; Morris, Ray

2002-01-01

As part of the 5th Framework PRIME project1 (Prediction Of Congestion And Incidents In Real Time, For Intelligent Incident Management And Emergency Traffic Management), a new incident detection algorithm has been developed using the 250-ms digital data produced by UTC detectors. The contributors to this part of the project were the University of Southampton, Southampton City Council and Siemens Traffic Controls.

Sodium channel Nav1.7 immunoreactivity in painful human dental pulp and burning mouth syndrome

Directory of Open Access Journals (Sweden)

Yiangou Yiangos

2010-06-01

Full Text Available Abstract Background Voltage gated sodium channels Nav1.7 are involved in nociceptor nerve action potentials and are known to affect pain sensitivity in clinical genetic disorders. Aims and Objectives To study Nav1.7 levels in dental pulpitis pain, an inflammatory condition, and burning mouth syndrome (BMS, considered a neuropathic orofacial pain disorder. Methods Two groups of patients were recruited for this study. One group consisted of patients with dental pulpitis pain (n = 5 and controls (n = 12, and the other patients with BMS (n = 7 and controls (n = 10. BMS patients were diagnosed according to the International Association for the Study of Pain criteria; a pain history was collected, including the visual analogue scale (VAS. Immunohistochemistry with visual intensity and computer image analysis were used to evaluate levels of Nav1.7 in dental pulp tissue samples from the dental pulpitis group, and tongue biopsies from the BMS group. Results There was a significantly increased visual intensity score for Nav1.7 in nerve fibres in the painful dental pulp specimens, compared to controls. Image analysis showed a trend for an increase of the Nav1.7 immunoreactive % area in the painful pulp group, but this was not statistically significant. When expressed as a ratio of the neurofilament % area, there was a strong trend for an increase of Nav1.7 in the painful pulp group. Nav1.7 immunoreactive fibres were seen in abundance in the sub-mucosal layer of tongue biopsies, with no significant difference between BMS and controls. Conclusion Nav1.7 sodium channel may play a significant role in inflammatory dental pain. Clinical trials with selective Nav1.7 channel blockers should prioritise dental pulp pain rather than BMS.

Sodium channel Nav1.7 immunoreactivity in painful human dental pulp and burning mouth syndrome

Science.gov (United States)

2010-01-01

Background Voltage gated sodium channels Nav1.7 are involved in nociceptor nerve action potentials and are known to affect pain sensitivity in clinical genetic disorders. Aims and Objectives To study Nav1.7 levels in dental pulpitis pain, an inflammatory condition, and burning mouth syndrome (BMS), considered a neuropathic orofacial pain disorder. Methods Two groups of patients were recruited for this study. One group consisted of patients with dental pulpitis pain (n = 5) and controls (n = 12), and the other patients with BMS (n = 7) and controls (n = 10). BMS patients were diagnosed according to the International Association for the Study of Pain criteria; a pain history was collected, including the visual analogue scale (VAS). Immunohistochemistry with visual intensity and computer image analysis were used to evaluate levels of Nav1.7 in dental pulp tissue samples from the dental pulpitis group, and tongue biopsies from the BMS group. Results There was a significantly increased visual intensity score for Nav1.7 in nerve fibres in the painful dental pulp specimens, compared to controls. Image analysis showed a trend for an increase of the Nav1.7 immunoreactive % area in the painful pulp group, but this was not statistically significant. When expressed as a ratio of the neurofilament % area, there was a strong trend for an increase of Nav1.7 in the painful pulp group. Nav1.7 immunoreactive fibres were seen in abundance in the sub-mucosal layer of tongue biopsies, with no significant difference between BMS and controls. Conclusion Nav1.7 sodium channel may play a significant role in inflammatory dental pain. Clinical trials with selective Nav1.7 channel blockers should prioritise dental pulp pain rather than BMS. PMID:20529324

Antioxidant, antiapoptotic and amino acid balance regulating activities of 1,7-dihydroxy-3,4,8-trimethoxyxanthone against dimethylnitrosamine-induced liver fibrosis.

Directory of Open Access Journals (Sweden)

Xi-Yuan Zheng

Full Text Available Liver fibrosis represents the consequences of a sustained wound healing response to chronic liver injury which could be caused by viral, autoimmune, drugs, and so on. Unfortunately, there was no effective therapy available for liver fibrosis in clinic. In this study, we identified the anti-fibrotic effects of 1,7-dihydroxy-3,4,8-trimethoxyxanthone (ZYC-1 on the dimethylnitrosamine (DMN-induced rat model. ZYC-1 was isolated from Swertia punicea Hemsl and was administrated to DMN-induced rat model. ZYC decreased the hyaluronic acid (HA, type IV collagen (CIV and hydroxyproline (Hyp levels and inhibited the expression of α smooth muscle actin (α-SMA and transforming growth factor beta 1 (TGF-1β. The anti-fibrotic effect of ZYC-1 was also confirmed by Sirius Red staining. Finally, we identified 42 differentially expressed proteins by using proteomics analysis after ZYC-1 treatment, of which 17 were up-regulated and 25 were down-regulated. These Most of the 42 proteins are involved in the oxidative stress pathway, the mitochondrial-mediated apoptotic pathway and the amino acid metabolism pathway. Our study presented the first elucidated mechanisms of xanthone on liver fibrosis in vivo. This study pointed out that ZYC-1 may be used as a lead compound for hepatofibrosis treatment.

Estradiol upregulates voltage-gated sodium channel 1.7 in trigeminal ganglion contributing to hyperalgesia of inflamed TMJ.

Directory of Open Access Journals (Sweden)

Rui-Yun Bi

Full Text Available Temporomandibular disorders (TMDs have the highest prevalence in women of reproductive age. The role of estrogen in TMDs and especially in TMDs related pain is not fully elucidated. Voltage-gated sodium channel 1.7 (Nav1.7 plays a prominent role in pain perception and Nav1.7 in trigeminal ganglion (TG is involved in the hyperalgesia of inflamed Temporomandibular joint (TMJ. Whether estrogen could upregulate trigeminal ganglionic Nav1.7 expression to enhance hyperalgesia of inflamed TMJ remains to be explored.Estrous cycle and plasma levels of 17β-estradiol in female rats were evaluated with vaginal smear and enzyme linked immunosorbent assay, respectively. Female rats were ovariectomized and treated with 17β-estradiol at 0 μg, 20 μg and 80 μg, respectively, for 10 days. TMJ inflammation was induced using complete Freund's adjuvant. Head withdrawal thresholds and food intake were measured to evaluate the TMJ nociceptive responses. The expression of Nav1.7 in TG was examined using real-time PCR and western blot. The activity of Nav1.7 promoter was examined using luciferase reporter assay. The locations of estrogen receptors (ERα and ERβ, the G protein coupled estrogen receptor (GPR30, and Nav1.7 in TG were examined using immunohistofluorescence.Upregulation of Nav1.7 in TG and decrease in head withdrawal threshold were observed with the highest plasma 17β-estradiol in the proestrus of female rats. Ovariectomized rats treated with 80 μg 17β-estradiol showed upregulation of Nav1.7 in TG and decrease in head withdrawal threshold as compared with that of the control or ovariectomized rats treated with 0 μg or 20 μg. Moreover, 17β-estradiol dose-dependently potentiated TMJ inflammation-induced upregulation of Nav1.7 in TG and also enhanced TMJ inflammation-induced decrease of head withdrawal threshold in ovariectomized rats. In addition, the estrogen receptor antagonist, ICI 182,780, partially blocked the 17β-estradiol effect on Nav1.7

17 CFR 240.15c1-2 - Fraud and misrepresentation.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fraud and misrepresentation. 240.15c1-2 Section 240.15c1-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-2 Fraud and...

17 CFR 275.206(4)-1 - Advertisements by investment advisers.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Advertisements by investment advisers. 275.206(4)-1 Section 275.206(4)-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT ADVISERS ACT OF 1940 § 275.206(4)-1 Advertisements by investment advisers. (a) It shall...

Induction and activation of human Th17 by targeting antigens to dendritic cells via dectin-1.

Science.gov (United States)

Duluc, Dorothée; Joo, HyeMee; Ni, Ling; Yin, Wenjie; Upchurch, Katherine; Li, Dapeng; Xue, Yaming; Klucar, Peter; Zurawski, Sandra; Zurawski, Gerard; Oh, SangKon

2014-06-15

Recent compelling evidence indicates that Th17 confer host immunity against a variety of microbes, including extracellular and intracellular pathogens. Therefore, understanding mechanisms for the induction and activation of Ag-specific Th17 is important for the rational design of vaccines against pathogens. To study this, we employed an in vitro system in which influenza hemagglutinin (HA) 1 was delivered to dendritic cells (DCs) via Dectin-1 using anti-human Dectin-1 (hDectin-1)-HA1 recombinant fusion proteins. We found that healthy individuals maintained broad ranges of HA1-specific memory Th17 that were efficiently activated by DCs targeted with anti-hDectin-1-HA1. Nonetheless, these DCs were not able to induce a significant level of HA1-specific Th17 responses even in the presence of the Th17-promoting cytokines IL-1β and IL-6. We further found that the induction of surface IL-1R1 expression by signals via TCRs and common γ-chain receptors was essential for naive CD4(+) T cell differentiation into HA1-specific Th17. This process was dependent on MyD88, but not IL-1R-associated kinase 1/4. Thus, interruptions in STAT3 or MyD88 signaling led to substantially diminished HA1-specific Th17 induction. Taken together, the de novo generation of pathogen-specific human Th17 requires complex, but complementary, actions of multiple signals. Data from this study will help us design a new and effective vaccine strategy that can promote Th17-mediated immunity against microbial pathogens. Copyright © 2014 by The American Association of Immunologists, Inc.

Structure and Stability of the Spinach Aquaporin SoPIP2;1 in Detergent Micelles and Lipid Membranes

DEFF Research Database (Denmark)

Plasencia, Ines; Survery, Sabeen; Ibragimova, Sania

2011-01-01

Background: SoPIP2;1 constitutes one of the major integral proteins in spinach leaf plasma membranes and belongs to the aquaporin family. SoPIP2;1 is a highly permeable and selective water channel that has been successfully overexpressed and purified with high yields. In order to optimize...... reconstitution of the purified protein into biomimetic systems, we have here for the first time characterized the structural stability of SoPIP2;1. Methodology/Principal Finding: We have characterized the protein structural stability after purification and after reconstitution into detergent micelles...... and proteoliposomes using circular dichroism and fluorescence spectroscopy techniques. The structure of SoPIP2;1 was analyzed either with the protein solubilized with octyl-beta-D-glucopyranoside (OG) or reconstituted into lipid membranes formed by E. coli lipids, diphytanoylphosphatidylcholine (DPh...

Chemoselective reduction of 1,4,6-cholestatrien-3-one and 1,4,6-androstatriene-3,17-dione by various hydride reagents.

Science.gov (United States)

Kim, Eunjeong; Ma, Eunsook

2007-04-01

The chemoselectivity of rigid cyclic alpha,beta-unsaturated carbonyl group on the reducing agents was influenced by the ring size and steric factor. Cholesterol (cholest-5-en-3beta-ol) and dehydroepiandrosterone (DHEA) were oxidized with 2,3-dichloro-5,6-dicyano-1,4-benzoquinone to form 1,4,6-cholestatrien-3-one and 1,4,6-androstatriene-3,17-dione. They were reduced with NaBH(4), lithium tri-sec-butylborohydride (l-Selectride), LiAlH(4), 9-borabicyclo[3.3.1]nonane (9-BBN), lithium triethylborohydride (Super-hydride), and BH(3) x (CH(3))(2)S in various conditions, respectively. Reduction of 1,4,6-cholestatrien-3-one and 1,4,6-androstatriene-3,17-dione by NaBH(4) (4 equiv.) produced 4,6-cholestadien-3beta-ol and 4,6-androstadiene-3beta,17beta-diol, respectively. Reduction by l-Selectride (12 equiv.) afforded 4,6-cholestadien-3alpha-ol and 4,6-androstadiene-3alpha,17beta-diol, chemoselectively. Reaction with Super-hydride (12 equiv.) produced 4,6-cholestadien-3-one and 3-oxo-4,6-androstadien-17beta-ol. Reduction of 1,4,6-cholestatrien-3-one by 9-BBN (14 equiv.) produced 1,4,6-cholestatrien-3alpha-ol, but 1,4,6-androstatriene-3,17-dione was not reacted with 9-BBN in the reaction conditions. Reaction of LiAlH(4) (6 equiv.) formed 4,6-cholestadien-3beta-ol and 3-oxo-1,4,6-androstatrien-17beta-ol. Reduction of 1,4,6-cholestatrien-3-one by BH(3) x (CH(3))(2)S (11 equiv.) gave cholestane as major compound and unlike reactivity of cholesterol, 1,4,6-androstatriene-3,17-dione by 8 equiv. of BH(3) x (CH(3))(2)S formed 3-oxo-1,4,6-androstatrien-17beta-ol. LiAlH(4) and BH(3) x (CH(3))(2)S showed relatively low chemoselectivity.

17 CFR 240.36a1-1 - Exemption from Section 7 for OTC derivatives dealers.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Exemption from Section 7 for OTC derivatives dealers. 240.36a1-1 Section 240.36a1-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) GENERAL RULES AND REGULATIONS, SECURITIES EXCHANGE ACT OF 1934...

Genetic variation in the HSD17B1 gene and risk of prostate cancer.

Directory of Open Access Journals (Sweden)

Peter Kraft

2005-11-01

Full Text Available Steroid hormones are believed to play an important role in prostate carcinogenesis, but epidemiological evidence linking prostate cancer and steroid hormone genes has been inconclusive, in part due to small sample sizes or incomplete characterization of genetic variation at the locus of interest. Here we report on the results of a comprehensive study of the association between HSD17B1 and prostate cancer by the Breast and Prostate Cancer Cohort Consortium, a large collaborative study. HSD17B1 encodes 17beta-hydroxysteroid dehydrogenase 1, an enzyme that converts dihydroepiandrosterone to the testosterone precursor Delta5-androsterone-3beta,17beta-diol and converts estrone to estradiol. The Breast and Prostate Cancer Cohort Consortium researchers systematically characterized variation in HSD17B1 by targeted resequencing and dense genotyping; selected haplotype-tagging single nucleotide polymorphisms (htSNPs that efficiently predict common variants in U.S. and European whites, Latinos, Japanese Americans, and Native Hawaiians; and genotyped these htSNPs in 8,290 prostate cancer cases and 9,367 study-, age-, and ethnicity-matched controls. We found no evidence that HSD17B1 htSNPs (including the nonsynonymous coding SNP S312G or htSNP haplotypes were associated with risk of prostate cancer or tumor stage in the pooled multiethnic sample or in U.S. and European whites. Analyses stratified by age, body mass index, and family history of disease found no subgroup-specific associations between these HSD17B1 htSNPs and prostate cancer. We found significant evidence of heterogeneity in associations between HSD17B1 haplotypes and prostate cancer across ethnicity: one haplotype had a significant (p < 0.002 inverse association with risk of prostate cancer in Latinos and Japanese Americans but showed no evidence of association in African Americans, Native Hawaiians, or whites. However, the smaller numbers of Latinos and Japanese Americans in this study makes

Updated SO2 emission estimates over China using OMI/Aura observations

Directory of Open Access Journals (Sweden)

M. E. Koukouli

2018-03-01

Full Text Available The main aim of this paper is to update existing sulfur dioxide (SO2 emission inventories over China using modern inversion techniques, state-of-the-art chemistry transport modelling (CTM and satellite observations of SO2. Within the framework of the EU Seventh Framework Programme (FP7 MarcoPolo (Monitoring and Assessment of Regional air quality in China using space Observations project, a new SO2 emission inventory over China was calculated using the CHIMERE v2013b CTM simulations, 10 years of Ozone Monitoring Instrument (OMI/Aura total SO2 columns and the pre-existing Multi-resolution Emission Inventory for China (MEIC v1.2. It is shown that including satellite observations in the calculations increases the current bottom-up MEIC inventory emissions for the entire domain studied (15–55° N, 102–132° E from 26.30 to 32.60 Tg annum−1, with positive updates which are stronger in winter ( ∼  36 % increase. New source areas were identified in the southwest (25–35° N, 100–110° E as well as in the northeast (40–50° N, 120–130° E of the domain studied as high SO2 levels were observed by OMI, resulting in increased emissions in the a posteriori inventory that do not appear in the original MEIC v1.2 dataset. Comparisons with the independent Emissions Database for Global Atmospheric Research, EDGAR v4.3.1, show a satisfying agreement since the EDGAR 2010 bottom-up database provides 33.30 Tg annum−1 of SO2 emissions. When studying the entire OMI/Aura time period (2005 to 2015, it was shown that the SO2 emissions remain nearly constant before the year 2010, with a drift of −0.51 ± 0.38 Tg annum−1, and show a statistically significant decline after the year 2010 of −1.64 ± 0.37 Tg annum−1 for the entire domain. Similar findings were obtained when focusing on the greater Beijing area (30–40° N, 110–120° E with pre-2010 drifts of −0.17 ± 0.14 and post-2010

/sup 13/C, /sup 17/O, and /sup 33/S NMR spectra of alkyl phenyl sulfones C/sub 6/H/sub 5/SO/sub 2/Alk

Energy Technology Data Exchange (ETDEWEB)

Bzhezovskii, V.M.; Valeev, R.B.; Kalabin, G.A.; Aliev, I.A.

1987-06-20

The /sup 13/C, /sup 17/O, and /sup 33/S NMR spectra of alkyl phenyl sulfones C/sub 6/H/sub 5/SO/sub 2/Alk were obtained. The changes in the screening of the /sup 13/C, /sup 17/O, and /sup 33/S nuclei in these compounds are determined by the effect of the alkyl substituents, which alternates in sign and decreases along the chain of atoms in the order: CH/sub 3/, C/sub 2/H/sub 5/, iso-C/sub 3/H/sub 7/, and tert-C/sub 4/H/sub 9/. In the alkyl phenyl sulfides C/sub 6/H/sub 5/SAlk the additional effect of disruption in the p,..pi.. interaction between the sulfur atom and the benzene ring as a result of conformational changes is superimposed on the screening of the /sup 13/C/sup ortho/ nuclei. For the changes in the screening of the /sup 13/C/sup para/ nuclei in C/sub 6/H/sub 5/SAlk the steric disruption of the p,..pi.. conjugation by the alkyl substituents is determining.

17 CFR 240.8c-1 - Hypothecation of customers' securities.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Hypothecation of customers... Securities Exchange Act of 1934 Hypothecation of Customers' Securities § 240.8c-1 Hypothecation of customers... any customer under circumstances: (1) That will permit the commingling of securities carried for the...

Rate constant for the reaction SO + BrO yields SO2 + Br

Science.gov (United States)

Brunning, J.; Stief, L.

1986-01-01

The rate of the radical-radical reaction SO + BrO yields SO2 + Br has been determined at 298 K in a discharge flow system near 1 torr pressure with detection of SO and BrO via collision-free sampling mass spectrometry. The rate constant was determined using two different methods: measuring the decay of SO radicals in the presence of an excess of BrO and measuring the decay of BrO radicals in excess SO. The results from the two methods are in reasonable agreement and the simple mean of the two values gives the recommended rate constant at 298 K, k = (5.7 + or - 2.0) x 10 to the -11th cu cm/s. This represents the first determination of this rate constant and it is consistent with a previously derived lower limit based on SO2 formation. Comparison is made with other radical-radical reactions involving SO or BrO. The reaction SO + BrO yields SO2 + Br is of interest for models of the upper atmosphere of the earth and provides a potential coupling between atmospheric sulfur and bromine chemistry.

Supersymmetric SO(10) models inspired by deconstruction

International Nuclear Information System (INIS)

Huang Chaoshang; Jiang Jing; Li Tianjun

2004-01-01

We consider 4-dimensional N=1 supersymmetric SO(10) models inspired by deconstruction of 5-dimensional N=1 supersymmetric orbifold SO(10) models and high-dimensional non-supersymmetric SO(10) models with Wilson line gauge symmetry breaking. We discuss the SO(10)xSO(10) models with bi-fundamental link fields where the gauge symmetry can be broken down to the Pati-Salam, SU(5)xU(1), flipped SU(5)xU(1)' or the Standard Model like gauge symmetry. We also propose an SO(10)xSO(6)xSO(4) model with bi-fundamental link fields where the gauge symmetry is broken down to the Pati-Salam gauge symmetry, and an SO(10)xSO(10) model with bi-spinor link fields where the gauge symmetry is broken down to the flipped SU(5)xU(1)' gauge symmetry. In these two models, the Pati-Salam and flipped SU(5)xU(1)' gauge symmetry can be further broken down to the Standard Model gauge symmetry, the doublet-triplet splittings can be obtained by the missing partner mechanism, and the proton decay problem can be solved. We also study the gauge coupling unification. We briefly comment on the interesting variation models with gauge groups SO(10)xSO(6) and SO(10)xflippedSU(5)xU(1)' in which the proton decay problem can be solved

Flop transitions in cuprate and color superconductors: From SO(5) to SO(10) unification?

Energy Technology Data Exchange (ETDEWEB)

Chandrasekharan, S.; Chudnovsky, V.; Schlittgen, B.; Wiese, U.-J

2001-03-01

The phase diagrams of cuprate superconductors and of QCD at non-zero baryon chemical potential are qualitatively similar. The Neel phase of the cuprates corresponds to the chirally broken phase of QCD, and the high-temperature superconducting phase corresponds to the color superconducting phase. In the SO(5) theory for the cuprates the SO(3){sub s} spin rotational symmetry and the U(1){sub em} gauge symmetry of electromagnetism are dynamically unified. This suggests that the SU(2){sub L} x SU(2){sub R} x U(1){sub B} chiral symmetry of QCD and the SU(3){sub c} color gauge symmetry may get unified to SO(10). Dynamical enhancement of symmetry from SO(2){sub s} x Z(2) to SO(3){sub s} is known to occur in anisotropic antiferromagnets. In these systems the staggered magnetization flops from an easy 3-axis into the 12-plane at a critical value of the external magnetic field. Similarly, the phase transitions in the SO(5) and SO(10) models are flop transitions of a 'superspin'. Despite this fact, a renormalization group flow analysis in 4 -- {epsilon} dimensions indicates that a point with full SO(5) or SO(10) symmetry exists neither in the cuprates nor in QCD.

Flop transitions in cuprate and color superconductors: From SO(5) to SO(10) unification?

International Nuclear Information System (INIS)

Chandrasekharan, S.; Chudnovsky, V.; Schlittgen, B.; Wiese, U.-J.

2001-01-01

The phase diagrams of cuprate superconductors and of QCD at non-zero baryon chemical potential are qualitatively similar. The Neel phase of the cuprates corresponds to the chirally broken phase of QCD, and the high-temperature superconducting phase corresponds to the color superconducting phase. In the SO(5) theory for the cuprates the SO(3) s spin rotational symmetry and the U(1) em gauge symmetry of electromagnetism are dynamically unified. This suggests that the SU(2) L x SU(2) R x U(1) B chiral symmetry of QCD and the SU(3) c color gauge symmetry may get unified to SO(10). Dynamical enhancement of symmetry from SO(2) s x Z(2) to SO(3) s is known to occur in anisotropic antiferromagnets. In these systems the staggered magnetization flops from an easy 3-axis into the 12-plane at a critical value of the external magnetic field. Similarly, the phase transitions in the SO(5) and SO(10) models are flop transitions of a 'superspin'. Despite this fact, a renormalization group flow analysis in 4 -- ε dimensions indicates that a point with full SO(5) or SO(10) symmetry exists neither in the cuprates nor in QCD

Separation negatives from Kodak film types SO-368 and SO-242

Science.gov (United States)

Weinstein, M. S.

1972-01-01

Two master resolution friskets were produced on Kodak film types SO-368 and SO-242. These target masters consisted of 21 density steps with three-bar resolution targets at five modulation levels within each step. The target masters were contact printed onto Kodak separation negative film, type 4131, using both a contact printing frame and enlarger as one method of exposure, and a Miller-Holzwarth contact printer as the other exposing device. Red, green, and blue Wratten filters were used to filter the exposing source. Tray processing was done with DK-50 developer diluted 1:2 at a temperature of 70 F. The resolution values were read for the SO-368 and SO-242 target masters, and the red, green, and blue separation negatives.

Low-temperature structural transition in the quasi-one-dimensional spin-1/2 compound L i2C u2O (SO4) 2

Science.gov (United States)

Rousse, G.; Rodríguez-Carvajal, J.; Giacobbe, C.; Sun, M.; Vaccarelli, O.; Radtke, G.

2017-04-01

A thorough structural exploration has been made on the quasi-one-dimensional S =1 /2 compound L i2C u2O (SO4) 2 by neutron and synchrotron x-ray diffraction. It reveals the occurrence of a structural transition at 125 K, characterized by a lowering of symmetry from P 42/m to P 1 ¯ , which is possibly driven by an exchange striction mechanism. This transition involves a dimerization of some Cu in the edge-sharing tetrahedral Cu chains. A symmetry mode analysis indicates that one representation, Γ3+Γ4+ , dominates the structural transition. Interestingly, no intermediate structure with P 112 /m symmetry is observed experimentally. Lastly, temperature dependent magnetic susceptibility measurements and neutron diffraction reveal that the magnetic ground state of this compound is a spin-singlet with a spin gap, characterized by the absence of long-range magnetic order down to 1.7 K.

CLINICAL STUDIES OF REACTOGENICITY, SAFETY AND IMMUNOGENICITY OF LIVE MONOVALENT INFLUENZA VACCINE (STRAIN А/17/CALIFORNIA/2009/38 — H1N1 IN CHILDREN

Directory of Open Access Journals (Sweden)

D.S. Bushmenkov

2010-01-01

Full Text Available Results of performed pre-clinical and clinical studies with volunteers 18-60 years old allowed registration of vaccine «INFLUVIR» (live monovalent vaccine for the prophylaxis of influenza A/H1N1, strain A/17/California/2009/38 (H1N1, developed by NPO «Microgen» in Russian Federation so timely vaccination campaign was performed. As a result, the level of morbidity with influenza A/H1N1 in Russia was decreased, and development of complication was prevented. Clinical studies in different groups of children were performed for the purpose of widening indications for vaccine «INFLUVIR» administration. According to the results of studies vaccine «INFLUVIR» has good tolerability and safety, low reactogenicity, and significant immunogenicity. This fact will allow changing of present normative documentation and administration of «INFLUVIR» in children of different age for prophylaxis of influenza A/H1N1.Key words: children, influenza, virus A/H1N1, live influenza vaccine, tolerability, safety, immunogenicity.(Voprosy sovremennoi pediatrii — Current Pediatrics. – 2010;9(4:101-105

2016 Electrochemistry Gordon Research Conference and Gordon Research Seminar

Science.gov (United States)

2016-02-23

Russell (University of Southampton, United Kingdom ) "New Adventures in Spectroscopic Studies of Electrode Surfaces" 9:15 pm - 9:30 pm Discussion Monday...Determination of Molecular Co-Catalysts for Energetically Efficient Electrochemical Processes" 12:10 pm - 12:30 pm Discussion 12:30 pm Lunch 1:30 pm - 4:00...discussion and mentoring. Organizers: Carol Korzeniewski (Texas Tech University, USA) and Andrea Russell (University of Southampton, United Kingdom

Obesity Drives Th17 Cell Differentiation by Inducing the Lipid Metabolic Kinase, ACC1.

Science.gov (United States)

Endo, Yusuke; Asou, Hikari K; Matsugae, Nao; Hirahara, Kiyoshi; Shinoda, Kenta; Tumes, Damon J; Tokuyama, Hirotake; Yokote, Koutaro; Nakayama, Toshinori

2015-08-11

Chronic inflammation due to obesity contributes to the development of metabolic diseases, autoimmune diseases, and cancer. Reciprocal interactions between metabolic systems and immune cells have pivotal roles in the pathogenesis of obesity-associated diseases, although the mechanisms regulating obesity-associated inflammatory diseases are still unclear. In the present study, we performed transcriptional profiling of memory phenotype CD4 T cells in high-fat-fed mice and identified acetyl-CoA carboxylase 1 (ACC1, the gene product of Acaca) as an essential regulator of Th17 cell differentiation in vitro and of the pathogenicity of Th17 cells in vivo. ACC1 modulates the DNA binding of RORγt to target genes in differentiating Th17 cells. In addition, we found a strong correlation between IL-17A-producing CD45RO(+)CD4 T cells and the expression of ACACA in obese subjects. Thus, ACC1 confers the appropriate function of RORγt through fatty acid synthesis and regulates the obesity-related pathology of Th17 cells. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

Th1, Th17, CXCL16 and homocysteine elevated after intracranial and cervical stent implantation.

Science.gov (United States)

Tang, Yanyan; Wei, Yunfei; Ye, Ziming; Qin, Chao

2017-08-01

The presence of Th1 and Th17 cells has been observed as major inducers in inflammation and immune responses associated stenting. However, there is rare data on the impact of Th1, Th17, CXCL16 and homocysteine after cerebral stent implantation. Here, we performed the statistical analysis to first evaluate the variation of the Th17and Th1 cells and their related cytokines, CXCL16 and homocysteine in the peripheral blood of patients with cerebral stenting. The flow cytometry was used to detect the proportion of Th1 and Th17 cells in peripheral blood mononuclear cells (PBMCs). The enzyme-linked immunosorbent assay was used to measure the serum concentrations of IFN-γ, IL-17 and CXCL16. Plasma homocysteine was examined by immunoturbidimetry. The level of Th1, CXCL16 and homocysteine showed an increase at 3 d, followed by the continuous decrease at 7 d and 3 months. The frequency of Th17 cells increased to a peak at three days, and subsequently decreased with a higher level than baseline. Our data revealed that the variation in Th1, Th17, CXCL16 and homocysteine in peripheral blood of patients with stenting may be implicated in inflammation after intracranial and cervical stent implantation. A better understanding of these factors will provide help for further drug design and clinical therapy.

Delayed Activation Kinetics of Th2- and Th17 Cells Compared to Th1 Cells.

Science.gov (United States)

Duechting, Andrea; Przybyla, Anna; Kuerten, Stefanie; Lehmann, Paul V

2017-09-12

During immune responses, different classes of T cells arise: Th1, Th2, and Th17. Mobilizing the right class plays a critical role in successful host defense and therefore defining the ratios of Th1/Th2/Th17 cells within the antigen-specific T cell repertoire is critical for immune monitoring purposes. Antigen-specific Th1, Th2, and Th17 cells can be detected by challenging peripheral blood mononuclear cells (PBMC) with antigen, and establishing the numbers of T cells producing the respective lead cytokine, IFN-γ and IL-2 for Th1 cells, IL-4 and IL-5 for Th2, and IL-17 for Th-17 cells, respectively. Traditionally, these cytokines are measured within 6 h in flow cytometry. We show here that 6 h of stimulation is sufficient to detect peptide-induced production of IFN-γ, but 24 h are required to reveal the full frequency of protein antigen-specific Th1 cells. Also the detection of IL-2 producing Th1 cells requires 24 h stimulation cultures. Measurements of IL-4 producing Th2 cells requires 48-h cultures and 96 h are required for frequency measurements of IL-5 and IL-17 secreting T cells. Therefore, accounting for the differential secretion kinetics of these cytokines is critical for the accurate determination of the frequencies and ratios of antigen-specific Th1, Th2, and Th17 cells.

Mechanism of Cytochrome P450 17A1-Catalyzed Hydroxylase and Lyase Reactions

DEFF Research Database (Denmark)

Bonomo, Silvia; Jorgensen, Flemming Steen; Olsen, Lars

2017-01-01

Cytochrome P450 17A1 (CYP17A1) catalyzes C17 hydroxylation of pregnenolone and progesterone and the subsequent C17–C20 bond cleavage (lyase reaction) to form androgen precursors. Compound I (Cpd I) and peroxo anion (POA) are the heme-reactive species underlying the two reactions. We have characte...... the concept that the selectivity of the steroidogenic CYPs is ruled by direct interactions with the enzyme, in contrast to the selectivity of drug-metabolizing CYPs, where the reactivity of the substrates dominates....... characterized the reaction path for both the hydroxylase and lyase reactions using density functional theory (DFT) calculations and the enzyme–substrate interactions by molecular dynamics (MD) simulations. Activation barriers for positions subject to hydroxylase reaction have values close to each other and span...

Topological features of the Sokolov integrable case on the Lie algebra so(3,1)

International Nuclear Information System (INIS)

Novikov, D V

2014-01-01

The integrable Sokolov case on so(3,1) ⋆ is investigated. This is a Hamiltonian system with two degrees of freedom, in which the Hamiltonian and the additional integral are homogeneous polynomials of degrees 2 and 4, respectively. It is an interesting feature of this system that connected components of common level surfaces of the Hamiltonian and the additional integral turn out to be noncompact. The critical points of the moment map and their indices are found, the bifurcation diagram is constructed, and the topology of noncompact level surfaces is determined, that is, the closures of solutions of the Sokolov system on so(3,1) are described. Bibliography: 24 titles

17 CFR 270.12d1-1 - Exemptions for investments in money market funds.

Science.gov (United States)

2010-04-01

...)(3) and 270.17e-1(d)(2), the payment of a commission, fee, or other remuneration to a broker shall be...) of the Act if: (1) The commission, fee, or other remuneration is paid in connection with the sale of... directors, the company's investment adviser performs the duties of the board of directors. [71 FR 36655...

Effectors of Th1 and Th17 cells act on astrocytes and augment their neuroinflammatory properties.

Science.gov (United States)

Prajeeth, Chittappen K; Kronisch, Julius; Khorooshi, Reza; Knier, Benjamin; Toft-Hansen, Henrik; Gudi, Viktoria; Floess, Stefan; Huehn, Jochen; Owens, Trevor; Korn, Thomas; Stangel, Martin

2017-10-16

Autoreactive Th1 and Th17 cells are believed to mediate the pathology of multiple sclerosis in the central nervous system (CNS). Their interaction with microglia and astrocytes in the CNS is crucial for the regulation of the neuroinflammation. Previously, we have shown that only Th1 but not Th17 effectors activate microglia. However, it is not clear which cells are targets of Th17 effectors in the CNS. To understand the effects driven by Th17 cells in the CNS, we induced experimental autoimmune encephalomyelitis in wild-type mice and CD4 + T cell-specific integrin α4-deficient mice where trafficking of Th1 cells into the CNS was affected. We compared microglial and astrocyte response in the brain and spinal cord of these mice. We further treated astrocytes with supernatants from highly pure Th1 and Th17 cultures and assessed the messenger RNA expression of neurotrophic factors, cytokines and chemokines, using real-time PCR. Data obtained was analyzed using the Kruskal-Wallis test. We observed in α4-deficient mice weak microglial activation but comparable astrogliosis to that of wild-type mice in the regions of the brain populated with Th17 infiltrates, suggesting that Th17 cells target astrocytes and not microglia. In vitro, in response to supernatants from Th1 and Th17 cultures, astrocytes showed altered expression of neurotrophic factors, pro-inflammatory cytokines and chemokines. Furthermore, increased expression of chemokines in Th1- and Th17-treated astrocytes enhanced recruitment of microglia and transendothelial migration of Th17 cells in vitro. Our results demonstrate the delicate interaction between T cell subsets and glial cells and how they communicate to mediate their effects. Effectors of Th1 act on both microglia and astrocytes whereas Th17 effectors preferentially target astrocytes to promote neuroinflammation.

Vapor pressures and thermophysical properties of selected hexenols and recommended vapor pressure for hexan-1-ol

Czech Academy of Sciences Publication Activity Database

Štejfa, V.; Fulem, Michal; Růžička, K.; Matějka, P.

2015-01-01

Roč. 402, Sep (2015), 18-29 ISSN 0378-3812 Institutional support: RVO:68378271 Keywords : alcohols * vapor pressure * heat capacity * ideal - gas thermodynamic properties * vaporization enthalpy Subject RIV: BJ - Thermodynamics Impact factor: 1.846, year: 2015

Osmotic and activity coefficients of {l_brace}y Na{sub 2}SO{sub 4} + (1 - y) ZnSO{sub 4}{r_brace}(aq) at T = 298.15 K

Energy Technology Data Exchange (ETDEWEB)

Marjanovic, V. [High Technical School, Trg Svetog Save 34, 31 000 Uzice (Serbia and Montenegro); Ninkovic, R. [Faculty of Technology and Metallurgy, University of Belgrade, Karnegijeva 4, 11 000 Belgrade (Serbia and Montenegro); Miladinovic, J. [Faculty of Technology and Metallurgy, University of Belgrade, Karnegijeva 4, 11 000 Belgrade (Serbia and Montenegro)]. E-mail: duma@elab.tmf.bg.ac.yu; Todorovic, M. [Faculty of Technology and Metallurgy, University of Belgrade, Karnegijeva 4, 11 000 Belgrade (Serbia and Montenegro); Pavicevic, V. [Faculty of Technology and Metallurgy, University of Belgrade, Karnegijeva 4, 11 000 Belgrade (Serbia and Montenegro)

2005-02-01

The osmotic coefficients of the mixed electrolyte solution {l_brace}y Na{sub 2}SO{sub 4} + (1 - y) ZnSO{sub 4}{r_brace}(aq) have been measured by the isopiestic method, at T = 298.5 K. The experimental results were treated by Scatchard's, Pitzer-Kim's and Clegg-Pitzer-Brimblecombe's methods for mixed-electrolyte solutions. By these methods, the activity coefficients for Na{sub 2}SO{sub 4} and ZnSO{sub 4} were calculated and compared. The Scatchard interaction parameters are used for calculation of the excess Gibbs free energy as a function of ionic strength and ionic-strength fraction of Na{sub 2}SO{sub 4}. Also, the Zdanovskii's rule of linearity is tested.

AZD5363 inhibits inflammatory synergy between interleukin-17 and insulin/insulin-like growth factor 1

Directory of Open Access Journals (Sweden)

Chong eChen

2014-12-01

Full Text Available In the United States, one third of population is affected by obesity and almost 29 million people are suffering from type 2 diabetes. Obese people have elevated serum levels of insulin, insulin-like growth factor 1 (IGF1 and interleukin-17 (IL-17. Insulin and IGF1 are known to enhance IL-17-induced expression of inflammatory cytokines and chemokines, which may contribute to the chronic inflammatory status observed in obese people. We have previously demonstrated that insulin/IGF1 signaling pathway crosstalks with IL-17-activated nuclear factor-kappa B (NF-κB pathway through inhibiting glycogen synthase kinase 3β (GSK3β activity. However, it is unclear whether GSK3α also plays a role and whether this crosstalk can be manipulated by AZD5363, a novel pan-Akt inhibitor that has been shown to increase GSK3 activity through reducing phosphorylation of GSK3α and GSK3β. In this study, we investigated IL-17-induced expression of C-X-C motif ligand 1 (Cxcl1, C-C motif ligand 20 (Ccl20 and interleukin-6 (Il-6 in wild-type, GSK3α-/-, and GSK3β-/- mouse embryonic fibroblast (MEF cells as well as in mouse prostate tissues by real-time quantitative PCR. We examined the proteins involved in the signaling pathways by Western blot analysis. We found that insulin and IGF1 enhanced IL-17- induced expression of Cxcl1, Ccl20 and Il-6, which was associated with increased phosphorylation of GSK3α and GSK3β in the presence of insulin and IGF1. AZD5363 inhibited the synergy between IL-17 and insulin/IGF1 through reducing phosphorylation of GSK3α and GSK3β by inhibiting Akt function. These findings imply that the cooperative crosstalk of IL-17 and insulin/IGF1 in initiating inflammatory responses may be alleviated by AZD5363.

17 CFR 240.11a-1 - Regulation of floor trading.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Regulation of floor trading... Securities Exchange Act of 1934 Adoption of Floor Trading Regulation (rule 11a-1) § 240.11a-1 Regulation of floor trading. (a) No member of a national securities exchange, while on the floor of such exchange...

Dicty_cDB: Contig-U13443-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available lignments: (bits) Value N ( AF305060 ) Dictyostelium discoideum Wiscott-Aldrich syndrome... 529 0.0 10 ( BJ3... AF305060 ) Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene...icant alignments: (bits) Value AF305060_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott...0_1( AF305060 |pid:none) Dictyostelium discoideum Wiscott-Aldrich syndrome protein (wasA) gene, complete cds

Translocation 1;7 in dyshematopoiesis: possibly induced with a nonrandom geographic distribution

International Nuclear Information System (INIS)

Scheres, J.M.; Hustinx, T.W.; Holdrinet, R.S.; Geraedts, J.P.; Hagemeijer, A.; van der Blij-Philipsen, M.

1984-01-01

Eight patients with various hematologic disorders had an identical chromosomal aberration in their bone marrow or unstimulated peripheral blood, a translocation t(1;7) interpreted as t(1;7)(p11;p11). The translocation chromosome replaced one normal chromosome number7; therefore, the karyotype of the abnormal cells was trisomic for 1q and monosomic for 7q. Including four cases from the literature, a total of 12 patients (4 women, 8 men) with this translocation are known at the moment. The translocation does not seem to be associated with a specific disorder, but almost all patients had a preleukemic syndrome during some stage of their disease. It is very remarkable that 11 of the 12 patients lived in the Netherlands, and 7 patients had a history of iatrogenic exposure to alkylating agents or irradiation; one patient was a radiation worker and another one had a history of toxic exposure to chloramphenicol. It is suggested, therefore, that the t(1;7) is a possibly induced chromosomal aberration with a clearly nonrandom geographic distribution

Stabilization of Angiotensin-(1-7) by key substitution with a cyclic non-natural amino acid.

Science.gov (United States)

Wester, Anita; Devocelle, Marc; Tallant, E Ann; Chappell, Mark C; Gallagher, Patricia E; Paradisi, Francesca

2017-10-01

Angiotensin-(1-7) [Ang-(1-7)], a heptapeptide hormone of the renin-angiotensin-aldosterone system, is a promising candidate as a treatment for cancer that reflects its anti-proliferative and anti-angiogenic properties. However, the peptide's therapeutic potential is limited by the short half-life and low bioavailability resulting from rapid enzymatic metabolism by peptidases including angiotensin-converting enzyme (ACE) and dipeptidyl peptidase 3 (DPP 3). We report the facile assembly of three novel Ang-(1-7) analogues by solid-phase peptide synthesis which incorporates the cyclic non-natural δ-amino acid ACCA. The analogues containing the ACCA substitution at the site of ACE cleavage exhibit complete resistance to human ACE, while substitution at the DDP 3 cleavage site provided stability against DPP 3 hydrolysis. Furthermore, the analogues retain the anti-proliferative properties of Ang-(1-7) against the 4T1 and HT-1080 cancer cell lines. These results suggest that ACCA-substituted Ang-(1-7) analogues which show resistance against proteolytic degradation by peptidases known to hydrolyze the native heptapeptide may be novel therapeutics in the treatment of cancer.

Raman Spectroscopy evidence of 1:1:1 complex formation during dissolution of WO3 : K2SO4 in a melt of K2S2O7

DEFF Research Database (Denmark)

Berg, Rolf W.; Maijó Ferré, Irene

2005-01-01

The dissolution reaction of solid WO3 into a melt consisting of a 1:1 molar mixture of K2S2O7 and K2SO4 was studied by Raman spectroscopy. It was found that a new compound was formed, dimeric K8[(WO2)2(m-SO4)2(SO4)4]. The assigned Raman spectrum is given. Extended abstract of Poster presented...

Th17 Cells in Type 1 Diabetes: Role in the Pathogenesis and Regulation by Gut Microbiome

Directory of Open Access Journals (Sweden)

Yangyang Li

2015-01-01

Full Text Available Type 1 diabetes (T1D is an autoimmune disease which is characterized by progressive destruction of insulin producing pancreatic islet β cells. The risk of developing T1D is determined by both genetic and environmental factors. A growing body of evidence supports an important role of T helper type 17 (Th17 cells along with impaired T regulatory (Treg cells in the development of T1D in animal models and humans. Alteration of gut microbiota has been implicated to be responsible for the imbalance between Th17 and Treg cells. However, there is controversy concerning a pathogenic versus protective role of Th17 cells in murine models of diabetes in the context of influence of gut microbiota. In this review we will summarize current knowledge about Th17 cells and gut microbiota involved in T1D and propose Th17 targeted therapy in children with islet autoimmunity to prevent progression to overt diabetes.

Crystal structures of NiSO4·9H2O and NiSO4·8H2O: magnetic properties, stability with respect to morenosite (NiSO4·7H2O), the solid-solution series (Mg x Ni1-x )SO4·9H2O

Science.gov (United States)

Fortes, A. D.; Knight, K. S.; Gibbs, A. S.; Wood, I. G.

2018-02-01

Since being discovered initially in mixed-cation systems, a method of forming end-member NiSO4·9H2O and NiSO4·8H2O has been found. We have obtained powder diffraction data from protonated analogues (with X-rays) and deuterated analogues (using neutrons) of these compounds over a range of temperatures, allowing us to determine their crystal structures—including all H-atoms—and to characterise the transitions on warming from 220 to 278 K; glass → 9-hydrate → 8-hydrate + ice → 7-hydrate + ice → partial melt (7-hydrate + liquid). NiSO4·8D2O is triclinic, space-group P\\bar {1} , Z = 2, with unit cell parameters at 150 K, a = 6.12463(8) Å, b = 6.8401(1) Å, c = 12.5339(2) Å, α = 92.846(1)°, β = 97.822(1)°, γ = 96.627(1)° and V = 515.58(1) Å3. The structure consists of two symmetry-inequivalent Ni(D2O)6 octahedra on sites of \\bar {1} symmetry. These are directly joined by a water-water H-bond to form chains of octahedra parallel with the c-axis at x = 0. Two interstitial water molecules serve both to bridge the Ni(D2O)6 octahedral chains in the b-c plane and also to connect with the SO4 2- tetrahedral oxyanion. These tetrahedra are linked by the two interstitial water molecules in a reticular motif to form sheets perpendicular to c. NiSO4·9D2O is monoclinic, space-group P21/c, Z = 4, with unit-cell parameters at 150 K, a = 6.69739(6) Å, b = 11.8628(1) Å, c = 14.5667(1) Å, β = 94.9739(8)° and V = 1152.96(1) Å3. The structure is isotypic with the Mg analogue described elsewhere (Fortes et al., Acta Cryst B 73:47‒64, 2017b). It shares the motif of H-bonded octahedral chains with NiSO4·8D2O, although in the enneahydrate these run parallel with the b-axis at x = 0. Three interstitial water molecules bridge the Ni(D2O)6 octahedra to the SO4 2- tetrahedral oxyanion. The tetrahedra sit at x ≈ 0.5 and are linked by two of the three interstitial water molecules in a pentagonal motif to form ribbons parallel with b. A solid-solution series

Investigation of CT picture in so-called loose shoulder

International Nuclear Information System (INIS)

Kuroda, Shigehito; Sakamaki, Hiroshi; Matsuoka, Akira; Moriishi, Takeji; Takada, Keiichi.

1985-01-01

CT picture of the shoulder joint was analyzed in 124 shoulders (114 patients). A line perpendicular to a given line between the precornu of acetabular tegmen (A) and the postcornu of acetabular tegmen (B) was drawn and the intersection where the line and the caput humeri meet (C) was obtained. The angle of CAB was defined as the backward angular aperture of the acetabular tegmen. The angular aperture was 26.2 0 +-1.9 in 16 so-called loose shoulders, 17.3 0 +-1.0 in 28 loose shoulders restricted to the inward rotation, and 12.2 0 +-0.4 in 80 normal shoulders, showing a distinct correlation between the angular aperture and the degree of loose shoulder. An increased backward angular aperture of the acetabular tegmen was considered greatly attributable to the forward glenohumeral movement resulting from malformation of the acetabular tegmen and flaccidity of the joint. Glenoid osteotomy was thus performed in 9 patients, 6 of whom underwent CT scanning before and after osteotomy. Coronal and transverse CT images of the shoulder joint disclosed a noticeable improvement of the glenohumeral alignment. The angular aperture shown on CT seems to be of major importance not only in the diagnosis of so-called loose shoulder but also in surgical choice. (Namekawa, K.)

Band gaps from the Tran-Blaha modified Becke-Johnson approach: A systematic investigation

Science.gov (United States)

Jiang, Hong

2013-04-01

The semi-local Becke-Johnson (BJ) exchange-correlation potential and its modified form proposed by Tran and Blaha (TB-mBJ) have attracted a lot of interest recently because of the surprisingly accurate band gaps they can deliver for many semiconductors and insulators. In this work, we have investigated the performance of the TB-mBJ potential for the description of electronic band structures in a comprehensive set of semiconductors and insulators. We point out that a perturbative use of the TB-mBJ potential can give overall better results. By investigating a set of IIB-VI and III-V semiconductors, we point out that although the TB-mBJ approach can describe the band gap of these materials quite well, the binding energies of semi-core d-states in these materials deviate strongly from experiment. The difficulty of the TB-mBJ potential to describe the localized states is likely the cause for the fact that the electronic band structures of Cu2O and La2O3 are still poorly described. Based on these observations, we propose to combine the TB-mBJ approach with the Hubbard U correction for localized d/f states, which is able to provide overall good descriptions for both the band gaps and semi-core states binding energies. We further apply the approach to calculate the band gaps of a set of Ti(IV)-oxides, many of which have complicated structures so that the more advanced methods like GW are expensive to treat directly. An overall good agreement with experiment is obtained, which is remarkable considering its little computational efforts compared to GW.

Reference Correlations for Thermophysical Properties of Liquid Water at 0.1 MPa

Czech Academy of Sciences Publication Activity Database

Pátek, Jaroslav; Hrubý, Jan; Klomfar, Jaroslav; Součková, Monika; Harvey, A.H.

2009-01-01

Roč. 38, č. 1 (2009), s. 21-29 ISSN 0047-2689 R&D Projects: GA AV ČR IAA200760701 Institutional research plan: CEZ:AV0Z20760514 Keywords : water * thermophysical properties * transport properties * calibration Subject RIV: BJ - Thermodynamics Impact factor: 2.093, year: 2009

Biglycan, a novel trigger of Th1 and Th17 cell recruitment into the kidney.

Science.gov (United States)

Nastase, Madalina-Viviana; Zeng-Brouwers, Jinyang; Beckmann, Janet; Tredup, Claudia; Christen, Urs; Radeke, Heinfried H; Wygrecka, Malgorzata; Schaefer, Liliana

2017-12-15

Th1 and Th17 cells, T helper (Th) subtypes, are key inducers of renal fibrosis. The molecular mechanisms of their recruitment into the kidney, however, are not well understood. Here, we show that biglycan, a proteoglycan of the extracellular matrix, acting in its soluble form as a danger signal, stimulates autonomously the production of Th1 and Th17 chemoattractants CXCL10 and CCL20 in macrophages. In the presence of IFNγ, biglycan synergistically stimulates CXCL9. In macrophages deficient for TLR2, TLR4, and their adaptor molecules MyD88 or TRIF, we identified highly selective mechanisms of biglycan-dependent Th1/17 chemoattraction. Thus, the expression of CXCL9 and CXCL10, common chemoattractants for CXCR3-positive Th1 and Th17 cells, is triggered in a biglycan-TLR4/TRIF-dependent manner. By contrast, biglycan induces CCL20 chemokine production, responsible for CCR6-positive Th17 cell recruitment, in a TLR2/4/MyD88-dependent manner. Importantly, at the onset of diabetes mellitus and lupus nephritis we provide evidence for biglycan-dependent recruitment of Th1 and Th17 cells, IFNγ and IL-17 production, and development of albuminuria in mice lacking or overexpressing soluble biglycan. Furthermore, by genetic ablation of Cxcl10 we showed in vivo involvement of this chemokine in biglycan-dependent recruitment of Th1 and Th17 cells into the kidney. Finally, a positive correlation of biglycan and CXCL10/CXCL9 levels was detected in plasma from patients with diabetic nephropathy and lupus nephritis. Taken together, we identified biglycan as a novel trigger of Th1 and Th17 cell recruitment into the kidney and we postulate that interfering with biglycan/TLR/TRIF/MyD88-signaling might provide novel therapeutic avenues for renal fibrosis. Copyright © 2017 International Society of Matrix Biology. Published by Elsevier B.V. All rights reserved.

A 'variable' stellar object in a variable blue nebula V-V 1-7

International Nuclear Information System (INIS)

Rao, N.K.; Gilra, D.P.

1981-01-01

V-V 1-7 is supposed to be one of the few planetary nebulae with Ao central stars and was included in the planetary-nebula catalogue as PK 235 + 1 0 1. The nebula was seen on the blue Palomar Observatory Sky Survey (POSS) print but not on the red print; as a result it was thought that it might be a reflection nebula. However, the symmetry of the nebula around the central star (HD 62001), and also the ultraviolet photometric variability of this central star led others to suggest that the nebula might be a nova shell. Subsequently it was found that the nebula V-V 1-7 has disappeared. It is not seen on any direct plate known to us except the POSS blue plate. In this paper the disappearance is reported (along with the nebula) of a stellar object, which appears within the 'nebular shell' of V-V 1-7 on the POSS blue plate, but not on the red plate. (author)

Identification of intracellular proteins and signaling pathways in human endothelial cells regulated by angiotensin-(1-7).

Science.gov (United States)

Meinert, Christian; Gembardt, Florian; Böhme, Ilka; Tetzner, Anja; Wieland, Thomas; Greenberg, Barry; Walther, Thomas

2016-01-01

The study aimed to identify proteins regulated by the cardiovascular protective peptide angiotensin-(1-7) and to determine potential intracellular signaling cascades. Human endothelial cells were stimulated with Ang-(1-7) for 1 h, 3 h, 6 h, and 9 h. Peptide effects on intracellular signaling were assessed via antibody microarray, containing antibodies against 725 proteins. Bioinformatics software was used to identify affected intracellular signaling pathways. Microarray data was verified exemplarily by Western blot, Real-Time RT-PCR, and immunohistochemical studies. The microarray identified 110 regulated proteins after 1 h, 119 after 3 h, 31 after 6 h, and 86 after 9 h Ang-(1-7) stimulation. Regulated proteins were associated with high significance to several metabolic pathways like “Molecular Mechanism of Cancer” and “p53 signaling” in a time dependent manner. Exemplarily, Western blots for the E3-type small ubiquitin-like modifier ligase PIAS2 confirmed the microarray data and displayed a decrease by more than 50% after Ang-(1-7) stimulation at 1 h and 3 h without affecting its mRNA. Immunohistochemical studies with PIAS2 in human endothelial cells showed a decrease in cytoplasmic PIAS2 after Ang-(1-7) treatment. The Ang-(1-7) mediated decrease of PIAS2 was reproduced in other endothelial cell types. The results suggest that angiotensin-(1-7) plays a role in metabolic pathways related to cell death and cell survival in human endothelial cells.

Th1-, Th2-, and Th17-associated cytokine expression in hypopharyngeal carcinoma and clinical significance.

Science.gov (United States)

Chen, Xuemei; Wang, Junfu; Wang, Rui; Su, Qinghong; Luan, Junwen; Huang, Haiyan; Zhou, Peng; Liu, Jinsheng; Xu, Xiaoqun

2016-02-01

Th0 cells differentiate into Th1 or Th2 depending on multiple transcription factors acting on specific time points to regulate gene expression. Th17 cells, a subset of IL-17-producing T cells distinct from Th1 or Th2 cells, have been described as key players in inflammation and autoimmune diseases as well as cancer development. In the present study, 53 patients with hypopharyngeal cancer were included. The expression levels of Th1-, Th2- and Th17-associated cytokines in hypopharyngeal cancer tissues and pericarcinoma tissues were detected. The relationship between Th1, Th2, or Th17 infiltration and metastasis was studied. Our results showed that the mRNA and protein expressions of Th1 cytokines were lower, while the expressions of Th2 and Th17 cytokines were higher in tumor tissues, and the intensity of expression was strengthened with clinical stage increasing. Cancer tissues had higher level expressions of Th2 and Th17 cytokines than that of pericarcinoma tissues. From the above data, we speculated that high expressions of Th2- and Th17-associated cytokines in hypopharyngeal carcinoma may contribute to cancer development and metastasis.

Letters to the Editor

Science.gov (United States)

1999-09-01

All the Letters to the Editor in this issue are in the same PostScript or PDF file. Contents The imaginary Sun? Harold Aspden Energy Science Ltd, PO Box 35, Southampton SO16 7RB, UK Difficult physics? Tim Akrill Chief Examiner, A-level Physics, Edexcel Foundation Was it a dream? Bill Jarvis 6 Peggy's Mill Road, Edinburgh EH4 6JY

The Who's who of Nobel Prize winners, 1901-2000

National Research Council Canada - National Science Library

Sherby, Louise S; Odelberg, Wilhelm

2002-01-01

... steamer from New York to Southampton, went by train to Harwich, from there to Esbjerg in Denmark, and so to Sweden. An English gentleman who boarded the boat at Harwich happened to be given a seat at the same dining table as Michelson. During the voyage a somewhat heated discussion ensued between the two of them. The English gentleman spoke dispar...

The ACE-2/Ang1-7/Mas cascade enhances bone structure and metabolism following angiotensin-II type 1 receptor blockade.

Science.gov (United States)

Abuohashish, Hatem M; Ahmed, Mohammed M; Sabry, Dina; Khattab, Mahmoud M; Al-Rejaie, Salim S

2017-07-15

The renin angiotensin system (RAS) regulates numerous systemic functions and is expressed locally in skeletal tissues. Angiotensin1-7 (Ang1-7) is a beneficial member of the RAS, and the therapeutic effects of a large number of angiotensin receptors blockers (ARBs) are mediated by an Ang1-7-dependent cascade. This study examines whether the reported osteo-preservative effects of losartan are mediated through the angiotensin converting enzyme2 (ACE-2)/Ang1-7/Mas pathway in ovariectomized (OVX) rats. Sham and OVX animals received losartan (10mg/kg/d p.o.) for 6 weeks. A specific Mas receptor blocker (A-779) was delivered via mini-osmotic pumps during the losartan treatment period. Serum and urine bone metabolism biomarker levels were measured. Bone trabecular and cortical morphometry were quantified in distal femurs, whereas mineral contents were estimated in ashed bones, serum and urine. Finally, the expression of RAS components, the receptor activator of NF-κB ligand (RANKL) and osteoprotegerin (OPG) was determined. Losartan significantly improved the elevated bone metabolism marker levels and altered trabecular and cortical structures in OVX animals, and restored normal urinary and skeletal mineral levels. Mas receptor inhibition significantly abolished all osteo-protective effects of losartan and enhanced the deleterious effects of OVX. Losartan enhanced OVX-induced up-regulation of ACE-1, AngII, angiotensin type 1 (AT 1 ) receptor and RANKL expression, and increased ACE-2, Ang1-7, Mas and OPG expression in OVX animals. However, A-779 significantly eradicated the effects of losartan on RAS components and RANKL/OPG expression. Thus, Ang1-7 are involved in the osteo-preservative effects of losartan via Mas receptor, which may add therapeutic value to this well-known antihypertensive agent. Copyright © 2017 Elsevier B.V. All rights reserved.

Pharmacological characterisation of the highly NaV1.7 selective spider venom peptide Pn3a.

Science.gov (United States)

Deuis, Jennifer R; Dekan, Zoltan; Wingerd, Joshua S; Smith, Jennifer J; Munasinghe, Nehan R; Bhola, Rebecca F; Imlach, Wendy L; Herzig, Volker; Armstrong, David A; Rosengren, K Johan; Bosmans, Frank; Waxman, Stephen G; Dib-Hajj, Sulayman D; Escoubas, Pierre; Minett, Michael S; Christie, Macdonald J; King, Glenn F; Alewood, Paul F; Lewis, Richard J; Wood, John N; Vetter, Irina

2017-01-20

Human genetic studies have implicated the voltage-gated sodium channel Na V 1.7 as a therapeutic target for the treatment of pain. A novel peptide, μ-theraphotoxin-Pn3a, isolated from venom of the tarantula Pamphobeteus nigricolor, potently inhibits Na V 1.7 (IC 50 0.9 nM) with at least 40-1000-fold selectivity over all other Na V subtypes. Despite on-target activity in small-diameter dorsal root ganglia, spinal slices, and in a mouse model of pain induced by Na V 1.7 activation, Pn3a alone displayed no analgesic activity in formalin-, carrageenan- or FCA-induced pain in rodents when administered systemically. A broad lack of analgesic activity was also found for the selective Na V 1.7 inhibitors PF-04856264 and phlotoxin 1. However, when administered with subtherapeutic doses of opioids or the enkephalinase inhibitor thiorphan, these subtype-selective Na V 1.7 inhibitors produced profound analgesia. Our results suggest that in these inflammatory models, acute administration of peripherally restricted Na V 1.7 inhibitors can only produce analgesia when administered in combination with an opioid.

Hierarchy of exactly solvable spin-1/2 chains with so (N)_I critical points

NARCIS (Netherlands)

Lahtinen, V.; Mansson, T.; Ardonne, E.

2014-01-01

We construct a hierarchy of exactly solvable spin-1/2 chains with so(N)1 critical points. Our construction is based on the framework of condensate-induced transitions between topological phases. We employ this framework to construct a Hamiltonian term that couples N transverse field Ising chains

38 CFR 1.17 - Evaluation of studies relating to health effects of radiation exposure.

Science.gov (United States)

2010-07-01

... relating to health effects of radiation exposure. 1.17 Section 1.17 Pensions, Bonuses, and Veterans' Relief... health effects of radiation exposure. (a) From time to time, the Secretary shall publish evaluations of scientific or medical studies relating to the adverse health effects of exposure to ionizing radiation in the...

17 CFR 240.13b2-1 - Falsification of accounting records.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Falsification of accounting records. 240.13b2-1 Section 240.13b2-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... Required Reports § 240.13b2-1 Falsification of accounting records. No person shall directly or indirectly...

17 CFR 270.3a-1 - Certain prima facie investment companies.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Certain prima facie investment companies. 270.3a-1 Section 270.3a-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3a-1 Certain prima facie investment...

Natural abundant (17) O NMR in a 1.5-T Halbach magnet.

Science.gov (United States)

Sørensen, Morten K; Bakharev, Oleg N; Jensen, Ole; Nielsen, Niels Chr

2016-06-01

We present mobile, low-field (17) O NMR as a means for monitoring oxygen in liquids. Whereas oxygen is one of the most important elements, oxygen NMR is limited by a poor sensitivity related to low natural abundance and gyro-magnetic ratio of the NMR active (17) O isotope. Here, we demonstrate (17) O NMR detection at a Larmor frequency of 8.74 MHz in a 1.5-T Halbach neodymium magnet with a home-built digital NMR instrument suitable for large-scale production and in-line monitoring applications. The proposed (17) O NMR sensor may be applied for direct, noninvasive measurements of water content in, for example, oil, manure, or food in automated quality or process control. Copyright © 2015 John Wiley & Sons, Ltd. Copyright © 2015 John Wiley & Sons, Ltd.

Building a multigenic model of breast cancer susceptibility: CYP17 and HSD17B1 are two important candidates.

Science.gov (United States)

Feigelson, H S; McKean-Cowdin, R; Coetzee, G A; Stram, D O; Kolonel, L N; Henderson, B E

2001-01-15

We conducted a nested case-control study to evaluate whether polymorphisms in two genes involved in estrogen metabolism, CYP17 and HSD17B1, were useful in developing a breast cancer risk model that could help discriminate women who are at higher risk of breast cancer. If polymorphisms in these genes affect the level of circulating estrogens, they may directly influence breast cancer risk. The base population for this study is a multiethnic cohort study that includes African-American, Non-Latina White, Japanese, Latina, and Native Hawaiian women. For this analysis, 1508 randomly selected controls and 850 incident breast cancer cases of the first four ethnic groups who agreed to provide a blood specimen were included (76 and 80% response rates, respectively). The CYP17 A2 allele and the HSD17B1 A allele were considered "high-risk" alleles. Subjects were then classified according to number of high-risk alleles. After adjusting for age, weight, and ethnicity, we found that carrying one or more high-risk alleles increases the risk of advanced breast cancer in a dose-response fashion. The risk among women carrying four high-risk alleles was 2.21 [95% confidence interval (CI), 0.98-5.00; P for trend = 0.03] compared with those who carried none. This risk was largely limited to women who were not taking hormone replacement therapy (relative risk, 2.60; 95% CI, 0.95-7.14) and was most pronounced among those weighing 170 pounds or less (RR, 3.05; 95% CI, 1.29-7.25). These findings suggest that breast cancer risk has a strong genetic component and supports the theory that the underlying mechanism of "complex traits" can be understood using a multigenic model of candidate genes.

Comparison of the Isothermal Oxidation Behavior of As-Cast Cu-17%Cr and Cu-17%Cr-5%Al. Part 1; Oxidation Kinetics

Science.gov (United States)

Raj. Sai V.

2008-01-01

The isothermal oxidation kinetics of as-cast Cu-17%Cr and Cu-17%Cr-5%Al in air were studied between 773 and 1173 K under atmospheric pressure. These observations reveal that Cu- 17%Cr-5%Al oxidizes at significantly slower rates than Cu-17%Cr. The rate constants for the alloys were determined from generalized analyses of the data without an a priori assumption of the nature of the oxidation kinetics. Detailed analyses of the isothermal thermogravimetric weight change data revealed that Cu-17%Cr exhibited parabolic oxidation kinetics with an activation energy of 165.9 9.5 kJ mol-1. In contrast, the oxidation kinetics for the Cu-17%Cr- 5%Al alloy exhibited a parabolic oxidation kinetics during the initial stages followed by a quartic relationship in the later stages of oxidation. Alternatively, the oxidation behavior of Cu-17%CR- 5%Al could be better represented by a logarithmic relationship. The parabolic rate constants and activation energy data for the two alloys are compared with literature data to gain insights on the nature of the oxidation mechanisms dominant in these alloys.

Carbon: Nitrogen Interaction Regulates Expression of Genes Involved in N-Uptake and Assimilation in Brassica juncea L.

Science.gov (United States)

Goel, Parul; Bhuria, Monika; Kaushal, Mamta

2016-01-01

In plants, several cellular and metabolic pathways interact with each other to regulate processes that are vital for their growth and development. Carbon (C) and Nitrogen (N) are two main nutrients for plants and coordination of C and N pathways is an important factor for maintaining plant growth and development. In the present work, influence of nitrogen and sucrose (C source) on growth parameters and expression of genes involved in nitrogen transport and assimilatory pathways was studied in B. juncea seedlings. For this, B. juncea seedlings were treated with four combinations of C and N source viz., N source alone (-Suc+N), C source alone (+Suc-N), with N and C source (+Suc+N) or without N and C source (-Suc-N). Cotyledon size and shoot length were found to be increased in seedlings, when nitrogen alone was present in the medium. Distinct expression pattern of genes in both, root and shoot tissues was observed in response to exogenously supplied N and C. The presence or depletion of nitrogen alone in the medium leads to severe up- or down-regulation of key genes involved in N-uptake and transport (BjNRT1.1, BjNRT1.8) in root tissue and genes involved in nitrate reduction (BjNR1 and BjNR2) in shoot tissue. Moreover, expression of several genes, like BjAMT1.2, BjAMT2 and BjPK in root and two genes BjAMT2 and BjGS1.1 in shoot were found to be regulated only when C source was present in the medium. Majority of genes were found to respond in root and shoot tissues, when both C and N source were present in the medium, thus reflecting their importance as a signal in regulating expression of genes involved in N-uptake and assimilation. The present work provides insight into the regulation of genes of N-uptake and assimilatory pathway in B. juncea by interaction of both carbon and nitrogen. PMID:27637072

Carbon: Nitrogen Interaction Regulates Expression of Genes Involved in N-Uptake and Assimilation in Brassica juncea L.

Directory of Open Access Journals (Sweden)

Parul Goel

Full Text Available In plants, several cellular and metabolic pathways interact with each other to regulate processes that are vital for their growth and development. Carbon (C and Nitrogen (N are two main nutrients for plants and coordination of C and N pathways is an important factor for maintaining plant growth and development. In the present work, influence of nitrogen and sucrose (C source on growth parameters and expression of genes involved in nitrogen transport and assimilatory pathways was studied in B. juncea seedlings. For this, B. juncea seedlings were treated with four combinations of C and N source viz., N source alone (-Suc+N, C source alone (+Suc-N, with N and C source (+Suc+N or without N and C source (-Suc-N. Cotyledon size and shoot length were found to be increased in seedlings, when nitrogen alone was present in the medium. Distinct expression pattern of genes in both, root and shoot tissues was observed in response to exogenously supplied N and C. The presence or depletion of nitrogen alone in the medium leads to severe up- or down-regulation of key genes involved in N-uptake and transport (BjNRT1.1, BjNRT1.8 in root tissue and genes involved in nitrate reduction (BjNR1 and BjNR2 in shoot tissue. Moreover, expression of several genes, like BjAMT1.2, BjAMT2 and BjPK in root and two genes BjAMT2 and BjGS1.1 in shoot were found to be regulated only when C source was present in the medium. Majority of genes were found to respond in root and shoot tissues, when both C and N source were present in the medium, thus reflecting their importance as a signal in regulating expression of genes involved in N-uptake and assimilation. The present work provides insight into the regulation of genes of N-uptake and assimilatory pathway in B. juncea by interaction of both carbon and nitrogen.

48 CFR 17.401 - General.

Science.gov (United States)

2010-10-01

... CONTRACT TYPES SPECIAL CONTRACTING METHODS Leader Company Contracting 17.401 General. Leader company... system is designated under this acquisition technique to be the leader company, and to furnish assistance and know-how under an approved contract to one or more designated follower companies, so they can...

O-17 NMR measurement of water

International Nuclear Information System (INIS)

Fukazawa, Nobuyuki

1990-01-01

Recently, attention has been paid to the various treatment of water and the utilization of water by magnetic treatment, electric field treatment and so on. It has been said that by these treatments, the change in the properties of water arises. The state of this treated water cannot be explained by the properties of water from conventional physical and chemical standpoints. In addition, the method of measurement of whether the change arose or not is not yet determined. It is necessary to establish the method of measurement for the basic state of water. In this study, O-17 NMR which observes the state of water directly at molecular or atomic level was investigated as the method of measuring water. The measurement of O-17 NMR was carried out with a JNR 90Q FT NMR of Fourier transformation type of JEOL Ltd. The experimental method and the results are reported. The result of measurement of the O-17 NMR spectrum for distilled ion exchange water is shown. It is know that it has very wide line width as compared with the NMR spectra of protons and C-13. The relative sensitivity of O-17 observation is about 1/100,000 of that of protons. As to the information on the state of water obtained by O-17 NMR, there are chemical shift and line width. As temperature rose, the line width showed decrease, which seemed to be related to the decrease of hydrogen combination. (K.I.)

Road Materials and Pavement Design Volume 17(1)

CSIR Research Space (South Africa)

De Beer, Morris

2016-03-01

Full Text Available Materials and Pavement Design Volume 17, 2016 - Issue 1 Editorial Board Page ebi | Published online: 03 Oct 2016  http://dx.doi.org/10.1080/14680629.2016.1244475 Editors-in-Chief Hervé DI BENEDETTO - University of Lyon/ENTPE, Vaulx-en-Velin, France... Andrew Charles COLLOP - De Montfort University, Leicester, UK William G. BUTTLAR - University of Missouri, Urbana-Champaign, USA Editor-in-Chief at Large Jorge B. Sousa - Consulpav, Oeiras, Portugal Associate Editors Morris de Beer - CSIR Built...

The genetics of dementias. Part 1: Molecular basis of frontotemporal dementia and parkinsonism linked to chromosome 17 (FTDP-17

Directory of Open Access Journals (Sweden)

Anna Kowalska

2009-06-01

Full Text Available Frontotemporal dementia (FTD, characterized by neurodegeneration mainly in the frontal and temporal lobes, accounts for ca. 10–15�0of all dementias. In 1892 the Czech-German neuropsychiatrist Arnold Pick reported the first case of FTD in a 71-year-old patient suffering from progressive dementia, memory disturbances, and aphasia associated with frontal and temporal lobe atrophy and the presence of neuronal inclusions. Later the inclusions were named Pick bodies. The neuropathological hallmark of FTD is very differentiated. In contrast to Alzheimer’s disease (AD, there are neither senile plaques nor neurofibrillary tangles in the brains of FTD patients. Frontotemporal dementias are tauopathies, a group of disorders caused by aberrant metabolism of tau protein, a family of proteins associated with microtubules (MAPT: macrotubule-associated tau protein. In the nervous system the protein stabilizes microtubules in neuronal axons and is thus responsible for crucial processes in neuron metabolism, such as signal transduction, plasticity, and intracellular transport. In the human brain, six isoforms are produced from the MAPT gene (chromosome 17 q21.2 by alternative mRNA splicing. The isoforms differ in the number of amino acids in the protein chain, the presence of three (3R tau type or four (4R tau type domains responsible for binding to microtubules, and one or two inserts containing from 29 to 58 amino acids. The isoforms are modified posttranslationally by hyperphosphorylation, glycation, or oxidation, which can change the protein’s properties and disturb its normal function. Altered metabolism of tau protein changes its interactions with tubulin, leading to destabilization of the microtubule structure and initiating the generation of toxic tau aggregates. The first mutations in the MAPT gene responsible for frontotemporal dementia and parkinsonism linked to chromosome 17 (FTDP-17 were found in 1998. So far over 40 mutations in the MAPT

Angiotensin-(1-7 Promotes Resolution of Neutrophilic Inflammation in a Model of Antigen-Induced Arthritis in Mice

Directory of Open Access Journals (Sweden)

Lívia C. Barroso

2017-11-01

Full Text Available Defective resolution of inflammation may be crucial for the initiation and development of chronic inflammatory diseases, such as arthritis. Therefore, it has been suggested that therapeutic strategies based on molecules that facilitate inflammation resolution present great potential for the treatment of chronic inflammatory diseases. In this study, we investigated the effects and role of angiotensin-(1-7 [Ang-(1-7] in driving resolution of neutrophilic inflammation in a model of arthritis. For this purpose, male C57BL/6 mice were subjected to antigen-induced arthritis and treated with Ang-(1-7 at the peak of the inflammatory process. Analysis of the number of inflammatory cells, apoptosis, and immunofluorescence for NF-κB was performed in the exudate collected from the knee cavity. Neutrophil accumulation in periarticular tissue was measured by assaying myeloperoxidase activity. Apoptosis of human neutrophil after treatment with Ang-(1-7 was evaluated morphologically and by flow cytometry, and NF-κB phosphorylation by immunofluorescence. Efferocytosis was evaluated in vivo. Therapeutic treatment with Ang-(1-7 at the peak of inflammation promoted resolution, an effect associated with caspase-dependent neutrophils apoptosis and NF-κB inhibition. Importantly, Ang-(1-7 was also able to induce apoptosis of human neutrophils, an effect associated with NF-κB inhibition. The pro-resolving effects of Ang-(1-7 were inhibited by the Mas receptor antagonist A779. Finally, we showed that Ang-(1-7 increased the efferocytic ability of murine macrophages. Our results clearly demonstrate that Ang-(1-7 resolves neutrophilic inflammation in vivo acting in two key step of resolution: apoptosis of neutrophils and their removal by efferocytosis. Ang-(1-7 is a novel mediator of resolution of inflammation.

The ARID1B phenotype: what we have learned so far.

Science.gov (United States)

Santen, Gijs W E; Clayton-Smith, Jill

2014-09-01

Evidence is now accumulating from a number of sequencing studies that ARID1B not only appears to be one of the most frequently mutated intellectual disability (ID) genes, but that the range of phenotypes caused by ARID1B mutations seems to be extremely wide. Thus, it is one of the most interesting ID genes identified so far in the exome sequencing era. In this article, we review the literature surrounding ARID1B and attempt to delineate the ARID1B phenotype. The vast majority of published ARID1B patients have been ascertained through studies of Coffin-Siris syndrome (CSS), which leads to bias when documenting the frequencies of phenotypic features. Additional observations of those individuals ascertained through exome sequencing studies helps in delineation of the broader clinical phenotype. We are currently establishing an ARID1B consortium, aimed at collecting ARID1B patients identified through genome-wide sequencing strategies. We hope that this endeavor will eventually lead to a more comprehensive view of the ARID1B phenotype. © 2014 Wiley Periodicals, Inc.

Theoretical Prediction of the Heats of Formation, Densities, and Relative Sensitivities for 1,7-dinitro-3,4,5,8-tetra N-oxide-bis([1,2,3]triazolo)[4,5-b:5’,4’ e]pyrazine, 1,7-dinitro-3,5,8-tri N-oxide bis([1,2,3]triazolo)[4,5-b:5’,4’ e]pyrazine, 1,7-dinitro 3,5-bis N-oxide bis([1,2,3]triazolo)[4,5-b:5’,4’ e]pyrazine, 1,7-dinitro 1,7-dihydrobis([1,2,3]triazolo)[4,5-b:4’,5’-e]pyrazine

Science.gov (United States)

2016-09-01

estimation of the impact sensitivities has been calculated. This report outlines the procedures used to generate this information, as well as Cheetah...1 US ARMY ARDEC (PDF) A DISTASIO 1 US ARMY ARDEC (PDF) S NICOLICH 1 NAVAL SURF WARFARE (PDF) CNTR J MANNION 17 DIR USARL

Structure and magnetic properties of Gd2Co17-xCr x (1.17 ≤ x ≤ 3.0) compounds

International Nuclear Information System (INIS)

Fuquan, B.; Tegus, O.; Dagula, W.; Brueck, E.; Klaasse, J.C.P.; Buschow, K.H.J.

2007-01-01

The structure and magnetic properties of Gd 2 Co 17-x Cr x (1.17 ≤ x ≤ 3.0) compounds have been investigated by means of X-ray diffraction (XRD) and magnetization measurements. The powder X-ray diffraction patterns show that all samples crystallize as a single phase with the rhombohedral Th 2 Zn 17 -type structure. The lattice parameters a and the unit cell volume V increases slightly with increasing Cr content, but the c parameter varies in a less simple way with increasing Cr content. The X-ray diffraction patterns of the magnetically aligned samples show that all compounds investigated have uniaxial anisotropy. Spin reorientation phenomena occur in all of the compounds. The Curie temperature T C , the spin reorientation temperature T sr , the spontaneous magnetization M 0 and the saturation magnetization M s decrease with the increasing Cr content. The anisotropy constant K 1 and the anisotropy field B a of the compounds at room temperature reach a maximum for x = 1.76. The M 0 and M s increase with increasing temperature from 5 K to 300 K. The easy-axis anisotropy of all compounds changes to easy-plane anisotropy at low temperatures and the spin reorientation phenomena are more pronounced for low Cr concentration

Clinical applications of corneal confocal microscopy

Directory of Open Access Journals (Sweden)

Mitra Tavakoli

2008-06-01

Full Text Available Mitra Tavakoli1, Parwez Hossain2, Rayaz A Malik11Division of Cardiovascular Medicine, University of Manchester and Manchester Royal Infirmary, Manchester, UK; 2University of Southampton, Southampton Eye Unit, Southampton General Hospital, Southampton, UKAbstract: Corneal confocal microscopy is a novel clinical technique for the study of corneal cellular structure. It provides images which are comparable to in-vitro histochemical techniques delineating corneal epithelium, Bowman’s layer, stroma, Descemet’s membrane and the corneal endothelium. Because, corneal confocal microscopy is a non invasive technique for in vivo imaging of the living cornea it has huge clinical potential to investigate numerous corneal diseases. Thus far it has been used in the detection and management of pathologic and infectious conditions, corneal dystrophies and ecstasies, monitoring contact lens induced corneal changes and for pre and post surgical evaluation (PRK, LASIK and LASEK, flap evaluations and Radial Keratotomy, and penetrating keratoplasty. Most recently it has been used as a surrogate for peripheral nerve damage in a variety of peripheral neuropathies and may have potential in acting as a surrogate marker for endothelial abnormalities.Keywords: corneal confocal microscopy, cornea, infective keratitis, corneal dystrophy, neuropathy

Developing geometrical reasoning in the secondary school: outcomes of trialling teaching activities in classrooms, a report to the QCA

OpenAIRE

Brown, Margaret; Jones, Keith; Taylor, Ron

2003-01-01

This report presents the findings of the Southampton/Hampshire Group of mathematicians and mathematics educators sponsored by the Qualifications and Curriculum Authority (QCA) to develop and trial some teaching/learning materials for use in schools that focus on the development of geometrical reasoning at the secondary school level. The project ran from October 2002 to November 2003. An interim report was presented to the QCA in March 2003. 1. The Southampton/Hampshire Group consisted of five...

Species used for drug testing reveal different inhibition susceptibility for 17beta-hydroxysteroid dehydrogenase type 1.

Directory of Open Access Journals (Sweden)

Gabriele Möller

Full Text Available Steroid-related cancers can be treated by inhibitors of steroid metabolism. In searching for new inhibitors of human 17beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD 1 for the treatment of breast cancer or endometriosis, novel substances based on 15-substituted estrone were validated. We checked the specificity for different 17beta-HSD types and species. Compounds were tested for specificity in vitro not only towards recombinant human 17beta-HSD types 1, 2, 4, 5 and 7 but also against 17beta-HSD 1 of several other species including marmoset, pig, mouse, and rat. The latter are used in the processes of pharmacophore screening. We present the quantification of inhibitor preferences between human and animal models. Profound differences in the susceptibility to inhibition of steroid conversion among all 17beta-HSDs analyzed were observed. Especially, the rodent 17beta-HSDs 1 were significantly less sensitive to inhibition compared to the human ortholog, while the most similar inhibition pattern to the human 17beta-HSD 1 was obtained with the marmoset enzyme. Molecular docking experiments predicted estrone as the most potent inhibitor. The best performing compound in enzymatic assays was also highly ranked by docking scoring for the human enzyme. However, species-specific prediction of inhibitor performance by molecular docking was not possible. We show that experiments with good candidate compounds would out-select them in the rodent model during preclinical optimization steps. Potentially active human-relevant drugs, therefore, would no longer be further developed. Activity and efficacy screens in heterologous species systems must be evaluated with caution.

The complex of PAMAM-OH dendrimer with Angiotensin (1-7) prevented the disuse-induced skeletal muscle atrophy in mice.

Science.gov (United States)

Márquez-Miranda, Valeria; Abrigo, Johanna; Rivera, Juan Carlos; Araya-Durán, Ingrid; Aravena, Javier; Simon, Felipe; Pacheco, Nicolás; González-Nilo, Fernando Danilo; Cabello-Verrugio, Claudio

2017-01-01

Angiotensin (1-7) (Ang-(1-7)) is a bioactive heptapeptide with a short half-life and has beneficial effects in several tissues - among them, skeletal muscle - by preventing muscle atrophy. Dendrimers are promising vehicles for the protection and transport of numerous bioactive molecules. This work explored the use of a neutral, non-cytotoxic hydroxyl-terminated poly(amidoamine) (PAMAM-OH) dendrimer as an Ang-(1-7) carrier. Bioinformatics analysis showed that the Ang-(1-7)-binding capacity of the dendrimer presented a 2:1 molar ratio. Molecular dynamics simulation analysis revealed the capacity of neutral PAMAM-OH to protect Ang-(1-7) and form stable complexes. The peptide coverage ability of the dendrimer was between ~50% and 65%. Furthermore, an electrophoretic mobility shift assay demonstrated that neutral PAMAM-OH effectively bonded peptides. Experimental results showed that the Ang-(1-7)/PAMAM-OH complex, but not Ang-(1-7) alone, had an anti-atrophic effect when administered intraperitoneally, as evaluated by muscle strength, fiber diameter, myofibrillar protein levels, and atrogin-1 and MuRF-1 expressions. The results of the Ang-(1-7)/PAMAM-OH complex being intraperitoneally injected were similar to the results obtained when Ang-(1-7) was systemically administered through mini-osmotic pumps. Together, the results suggest that Ang-(1-7) can be protected for PAMAM-OH when this complex is intraperitoneally injected. Therefore, the Ang-(1-7)/PAMAM-OH complex is an efficient delivery method for Ang-(1-7), since it improves the anti-atrophic activity of this peptide in skeletal muscle.

The quasi-biennial oscillation of 1.7 years in ground level enhancement events

Science.gov (United States)

Velasco Herrera, V. M.; Pérez-Peraza, J.; Soon, W.; Márquez-Adame, J. C.

2018-04-01

The so-called Ground Level Enhancement events are sporadic relativistic solar particles measured at ground level by a network of cosmic ray detectors worldwide. These sporadic events are typically assumed to occur by random chance. However, we find that by studying the last 56 ground level enhancement events reported from 1966 through 2014, these events occur preferentially in the positive phase of the quasi-biennial oscillation of 1.7 year periodicity. These discrete ground level enhancement events show that there is another type of solar emission (i.e., wavelike packets) that occurs only in a specific phase of a very particular oscillation. We interpret this empirical result to support that ground level enhancement events are not a result of purely stochastic processes. We used the Morlet wavelet to analyze the phase of each of the periodicities found by the wavelet analyses and local variations of power spectral density in these sporadic events. We found quasi-regular periodicities of 10.4, 6.55, 4.12, 2.9, 1.73, 0.86, 0.61, 0.4 and 0.24 years in ground level enhancements. Although some of these quasi-biennial oscillation periodicities (i.e., oscillations operating between 0.6 and 4 years) may be interpreted as simply harmonics and overtones of the fundamental solar cycle from the underlying sun-spot magnetism phenomenon. The sources of these periodicities are still unclear. Also there is no clear mechanism for the variability of the quasi-biennial oscillation periodicities itself. The quasi-biennial oscillation periodicities are broadly considered to be a variation of solar activity, associated with the solar dynamo process. Also, the intensity of these periodicities is more important around the years of maximum solar activity because the quasi-biennial oscillation periodicities are modulated by the solar cycle where the Sun is more energetically enhanced during activity maxima. To identify the relationships among ground level enhancement, solar, and cosmic

Bystanders not so innocent after all.

Science.gov (United States)

Batten, Marcel; Ghilardi, Nico

2012-06-29

Interleukin 27 (IL-27) regulates immune responses, including T helper 17 (Th17) cell activity. In this issue of Immunity, Hirahara et al. (2012) demonstrate that IL-27 suppresses Th17 cells in trans through induction of the inhibitory ligand PD-L1 on bystander T cells. Copyright © 2012 Elsevier Inc. All rights reserved.

Adverse cardiac effects of exogenous angiotensin 1-7 in rats with subtotal nephrectomy are prevented by ACE inhibition.

Directory of Open Access Journals (Sweden)

Louise M Burrell

Full Text Available We previously reported that exogenous angiotensin (Ang 1-7 has adverse cardiac effects in experimental kidney failure due to its action to increase cardiac angiotensin converting enzyme (ACE activity. This study investigated if the addition of an ACE inhibitor (ACEi to Ang 1-7 infusion would unmask any beneficial effects of Ang 1-7 on the heart in experimental kidney failure. Male Sprague-Dawley rats underwent subtotal nephrectomy (STNx and were treated with vehicle, the ACEi ramipril (oral 1mg/kg/day, Ang 1-7 (subcutaneous 24 μg/kg/h or dual therapy (all groups, n = 12. A control group (n = 10 of sham-operated rats were also studied. STNx led to hypertension, renal impairment, cardiac hypertrophy and fibrosis, and increased both left ventricular ACE2 activity and ACE binding. STNx was not associated with changes in plasma levels of ACE, ACE2 or angiotensin peptides. Ramipril reduced blood pressure, improved cardiac hypertrophy and fibrosis and inhibited cardiac ACE. Ang 1-7 infusion increased blood pressure, cardiac interstitial fibrosis and cardiac ACE binding compared to untreated STNx rats. Although in STNx rats, the addition of ACEi to Ang 1-7 prevented any deleterious cardiac effects of Ang 1-7, a limitation of the study is that the large increase in plasma Ang 1-7 with ramipril may have masked any effect of infused Ang 1-7.

The conversion of SO{sub 2} to SO{sub 3} in gas turbine engines

Energy Technology Data Exchange (ETDEWEB)

Miake-Lye, R C; Anderson, M R; Brown, R C; Kolb, C E [Aerodyne Research, Inc., Billerica, MA (United States). Center for Chemical and Environmental Physics; Sorokin, A A; Buriko, Y I [Scientific Research Center ` Ecolen` , Moscow (Russian Federation)

1998-12-31

The oxidation of fuel sulfur to S(6) (SO{sub 3}+H{sub 2}SO{sub 4}) in a supersonic (Concorde) and a subsonic (ATTAS) aircraft engine is estimated numerically. The results indicate between 2% and 10% of the fuel sulfur is emitted as S(6). It is also shown that conversion in the turbine is limited by the level of atomic oxygen at the combustor exit, resulting in a higher oxidation efficiency as the sulfur mass loading is decreased. SO{sub 2} and SO{sub 3} are the primary sulfur oxidation products, with less than 1% of fuel sulfur converted to H{sub 2}SO{sub 4}. For the Concorde, H{sub 2}SO{sub 4} was primarily formed during the supersonic expansion through the divergent nozzle. (author) 20 refs.

The conversion of SO{sub 2} to SO{sub 3} in gas turbine engines

Energy Technology Data Exchange (ETDEWEB)

Miake-Lye, R.C.; Anderson, M.R.; Brown, R.C.; Kolb, C.E. [Aerodyne Research, Inc., Billerica, MA (United States). Center for Chemical and Environmental Physics; Sorokin, A.A.; Buriko, Y.I. [Scientific Research Center `Ecolen`, Moscow (Russian Federation)

1997-12-31

The oxidation of fuel sulfur to S(6) (SO{sub 3}+H{sub 2}SO{sub 4}) in a supersonic (Concorde) and a subsonic (ATTAS) aircraft engine is estimated numerically. The results indicate between 2% and 10% of the fuel sulfur is emitted as S(6). It is also shown that conversion in the turbine is limited by the level of atomic oxygen at the combustor exit, resulting in a higher oxidation efficiency as the sulfur mass loading is decreased. SO{sub 2} and SO{sub 3} are the primary sulfur oxidation products, with less than 1% of fuel sulfur converted to H{sub 2}SO{sub 4}. For the Concorde, H{sub 2}SO{sub 4} was primarily formed during the supersonic expansion through the divergent nozzle. (author) 20 refs.

Surface Tension and p−ρ−T Data for 1,1,1,3,3-Pentafluorobutane (HFC-365mfc) and 1,1,1,2,2,3,3-Heptafluoro-3-methoxy-propane (HFE-347mcc)

Czech Academy of Sciences Publication Activity Database

Klomfar, Jaroslav; Součková, Monika; Pátek, Jaroslav

2013-01-01

Roč. 58, č. 8 (2013), s. 2316-2325 ISSN 0021-9568 R&D Projects: GA ČR GA101/09/0010 Institutional support: RVO:61388998 Keywords : surface tension * density * HFC-365mfc * HFE-347mcc Subject RIV: BJ - Thermodynamics Impact factor: 2.045, year: 2013

17 CFR 270.3c-1 - Definition of beneficial ownership for certain 3(c)(1) funds.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Definition of beneficial... AND EXCHANGE COMMISSION (CONTINUED) RULES AND REGULATIONS, INVESTMENT COMPANY ACT OF 1940 § 270.3c-1 Definition of beneficial ownership for certain 3(c)(1) funds. (a) As used in this section: (1) The term...

Self-reported quality of life and health among Björk-Shiley convexo-concave prosthetic heart valve patients.

Science.gov (United States)

Signorello, L B; Kennedy, J A; Richmond, R A; Sieu, K L; Blot, W J; Harrison, D C

2001-03-01

The risk of fracture of Björk-Shiley convexo-concave (BSCC) prosthetic heart valves has resulted in consideration of prophylactic explantation and replacement for patients with high-risk valves. Little information exists on perceived quality of life, health status, and serious morbidity among BSCC patients, including those who have undergone explantation. Self-administered questionnaires were completed by a cohort of 585 BSCC patients who participated in an X-ray imaging study to detect precursors to valve fracture up to seven years (average 3.9 years) previously. Responses from 31 explant patients were contrasted with those from 554 BSCC patients in whom explant surgery was not attempted. Perceived quality of life and health status and risk of hospitalization after participating in the imaging study varied considerably among patients, but on average tended not to differ significantly between those with and without explants. A slightly greater proportion of explantees tended to report both improved health status and high rates of heart attack and pacemaker implantation. The health status of these patients was, in general, considerably worse than previously reported among valve implant patients. Over half the cohort were hospitalized during follow up, and half were unable to walk up more than one flight of stairs without shortness of breath. The less than optimal health status of most BSCC patients and relatively high rates of morbidity should be taken into account when considering potential explantation of the valves.

Flipped SO(10)

Energy Technology Data Exchange (ETDEWEB)

Tamvakis, K.

1988-01-28

We construct an N=1 supersymmetric SO(10) GUT broken down to SU(3)c x SU(2)/sub L/ x U(1)/sub ..gamma../ with an intermediate flipped SU(5) x U(1)/sub chi/ gauge symmetry. A solution to the triplet-doublet mass-splitting problem is proposed in terms of a non-minimal missing-partner mechanism.

The renal urate transporter SLC17A1 locus: confirmation of association with gout.

Science.gov (United States)

Hollis-Moffatt, Jade E; Phipps-Green, Amanda J; Chapman, Brett; Jones, Gregory T; van Rij, Andre; Gow, Peter J; Harrison, Andrew A; Highton, John; Jones, Peter B; Montgomery, Grant W; Stamp, Lisa K; Dalbeth, Nicola; Merriman, Tony R

2012-04-27

Two major gout-causing genes have been identified, the urate transport genes SLC2A9 and ABCG2. Variation within the SLC17A1 locus, which encodes sodium-dependent phosphate transporter 1, a renal transporter of uric acid, has also been associated with serum urate concentration. However, evidence for association with gout is equivocal. We investigated the association of the SLC17A1 locus with gout in New Zealand sample sets. Five variants (rs1165196, rs1183201, rs9358890, rs3799344, rs12664474) were genotyped across a New Zealand sample set totaling 971 cases and 1,742 controls. Cases were ascertained according to American Rheumatism Association criteria. Two population groups were studied: Caucasian and Polynesian. At rs1183201 (SLC17A1), evidence for association with gout was observed in both the Caucasian (odds ratio (OR) = 0.67, P = 3.0 × 10-6) and Polynesian (OR = 0.74, P = 3.0 × 10-3) groups. Meta-analysis confirmed association of rs1183201 with gout at a genome-wide level of significance (OR = 0.70, P = 3.0 × 10-8). Haplotype analysis suggested the presence of a common protective haplotype. We confirm the SLC17A1 locus as the third associated with gout at a genome-wide level of significance.

Unique edge-sharing sulfate-transition metal coordination in Na2M(SO4)2 (M=Ni and Co)

International Nuclear Information System (INIS)

Fry, Allyson M.; Sweeney, Owen T.; Adam Phelan, W.; Drichko, Natalia; Siegler, Maxime A.; McQueen, Tyrel M.

2015-01-01

Two compounds, Na 2 Ni(SO 4 ) 2 and Na 2 Co(SO 4 ) 2 , were synthesized and their structure and properties were characterized. They adopt a structure that contains a bidentate coordination of sulfate to the transition metal center, which was determined via single crystal X-ray diffraction combined with model refinements to both laboratory X-ray and time-of-flight neutron powder diffraction data. The compounds were both found to crystallize in the C2/c space group with Z=24 and a unit cell of a=23.3461(3) Å, b=10.3004(1) Å, c=17.4115(2) Å, β=98.8659(9)°, and V=4136.99(8) Å 3 for the cobalt analog and a=23.2253(1) Å, b=10.26155(6) Å, c=17.3353(1) Å, β=99.0376(5)°, and V=4080.20(5) Å 3 for the nickel analog. Magnetization measurements show that the transition metal centers have negligible interactions with neighboring sites. Infrared and Raman spectroscopies were used to further probe the unique sulfate-transition metal coordination, and confirm the bidentate binding motif. The resulting pseudo-trigonal bipyramidal coordination produces vivid violet, Na 2 Co(SO 4 ) 2 , and yellow, Na 2 Ni(SO 4 ) 2 , colors that were probed by diffuse reflectance. - Graphical abstract: Two blue distorted transition metal octahedra (oxygen in red) bridged by two sulfate tetrahedra are shown here. Each bridging sulfate tetrahedra shares an edge with one octahedron and a corner with the other. All of the remaining corners of the octahedra are corner sharing with four tetrahedra forming a polyhedral network. - Highlights: • Structure of Na2Ni(SO4)2 and Na2Co(SO4)2 is determined. • Unique sulfate-transition metal binding observed in the new structure. • Combined diffraction and spectroscopic techniques were used. • Magnetization measurements show negligible interactions between sites

Volcanic SO2 and SiF4 visualization using 2-D thermal emission spectroscopy – Part 1: Slant-columns and their ratios

Directory of Open Access Journals (Sweden)

M. Grutter

2012-02-01

Full Text Available The composition and emission rates of volcanic gas plumes provide insight of the geologic internal activity, atmospheric chemistry, aerosol formation and radiative processes around it. Observations are necessary for public security and the aviation industry. Ground-based thermal emission infrared spectroscopy, which uses the radiation of the volcanic gas itself, allows for continuously monitoring during day and night from a safe distance. We present measurements on Popocatépetl volcano based on thermal emission spectroscopy during different campaigns between 2006–2009 using a Scanning Infrared Gas Imaging System (SIGIS. The experimental set-up, measurement geometries and analytical algorithms are described. The equipment was operated from a safe distance of 12 km from the volcano at two different spectral resolutions: 0.5 and 4 cm−1. The 2-dimensional scanning capability of the instrument allows for an on-line visualization of the volcanic SO2 plume and its animation. SiF4 was also identified in the infrared spectra recorded at both resolutions. The SiF4/SO2 molecular ratio can be calculated from each image and used as a highly useful parameter to follow changes in volcanic activity. A small Vulcanian eruption was monitored during the night of 16 to 17 November 2008 and strong ash emission together with a pronounced SO2 cloud was registered around 01:00 a.m. LST (Local Standard Time. Enhanced SiF4/SO2 ratios were observed before and after the eruption. A validation of the results from thermal emission measurements with those from absorption spectra of the moon taken at the same time, as well as an error analysis, are presented. The inferred propagation speed from sequential images is used in a subsequent paper (Part 2 to calculate the emission rates at different distances from the crater.

Reliability and Validity of the Beijing Version of the Montreal Cognitive Assessment in the Evaluation of Cognitive Function of Adult Patients with OSAHS.

Directory of Open Access Journals (Sweden)

Xiong Chen

Full Text Available The patients with obstructive sleep apnea hypopnea syndrome (OSAHS tend to develop cognitive deficits, which usually go unrecognized, and can affect their daily life. The Beijing version of the Montreal cognitive assessment (MoCA-BJ, a Chinese version of MoCA, has been used for the assessment of cognitive functions of OSAHS patients in clinical practice. So far, its reliability and validity have not been tested. This study examined the reliability and validity of MoCA-BJ in a cohort of adult OSAHS patients.152 OSAHS patients, ranging from mild, moderate to severe, 49 primary snoring subjects and 40 normal controls were evaluated for cognitive functions by employing both MoCA-BJ and the Mini Mental State Examination (MMSE. Forty of them were re-tested by MoCA-BJ 14 days after the first test. Internal consistency, test-retest reliability, discriminate and concurrent validity of MoCA-BJ were analyzed.Internal consistency reliability by Cronbach's alpha was adequate (0.73. Intra-class correlation coefficient (ICC, an measure of test-retest reliability, was 0.87 (P<0.001. The total MoCA-BJ scores were significant higher in normal controls than in OSAHS groups (p<0.05. The performances of visuospatial ability in severe OSAHS group were significantly weaker than in normal controls and primary snoring group. The performances of executive ability in severe OSAHS patients were weaker than in normal controls. An optimal cut-off between normal controls and non-normal subjects was at 26 points (total MoCA score. Moreover, cut-off between non-severe and severe OSAHS was at 2 points on visuospatial subscale. Analysis of the correlation between MoCA total scores and MMSE total scores revealed a statistically significant, though relatively weak, correlation (r=0.41, P<0.05.In conclusion, our study showed that the Beijing version of the MoCA was reliable and stable. The MoCA-BJ was capable of detecting cognitive dysfunction by visuospatial and total MoCA-BJ score.

Effect of influent COD/SO4(2-) ratios on biodegradation behaviors of starch wastewater in an upflow anaerobic sludge blanket (UASB) reactor.

Science.gov (United States)

Lu, Xueqin; Zhen, Guangyin; Ni, Jialing; Hojo, Toshimasa; Kubota, Kengo; Li, Yu-You

2016-08-01

A lab-scale upflow anaerobic sludge blanket (UASB) has been run for 250days to investigate the influence of influent COD/SO4(2-) ratios on the biodegradation behavior of starch wastewater and process performance. Stepwise decreasing COD/SO4(2-) ratio enhanced sulfidogenesis, complicating starch degradation routes and improving process stability. The reactor exhibited satisfactory performance at a wide COD/SO4(2-) range ⩾2, attaining stable biogas production of 1.15-1.17LL(-1)d(-1) with efficient simultaneous removal of total COD (73.5-80.3%) and sulfate (82.6±6.4%). Adding sulfate favored sulfidogenesis process and diversified microbial community, invoking hydrolysis-acidification of starch and propionate degradation and subsequent acetoclastic methanogenesis; whereas excessively enhanced sulfidogenesis (COD/SO4(2-) ratios UASB technology in water industry from basic science. Copyright © 2016 Elsevier Ltd. All rights reserved.

Reverse plasticity: TGF-β and IL-6 induce Th1-to-Th17-cell transdifferentiation in the gut.

Science.gov (United States)

Geginat, Jens; Paroni, Moira; Kastirr, Ilko; Larghi, Paola; Pagani, Massimiliano; Abrignani, Sergio

2016-10-01

Th17 cells are a heterogeneous population of pro-inflammatory T cells that have been shown to mediate immune responses against intestinal bacteria. Th17 cells are highly plastic and can transdifferentiate to Th1/17 cells or unconventional Th1 cells, which are highly pathogenic in animal models of immune-mediated diseases such as inflammatory bowel diseases. A recent European Journal of Immunology article by Liu et al. (Eur. J. Immunol. 2015. 45:1010-1018) showed, surprisingly, that Th1 cells have a similar plasticity, and could transdifferentiate to Th17 cells. Thus, IFN-γ-producing Th1 effector cells specific for an intestinal microbial antigen were shown to acquire IL-17-producing capacities in the gut in a mouse model of colitis, and in response to TGF-β and IL-6 in vitro. TGF-β induced Runx1, and together with IL-6 was shown to render the ROR-γt and IL-17 promoters in Th1 cells accessible for Runx1 binding. In this commentary, we discuss how this unexpected plasticity of Th1 cells challenges our view on the generation of Th1/17 cells with the capacity to co-produce IL-17 and IFN-γ, and consider possible implications of this Th1-to-Th17-cell conversion for therapies of inflammatory bowel diseases and protective immune responses against intracellular pathogens. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Growth suppression of colorectal cancer by plant-derived multiple mAb CO17-1A × BR55 via inhibition of ERK1/2 phosphorylation.

Science.gov (United States)

Kwak, Dong Hoon; Moussavou, Ghislain; Lee, Ju Hyoung; Heo, Sung Youn; Ko, Kisung; Hwang, Kyung-A; Jekal, Seung-Joo; Choo, Young-Kug

2014-11-14

We have generated the transgenic Tabaco plants expressing multiple monoclonal antibody (mAb) CO7-1A × BR55 by cross-pollinating with mAb CO17-1A and mAb BR55. We have demonstrated the anti-cancer effect of plant-derived multiple mAb CO17-1A × BR55. We find that co-treatment of colorectal mAbs (anti-epithelial cellular adhesion molecule (EpCAM), plant-derived monoclonal antibody (mAb(P)) CO17-1A and mAb(P) CO17-1A × BR55) with RAW264.7 cells significantly inhibited the cell growth in SW620 cancer cells. In particular, multi mAb(P) CO17-1A × BR55 significantly and efficiently suppressed the growth of SW620 cancer cells compared to another mAbs. Apoptotic death-positive cells were significantly increased in the mAb(P) CO17-1A × BR55-treated. The mAb(P) CO17-1A × BR55 treatment significantly decreased the expression of B-Cell lymphoma-2 (BCl-2), but the expression of Bcl-2-associated X protein (Bax), and cleaved caspase-3 were markedly increased. In vivo, the mAb(P) CO17-1A × BR55 significantly and efficiently inhibited the growth of colon tumors compared to another mAbs. The apoptotic cell death and inhibition of pro-apoptotic proteins expression were highest by treatment with mAb(P) CO17-1A × BR55. In addition, the mAb(P) CO17-1A × BR55 significantly inhibited the extracellular signal-regulated kinase 1 and 2 (ERK1/2) phosphorylation in cancer cells and tumors. Therefore, this study results suggest that multiple mAb(P) CO17-1A × BR55 has a significant effect on apoptosis-mediated anticancer by suppression of ERK1/2 phosphorylation in colon cancer compared to another mAbs. In light of these results, further clinical investigation should be conducted on mAb(P) CO17-1A × BR55 to determine its possible chemopreventive and/or therapeutic efficacy against human colon cancer.

Inhibition of Th1 and Th17 Cells by Medicinal Plants and Their Derivatives: A Systematic Review.

Science.gov (United States)

Asadi-Samani, Majid; Bagheri, Nader; Rafieian-Kopaei, Mahmoud; Shirzad, Hedayatollah

2017-08-01

Searching for new natural drugs that are capable of targeting Th1 and Th17 may lead to development of more effective treatments for inflammatory and autoimmune diseases. Most of the natural drugs can be derived from plants that are used in traditional medicine and folk medicine. The aim of this systematic review is to identify and introduce plants or plant derivatives that are effective on inflammatory diseases by inhibiting Th1 and Th17 responses. To achieve this purpose, the search terms herb, herbal medicine, herbal drug, medicinal plant, phytochemical, traditional Chinese medicine, Ayurvedic medicine, natural compound, inflammation, inflammatory diseases, Th1, Th17, T helper 1 or T helper 17 were used separately in Title/Keywords/Abstract in Web of Science and PubMed databases. In articles investigating the effect of the medicinal plants and their derivatives in inhibiting Th1 and Th17 cells, the effects of eight extracts of the medicinal plants, 21 plant-based compounds and some of their derivatives, and eight drugs derived from the medicinal plants' compounds in inhibiting Th1 and Th17 cells were reviewed. The results showed that medicinal plants and their derivates are able to suppress Th17 and Th1 T cell functions as well as cytokine secretion and differentiation. The results can be used to produce herbal drugs that suppress Th, especially Th17, responses. Copyright © 2017 John Wiley & Sons, Ltd. Copyright © 2017 John Wiley & Sons, Ltd.

Discovery of nonsteroidal 17beta-hydroxysteroid dehydrogenase 1 inhibitors by pharmacophore-based screening of virtual compound libraries.

Science.gov (United States)

Schuster, Daniela; Nashev, Lyubomir G; Kirchmair, Johannes; Laggner, Christian; Wolber, Gerhard; Langer, Thierry; Odermatt, Alex

2008-07-24

17Beta-hydroxysteroid dehydrogenase type 1 (17beta-HSD1) plays a pivotal role in the local synthesis of the most potent estrogen estradiol. Its expression is a prognostic marker for the outcome of patients with breast cancer and inhibition of 17beta-HSD1 is currently under consideration for breast cancer prevention and treatment. We aimed to identify nonsteroidal 17beta-HSD1 inhibitor scaffolds by virtual screening with pharmacophore models built from crystal structures containing steroidal compounds. The most promising model was validated by comparing predicted and experimentally determined inhibitory activities of several flavonoids. Subsequently, a virtual library of nonsteroidal compounds was screened against the 3D pharmacophore. Analysis of 14 selected compounds yielded four that inhibited the activity of human 17beta-HSD1 (IC 50 below 50 microM). Specificity assessment of identified 17beta-HSD1 inhibitors emphasized the importance of including related short-chain dehydrogenase/reductase (SDR) members to analyze off-target effects. Compound 29 displayed at least 10-fold selectivity over the related SDR enzymes tested.

17 CFR 240.12d2-1 - Suspension of trading.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Suspension of trading. 240... Securities Exchange Act of 1934 Suspension of Trading, Withdrawal, and Striking from Listing and Registration § 240.12d2-1 Suspension of trading. (a) A national securities exchange may suspend from trading a...

Comparisons of Prostate Cancer Inhibitors Abiraterone and TOK-001 Binding with CYP17A1 through Molecular Dynamics.

Science.gov (United States)

Xiao, Fei; Yang, Maohua; Xu, Youjun; Vongsangnak, Wanwipa

2015-01-01

Cytochrome P450 17A1 (CYP17A1) is associated in the steroid hormone biosynthesis in human. As cell proliferation of prostate cancer in response to androgen steroid, an inhibition of CYP17A1 becomes an alternative approach to inhibit biosynthesis of androgen and support treatment of prostate cancer. However, biology-driven inhibitor development of prostate cancer is poorly elucidated. The aims of this study are to address structural differences at atomic-level between CYP17A1 and inhibitors i.e., abiraterone and TOK-001, and further investigate the effect of point mutation of CYP17A1 on the active site stability and the local interactions that are hydrophobic interaction and hydrogen bonding throughout molecular dynamics (MD) simulation. After performing multiple comparisons among four different complexes across CYP17A1 and inhibitors, interestingly TOK-001 oriented toward the active pocket and formed larger volume with I-helix of CYP17A1 than abiraterone, whereas abiraterone showed tighter binding and more active site stability. Considering on the effect of hydrophobic interaction and hydrogen bonding between abiraterone and CYP17A1, the key residues of Phe114, Ile371, Val482, and Asn202 were identified. This contributes into tight binding interactions; however abiraterone is effectively weakened along with the global conformation mobility increased in A105L mutation. Surprisingly, overall conformation of the CYP17A1 remained stable when bound to TOK-001. This basic knowledge can guide future experiments on design of efficient inhibitors for CYP17A1, which provides theoretical basis of androgen-dependent disease therapy.

Green's functions through so(2,1) lie algebra in nonrelativistic quantum mechanics

International Nuclear Information System (INIS)

Boschi-Filho, H.; Vaidya, A.N.

1991-01-01

The authors discuss an algebraic technique to construct the Green's function for systems described by the noncompact so(2,1) Lie algebra. They show that this technique solves the one-dimensional linear oscillator and Coulomb potentials and also generates particular solutions for other one-dimensional potentials. Then they construct explicitly the Green's function for the three-dimensional oscillator and the three-dimensional Coulomb potential, which are generalizations of the one-dimensional cases, and the Coulomb plus an Aharanov-Bohm, potential. They discuss the dynamical algebra involved in each case and also find their wave functions and bound state spectra. Finally they introduce in each case and also find their wave functions and bound state spectra. Finally they introduce a point canonical transformation in the generators of so(2,10) Lie algebra, show that this procedure permits us to solve the one-dimensional Morse potential in addition to the previous cases, and construct its Green's function and find its energy spectrum and wave functions

Low doses of Paclitaxel repress breast cancer invasion through DJ-1/KLF17 signalling pathway.

Science.gov (United States)

Ismail, Ismail Ahmed; El-Sokkary, Gamal H; Saber, Saber H

2018-04-27

Paclitaxel (taxol) is an important agent against many tumours, including breast cancer. Ample data documents that paclitaxel inhibits breast cancer metastasis while others prove that paclitaxel enhances breast cancer metastasis. The mechanisms by which paclitaxel exerts its action are not well established. This study focuses on the effect of paclitaxel, particularly the low doses on breast cancer metastasis and the mechanisms that regulate it. Current results show that, paclitaxel exerts significant cytotoxicity even at low doses in both MCF-7 and MDA-MB-231 cells. Interestingly, paclitaxel significantly inhibits cell invasion and migration, decreases Snail and increases E-cadherin mRNA expression levels at the indicated low doses. Furthermore, paclitaxel-inhibiting breast cancer metastasis is associated with down-regulation of DJ-1 and ID-1 mRNA expression level with a concurrent increase in KLF17 expression. Under the same experimental conditions, paclitaxel induces KLF17 and concurrently represses ID-1 protein levels. Our results show for the first time that paclitaxel inhibits breast cancer metastasis through regulating DJ-1/KLF17/ID-1 signalling pathway; repressed DJ-1 and ID-1 and enhanced KLF17 expression. © 2018 John Wiley & Sons Australia, Ltd.

Natural killer cells regulate Th1/Treg and Th17/Treg balance in chlamydial lung infection.

Science.gov (United States)

Li, Jing; Dong, Xiaojing; Zhao, Lei; Wang, Xiao; Wang, Yan; Yang, Xi; Wang, Hong; Zhao, Weiming

2016-07-01

Natural killer (NK) cell is an important component in innate immunity, playing a critical role in bridging innate and adaptive immunity by modulating the function of other immune cells including T cells. In this study, we focused on the role of NK cells in regulating Th1/Treg and Th17/Treg balance during chlamydial lung infection. We found that NK cell-depleted mice showed decreased Th1 and Th17 cells, which was correlated with reduced interferon-γ, interleukin (IL)-12, IL-17 and IL-22 production as well as T-bet and receptor-related orphan receptor gamma t expression compared with mice treated with the isotype control antibody. In contrast, NK cell depletion significantly increased Treg in cell number and related transcription factor (Foxp3) expression. The opposite trends of changes of Th1/Th17 and Treg led to significant reduction in the Th1/Treg and Th17/Treg ratios. The data implicate that NK cells play an important role in host defence against chlamydial lung infection, mainly through maintaining Th1/Treg and Th17/Treg balance. © 2016 The Authors. Journal of Cellular and Molecular Medicine published by John Wiley & Sons Ltd and Foundation for Cellular and Molecular Medicine.

Antenatal betamethasone attenuates the angiotensin-(1-7)-Mas receptor-nitric oxide axis in isolated proximal tubule cells.

Science.gov (United States)

Su, Yixin; Bi, Jianli; Pulgar, Victor M; Chappell, Mark C; Rose, James C

2017-06-01

We previously reported a sex-specific effect of antenatal treatment with betamethasone (Beta) on sodium (Na + ) excretion in adult sheep whereby treated males but not females had an attenuated natriuretic response to angiotensin-(1-7) [Ang-(1-7)]. The present study determined the Na + uptake and nitric oxide (NO) response to low-dose Ang-(1-7) (1 pM) in renal proximal tubule cells (RPTC) from adult male and female sheep antenatally exposed to Beta or vehicle. Data were expressed as percentage of basal uptake or area under the curve for Na + or percentage of control for NO. Male Beta RPTC exhibited greater Na + uptake than male vehicle cells (433 ± 28 vs. 330 ± 26%; P 0.05). Ang-(1-7) significantly inhibited Na + uptake in RPTC from vehicle male (214 ± 11%) and from both vehicle (190 ± 14%) and Beta (209 ± 11%) females but failed to attenuate Na + uptake in Beta male cells. Beta exposure also abolished stimulation of NO by Ang-(1-7) in male but not female RPTC. Both the Na + and NO responses to Ang-(1-7) were blocked by Mas receptor antagonist d-Ala 7 -Ang-(1-7). We conclude that the tubular Ang-(1-7)-Mas-NO pathway is attenuated in males and not females by antenatal Beta exposure. Moreover, since primary cultures of RPTC retain both the sex and Beta-induced phenotype of the adult kidney in vivo they appear to be an appropriate cell model to examine the effects of fetal programming on Na + handling by the renal tubules. Copyright © 2017 the American Physiological Society.

Mechanism of the Dual Activities of Human CYP17A1 and Binding to Anti-Prostate Cancer Drug Abiraterone Revealed by a Novel V366M Mutation Causing 17,20 Lyase Deficiency

Directory of Open Access Journals (Sweden)

Mónica Fernández-Cancio

2018-04-01

Full Text Available The CYP17A1 gene regulates sex steroid biosynthesis in humans through 17α-hydroxylase/17,20 lyase activities and is a target of anti-prostate cancer drug abiraterone. In a 46, XY patient with female external genitalia, together with a loss of function mutation S441P, we identified a novel missense mutation V366M at the catalytic center of CYP17A1 which preferentially impaired 17,20 lyase activity. Kinetic experiments with bacterially expressed proteins revealed that V366M mutant enzyme can bind and metabolize pregnenolone to 17OH-pregnenolone, but 17OH-pregnenolone binding and conversion to dehydroepiandrosterone (DHEA was impaired, explaining the patient’s steroid profile. Abiraterone could not bind and inhibit the 17α-hydroxylase activity of the CYP17A1-V366M mutant. Molecular dynamics (MD simulations showed that V366M creates a “one-way valve” and suggests a mechanism for dual activities of human CYP17A1 where, after the conversion of pregnenolone to 17OH-pregnenolone, the product exits the active site and re-enters for conversion to dehydroepiandrosterone. The V366M mutant also explained the effectiveness of the anti-prostate cancer drug abiraterone as a potent inhibitor of CYP17A1 by binding tightly at the active site in the WT enzyme. The V366M is the first human mutation to be described at the active site of CYP17A1 that causes isolated 17,20 lyase deficiency. Knowledge about the specificity of CYP17A1 activities is of importance for the development of treatments for polycystic ovary syndrome and inhibitors for prostate cancer therapy.

Surface tension and 0.1 MPa density data for 1-Cn-3-methylimidazolium iodides with n=3, 4, and 6, validated using a parachor and group contribution model

Czech Academy of Sciences Publication Activity Database

Součková, Monika; Klomfar, Jaroslav; Pátek, Jaroslav

2015-01-01

Roč. 83, April (2015), s. 52-60 ISSN 0021-9614 R&D Projects: GA ČR GA13-00145S; GA ČR GA101/09/0010 Institutional support: RVO:61388998 Keywords : density * surface tension * 1-alkyl-3-methylimidazolium iodide * group contribution method * parachor Subject RIV: BJ - Thermodynamics Impact factor: 2.196, year: 2015

Interleukin-17 limits hypoxia-inducible factor 1α and development of hypoxic granulomas during tuberculosis.

Science.gov (United States)

Domingo-Gonzalez, Racquel; Das, Shibali; Griffiths, Kristin L; Ahmed, Mushtaq; Bambouskova, Monika; Gopal, Radha; Gondi, Suhas; Muñoz-Torrico, Marcela; Salazar-Lezama, Miguel A; Cruz-Lagunas, Alfredo; Jiménez-Álvarez, Luis; Ramirez-Martinez, Gustavo; Espinosa-Soto, Ramón; Sultana, Tamanna; Lyons-Weiler, James; Reinhart, Todd A; Arcos, Jesus; de la Luz Garcia-Hernandez, Maria; Mastrangelo, Michael A; Al-Hammadi, Noor; Townsend, Reid; Balada-Llasat, Joan-Miquel; Torrelles, Jordi B; Kaplan, Gilla; Horne, William; Kolls, Jay K; Artyomov, Maxim N; Rangel-Moreno, Javier; Zúñiga, Joaquín; Khader, Shabaana A

2017-10-05

Mycobacterium tuberculosis (Mtb) is a global health threat, compounded by the emergence of drug-resistant strains. A hallmark of pulmonary tuberculosis (TB) is the formation of hypoxic necrotic granulomas, which upon disintegration, release infectious Mtb. Furthermore, hypoxic necrotic granulomas are associated with increased disease severity and provide a niche for drug-resistant Mtb. However, the host immune responses that promote the development of hypoxic TB granulomas are not well described. Using a necrotic Mtb mouse model, we show that loss of Mtb virulence factors, such as phenolic glycolipids, decreases the production of the proinflammatory cytokine IL-17 (also referred to as IL-17A). IL-17 production negatively regulates the development of hypoxic TB granulomas by limiting the expression of the transcription factor hypoxia-inducible factor 1α (HIF1α). In human TB patients, HIF1α mRNA expression is increased. Through genotyping and association analyses in human samples, we identified a link between the single nucleotide polymorphism rs2275913 in the IL-17 promoter (-197G/G), which is associated with decreased IL-17 production upon stimulation with Mtb cell wall. Together, our data highlight a potentially novel role for IL-17 in limiting the development of hypoxic necrotic granulomas and reducing disease severity in TB.

IL-1β, But Not Programed Death-1 and Programed Death Ligand Pathway, Is Critical for the Human Th17 Response to Mycobacterium tuberculosis

Science.gov (United States)

Stephen-Victor, Emmanuel; Sharma, Varun Kumar; Das, Mrinmoy; Karnam, Anupama; Saha, Chaitrali; Lecerf, Maxime; Galeotti, Caroline; Kaveri, Srinivas V.; Bayry, Jagadeesh

2016-01-01

The programed death-1 (PD-1)–programed death ligand-1 (PD-L1) and PD-L2 co-inhibitory pathway has been implicated in the evasion strategies of Mycobacterium tuberculosis. Specifically, M. tuberculosis-induced PD-L1 orchestrates expansion of regulatory T cells and suppression of Th1 response. However, the role of PD pathway in regulating Th17 response to M. tuberculosis has not been investigated. In the present report, we demonstrate that M. tuberculosis and M. tuberculosis-derived antigen fractions have differential abilities to mediate human monocyte- and dendritic cell (DC)-mediated Th17 response and were independent of expression of PD-L1 or PD-L2 on aforementioned antigen-presenting cells. Importantly, we observed that blockade of PD-L1 or PD-1 did not significantly modify either the frequencies of Th17 cells or the production of IL-17 from CD4+ T cells though IFN-γ response was significantly enhanced. On the contrary, IL-1β from monocytes and DCs were critical for the Th17 response to M. tuberculosis. Together, our results indicate that IL-1β, but not members of the programed death pathway, is critical for human Th17 response to M. tuberculosis. PMID:27867382

IL-1β but not programmed death-1 and programmed death-ligand pathway is critical for the human Th17 response to M. tuberculosis

Directory of Open Access Journals (Sweden)

Emmanuel Stephen-Victor

2016-11-01

Full Text Available The programmed death-1 (PD-1- programmed death ligand-1 (PD-L1 and PD-L2 co-inhibitory pathway has been implicated in the evasion strategies of Mycobacterium tuberculosis. Specifically, M. tuberculosis-induced PD-L1 orchestrates expansion of regulatory T cells (Tregs and suppression of Th1 response. However, the role of PD pathway in regulating Th17 response to M. tuberculosis has not been investigated. In the present report, we demonstrate that M. tuberculosis and M. tuberculosis-derived antigen fractions have differential abilities to mediate human monocyte and dendritic cell (DC-mediated Th17 response and were independent of expression of PD-L1 or PD-L2 on aforementioned antigen-presenting cells. Importantly, we observed that blockade of PD-L1 or PD-1 did not significantly modify either the frequencies of Th17 cells or the production of IL-17 from CD4+ T cells though IFN-γ response was significantly enhanced. On the contrary, IL-1β from monocytes and DCs were critical for the Th17 response to M. tuberculosis. Together, our results indicate that IL-1β but not members of the programmed death pathway is critical for human Th17 response to M. tuberculosis

Holographic RG flow in a new SO(3) × SO(3) sector of ω-deformed SO(8) gauged N = 8 $$ \\mathcal{N}=8 $$ supergravity

OpenAIRE

Pang, YiGeorge P. & Cynthia Woods Mitchell Institute for Fundamental Physics and Astronomy, Texas A&M; University, College Station, TX, 77843, U.S.A.; Pope, C.(George P. & Cynthia Woods Mitchell Institute for Fundamental Physics and Astronomy, Texas A&M; University, College Station, TX, 77843, U.S.A.); Rong, Junchen(George P. & Cynthia Woods Mitchell Institute for Fundamental Physics and Astronomy, Texas A&M; University, College Station, TX, 77843, U.S.A.)

2015-01-01

We consider a certain ${\\cal N}=1$ supersymmetric, $SO(3)\\times SO(3)$ invariant, subsector of the $\\omega$-deformed family of $SO(8)$-gauged ${\\cal N}=8$ four-dimensional supergravities. The theory contains two scalar fields and two pseudoscalar fields. We look for stationary points of the scalar potential, corresponding to AdS vacua in the theory. One of these, which breaks all supersymmetries but is nonetheless stable, is new. It exists only when $\\omega\

Role of PD1/PDL1 pathway, and TH17 and treg cells in maternal tolerance to the fetus

Directory of Open Access Journals (Sweden)

Sudipta Tripathi

2015-02-01

Full Text Available Tolerance of the fetus by the maternal immune system is regulated through various mechanisms involving the different immune cells, both in the periphery and locally at the feto-maternal interface. The maternal T lymphocytes are aware of the paternal fetal antigens and a state of dynamic T cell homeostasis is maintained in the uterus during gestation, which involves increase in antigen-specific regulatory T cell (Treg proliferation, increase in apoptosis of antigen-specific effector T cells, and inhibition of excessive inflammation post successful implantation to ensure tolerance to the fetus. The Tregs play an important role in the maintenance of tolerance during gestation. Recently, the inflammatory T helper type 17 (Th17 cells are reported to have a role in loss of tolerance to the fetus. The interaction between costimulatory molecule programmed death 1 (PD1 and its ligand PDL1 is known to play a role in regulating both the Tregs and Th17 cells. Here we discuss how the PD1/PDL1 pathway affects these two T cell populations and its role in feto-maternal tolerance.

Matrix elements of a hyperbolic vector operator under SO(2,1)

International Nuclear Information System (INIS)

Zettili, N.; Boukahil, A.

2003-01-01

We deal here with the use of Wigner–Eckart type arguments to calculate the matrix elements of a hyperbolic vector operator V-vector by expressing them in terms of reduced matrix elements. In particular, we focus on calculating the matrix elements of this vector operator within the basis of the hyperbolic angular momentum T-vector whose components T-vector 1 , T-vector 2 , T-vector 3 satisfy an SO(2,1) Lie algebra. We show that the commutation rules between the components of V-vector and T-vector can be inferred from the algebra of ordinary angular momentum. We then show that, by analogy to the Wigner–Eckart theorem, we can calculate the matrix elements of V-vector within a representation where T-vector 2 and T-vector 3 are jointly diagonal. (author)

IL-1 and IL-23 mediate early IL-17A production in pulmonary inflammation leading to late fibrosis.

Directory of Open Access Journals (Sweden)

Paméla Gasse

Full Text Available BACKGROUND: Idiopathic pulmonary fibrosis is a devastating as yet untreatable disease. We demonstrated recently the predominant role of the NLRP3 inflammasome activation and IL-1β expression in the establishment of pulmonary inflammation and fibrosis in mice. METHODS: The contribution of IL-23 or IL-17 in pulmonary inflammation and fibrosis was assessed using the bleomycin model in deficient mice. RESULTS: We show that bleomycin or IL-1β-induced lung injury leads to increased expression of early IL-23p19, and IL-17A or IL-17F expression. Early IL-23p19 and IL-17A, but not IL-17F, and IL-17RA signaling are required for inflammatory response to BLM as shown with gene deficient mice or mice treated with neutralizing antibodies. Using FACS analysis, we show a very early IL-17A and IL-17F expression by RORγt(+ γδ T cells and to a lesser extent by CD4αβ(+ T cells, but not by iNKT cells, 24 hrs after BLM administration. Moreover, IL-23p19 and IL-17A expressions or IL-17RA signaling are necessary to pulmonary TGF-β1 production, collagen deposition and evolution to fibrosis. CONCLUSIONS: Our findings demonstrate the existence of an early IL-1β-IL-23-IL-17A axis leading to pulmonary inflammation and fibrosis and identify innate IL-23 and IL-17A as interesting drug targets for IL-1β driven lung pathology.

Angiotensin-(1-7)/Mas axis modulates fear memory and extinction in mice.

Science.gov (United States)

Lazaroni, Thiago Luiz do Nascimento; Bastos, Cristiane Perácio; Moraes, Márcio Flávio Dutra; Santos, Robson Souza; Pereira, Grace Schenatto

2016-01-01

Inappropriate defense-alerting reaction to fear is a common feature of neuropsychiatric diseases. Therefore, impairments in brain circuits, as well as in molecular pathways underlying the neurovegetative adjustments to fear may play an essential role on developing neuropsychiatric disorders. Here we tested the hypothesis that interfering with angiotensin-(1-7) [Ang-(1-7)]/Mas receptor axis homeostasis, which appears to be essential to arterial pressure control, would affect fear memory and extinction. Mas knockout (MasKO) mice, in FVB/N background, showed normal cued fear memory and extinction, but increased freezing in response to context. Next, as FVB/N has poor performance in contextual fear memory, we tested MasKO in mixed 129xC57BL/6 background. MasKO mice behaved similarly to wild-type (WT), but memory extinction was slower in contextual fear conditioning to a weak protocol (1CS/US). In addition, delayed extinction in MasKO mice was even more pronounced after a stronger protocol (3CS/US). We showed previously that Angiotensin II receptor AT1 antagonist, losantan, rescued object recognition memory deficit in MasKO mice. Here, losartan was also effective. Memory extinction was accelerated in MasKO mice after treatment with losartan. In conclusion, we showed for the first time that Ang-(1-7)/Mas axis may modulate fear memory extinction. Furthermore, we suggest MasKO mice as an animal model to study post-traumatic stress disorder (PTSD). Copyright © 2015 Elsevier Inc. All rights reserved.

17β-estradiol-induced regulation of the novel 5-HT1A-related transcription factors NUDR and Freud-1 in SH SY5Y cells.

Science.gov (United States)

Adeosun, Samuel O; Albert, Paul R; Austin, Mark C; Iyo, Abiye H

2012-05-01

Nuclear deformed epidermal autoregulatory factor-1 (NUDR/Deaf-1) and five prime repressor element under dual repression (Freud-1) are novel transcriptional regulators of the 5-HT(1A) receptor, a receptor that has been implicated in the pathophysiology of various psychiatric illnesses. The antidepressant effect of 17β-Estradiol (17βE(2)) is purported to involve the downregulation of this receptor. We investigated the possible role of NUDR and Freud-1 in 17βE(2)-induced downregulation of the 5-HT(1A) receptor in the neuroblastoma cell line SH SY5Y. Cells were treated with 10 nM of 17βE(2) for 3 or 48 h, followed by a 24-h withdrawal period. Proteins were isolated and analyzed by western blotting. 17βE(2) treatment increased NUDR immunoreactivity while Freud-1 and the 5-HT(1A) receptor showed significant decreases. Upon withdrawal of 17βE(2), protein expression returned to control levels, except for NUDR, which remained significantly elevated in the 3-h treatment. Taken together, these data support a non-genomic downregulation of 5-HT(1A) receptor protein by 17βE(2), which does not involve NUDR and Freud-1. Rather, changes in both transcription factors seem to be compensatory/homeostatic responses to changes in 5-HT(1A) receptor induced by 17βE(2). These observations further highlight the importance of NUDR and Freud-1 in regulating 5-HT(1A) receptor expression.

UV Fourier transform measurements of tropospheric O3, NO2, SO2, benzene, and toluene

International Nuclear Information System (INIS)

Vandaele, A.C.; Tsouli, A.; Carleer, M.; Colin, R.

2002-01-01

Using the differential optical absorption spectroscopy (DOAS) technique and a Fourier transform spectrometer, NO 2 , SO 2 , O 3 , benzene, and toluene were measured during three measurement campaigns held in Brussels in 1995, 1996, and 1997. The O 3 concentrations could be explained as the results of the local photochemistry and the dynamical properties of the mixing layer. NO 2 concentrations were anti-correlated to the O 3 concentrations, is expected. SO 2 also showed a pronounced dependence on car traffic. Average benzene and toluene concentrations were, respectively 1.7 ppb and between 4.4 and 6.6 pbb, but high values of toluene up to 98.8 ppb were observed. SO 2 concentrations and to a lesser extent, those of NO 2 and O 3 , were dependent on the wind direction. Ozone in Brussels has been found to be influenced by the meteorological conditions prevailing in central Europe. Comparisons with other measurements have shown that O 3 and SO 2 data are in general in good agreement, but our NO 2 concentrations seem to be generally higher. (author)

17β-estradiol induces stearoyl-CoA desaturase-1 expression in estrogen receptor-positive breast cancer cells

International Nuclear Information System (INIS)

Belkaid, Anissa; Duguay, Sabrina R.; Ouellette, Rodney J.; Surette, Marc E.

2015-01-01

To sustain cell growth, cancer cells exhibit an altered metabolism characterized by increased lipogenesis. Stearoyl-CoA desaturase-1 (SCD-1) catalyzes the production of monounsaturated fatty acids that are essential for membrane biogenesis, and is required for cell proliferation in many cancer cell types. Although estrogen is required for the proliferation of many estrogen-sensitive breast carcinoma cells, it is also a repressor of SCD-1 expression in liver and adipose. The current study addresses this apparent paradox by investigating the impact of estrogen on SCD-1 expression in estrogen receptor-α-positive breast carcinoma cell lines. MCF-7 and T47D mammary carcinomas cells and immortalized MCF-10A mammary epithelial cells were hormone-starved then treated or not with 17β-estradiol. SCD-1 activity was assessed by measuring cellular monounsaturated/saturated fatty acid (MUFA/SFA) ratios, and SCD-1 expression was measured by qPCR, immunoblot, and immunofluorescence analyses. The role of SCD-1 in cell proliferation was measured following treatment with the SCD-1 inhibitor A959372 and following SCD-1 silencing using siRNA. The involvement of IGF-1R on SCD-1 expression was measured using the IGF-1R antagonist AG1024. The expression of SREBP-1c, a transcription factor that regulates SCD-1, was measured by qPCR, and by immunoblot analyses. 17β-estradiol significantly induced cell proliferation and SCD-1 activity in MCF-7 and T47D cells but not MCF-10A cells. Accordingly, 17β-estradiol significantly increased SCD-1 mRNA and protein expression in MCF-7 and T47D cells compared to untreated cells. Treatment of MCF-7 cells with 4-OH tamoxifen or siRNA silencing of estrogen receptor-α largely prevented 17β-estradiol-induced SCD-1 expression. 17β-estradiol increased SREBP-1c expression and induced the mature active 60 kDa form of SREBP-1. The selective SCD-1 inhibitor or siRNA silencing of SCD-1 blocked the 17β-estradiol-induced cell proliferation and increase in

Dicty_cDB: Contig-U07450-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available ration Library Syntrich... 208 3e-52 2 ( CN205665 ) Tor6072 Gametophyte rehydration... Library Syntrichi... 208 3e-52 2 ( CN202424 ) Tor2583 Gametophyte rehydration Li...brary Syntrichi... 208 3e-52 2 ( CN207120 ) Tor7541 Gametophyte rehydration Library Syntrichi... 208 3e-52 2...... 224 1e-54 1 ( BJ958614 ) Physcomitrella patens subsp. patens cDNA clone:pp... 216 3e-52 1 ( CN200625 ) Tor10291 Gametophyte rehyd

17 CFR 12.17 - Satisfaction of complaint.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 1 2010-04-01 2010-04-01 false Satisfaction of complaint. 12... RELATING TO REPARATIONS General Information and Preliminary Consideration of Pleadings § 12.17 Satisfaction... as the complainant will accept in satisfaction of his claim; and (b) by submitting to the Commission...

SU(2) X SU(2) X U(1) basis for symmetric SO(6) representations: matrix elements of the generators

International Nuclear Information System (INIS)

Piepenbring, R.; Silvestre-Brac, B.; Szymanski, Z.

1987-01-01

Matrix elements of the group generators for the symmetric irreducible representations of SO(6) are explicitly calculated in a closed form employing thedecomposition chain SO(6) is contained in SU(2) X SU(2) X U(1) (which is different from the well known Wigner supermultiplet scheme). The relation to the Gel'fand Tsetlin method using SO(6) contained in SO(5) up to ... SO(2) is indicated. An example of a physical application is given

The geometry of lie algebras and broken SO(6) symmetries

International Nuclear Information System (INIS)

Lawrence, T.R.

2001-10-01

Non-linear realisations of the groups SU(2), SO(1,4) and SO(2,4) are analysed, described by the coset spaces SU(2)/U(1), SO(1,4)/SO(1,3) and SO(2,4)/SO(1,3) x SO(1,1). The Lie algebras of certain special unitary and special orthogonal groups are studied and their projection operators are determined in order to facilitate the above analyses, in particular that of SO(2,4)/SO(l,3) x SO(1,1). The analysis consists of determining the transformation properties of the Goldstone bosons, constructing the most general possible Lagrangian for the realisations and finding the metric of the coset space. (author)

Association of plasma angiotensin-(1-7 level and left ventricular function in patients with type 2 diabetes mellitus.

Directory of Open Access Journals (Sweden)

Pan-Pan Hao

Full Text Available We recently found that overexpression of angiotensin (Ang-converting enzyme 2, which metabolizes Ang-II to Ang-(1-7 and Ang-I to Ang-(1-9, may prevent diabetes-induced left ventricular remodeling and dysfunction in rats. Our objective was to evaluate the association of plasma Ang-(1-7 level and left ventricular function in patients with type 2 diabetes mellitus.We measured the left ventricular ejection fraction (EF, ratio of early to late left ventricular filling velocity (E/A and ratio of early diastolic mitral inflow to annular velocity (E/Ea by ultrasonography in 110 patients with type 2 diabetes mellitus for more than 5 years. Anthropometric and fasting blood values were obtained from medical records. The plasma Ang-(1-7 level in patients with a poor EF (15 was significantly lower than that in patients with E/Ea ≤15. Ang-(1-7 level was negatively correlated with E/Ea and Log-N-terminal pro-B-type natriuretic peptide and positively with EF and E/A. Stepwise multiple regression analysis revealed that Ang-(1-7, hemoglobin A1c and Ang-II levels as well as duration of diabetes predicted EF; Ang-(1-7 level, fasting blood glucose, low-density lipoprotein cholesterol level and duration of diabetes predicted E/A; and Ang-(1-7 and hemoglobin A1c levels predicted E/Ea.Plasma Ang-(1-7 level is independently associated with left ventricular function in patients with type 2 diabetes mellitus and may be a biomarker for assessing cardiac function in such patients.

17 CFR 240.14e-1 - Unlawful tender offer practices.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Unlawful tender offer... Securities Exchange Act of 1934 Regulation 14e § 240.14e-1 Unlawful tender offer practices. As a means... section 14(e) of the Act, no person who makes a tender offer shall: (a) Hold such tender offer open for...

Th1 and Th17 Cells and Associated Cytokines Discriminate among Clinically Isolated Syndrome and Multiple Sclerosis Phenotypes.

Science.gov (United States)

Arellano, Gabriel; Acuña, Eric; Reyes, Lilian I; Ottum, Payton A; De Sarno, Patrizia; Villarroel, Luis; Ciampi, Ethel; Uribe-San Martín, Reinaldo; Cárcamo, Claudia; Naves, Rodrigo

2017-01-01

Multiple sclerosis (MS) is a chronic, inflammatory, and demyelinating disease of the central nervous system. It is a heterogeneous pathology that can follow different clinical courses, and the mechanisms that underlie the progression of the immune response across MS subtypes remain incompletely understood. Here, we aimed to determine differences in the immunological status among different MS clinical subtypes. Blood samples from untreated patients diagnosed with clinically isolated syndrome (CIS) ( n  = 21), different clinical forms of MS ( n  = 62) [relapsing-remitting (RRMS), secondary progressive, and primary progressive], and healthy controls (HCs) ( n  = 17) were tested for plasma levels of interferon (IFN)-γ, IL-10, TGF-β, IL-17A, and IL-17F by immunoanalysis. Th1 and Th17 lymphocyte frequencies were determined by flow cytometry. Our results showed that IFN-γ levels and the IFN-γ/IL-10 ratio were higher in CIS patients than in RRMS patients and HC. Th1 cell frequencies were higher in CIS and RRMS than in progressive MS, and RRMS had a higher Th17 frequency than CIS. The Th1/Th17 cell ratio was skewed toward Th1 in CIS compared to MS phenotypes and HC. Receiver operating characteristic statistical analysis determined that IFN-γ, the IFN-γ/IL-10 ratio, Th1 cell frequency, and the Th1/Th17 cell ratio discriminated among CIS and MS subtypes. A subanalysis among patients expressing high IL-17F levels showed that IL-17F and the IFN-γ/IL-17F ratio discriminated between disease subtypes. Overall, our data showed that CIS and MS phenotypes displayed distinct Th1- and Th17-related cytokines and cell profiles and that these immune parameters discriminated between clinical forms. Upon validation, these parameters might be useful as biomarkers to predict disease progression.

17 CFR 240.15c1-8 - Sales at the market.

Science.gov (United States)

2010-04-01

... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales at the market. 240.15c1... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-8 Sales at the market... securities exchange that such security is being offered to such customer “at the market” or at a price...

Exploration and pharmacokinetic profiling of phenylalanine based carbamates as novel substance p 1-7 analogues.

Science.gov (United States)

Fransson, Rebecca; Nordvall, Gunnar; Bylund, Johan; Carlsson-Jonsson, Anna; Kratz, Jadel M; Svensson, Richard; Artursson, Per; Hallberg, Mathias; Sandström, Anja

2014-12-11

The bioactive metabolite of Substance P, the heptapeptide SP1-7 (H-Arg-Pro-Lys-Pro-Gln-Gln-Phe-OH), has been shown to attenuate signs of hyperalgesia in diabetic mice, which indicate a possible use of compounds targeting the SP1-7 binding site as analgesics for neuropathic pain. Aiming at the development of drug-like SP1-7 peptidomimetics we have previously reported on the discovery of H-Phe-Phe-NH2 as a high affinity lead compound. Unfortunately, the pharmacophore of this compound was accompanied by a poor pharmacokinetic (PK) profile. Herein, further lead optimization of H-Phe-Phe-NH2 by substituting the N-terminal phenylalanine for a benzylcarbamate group giving a new type of SP1-7 analogues with good binding affinities is reported. Extensive in vitro as well as in vivo PK characterization is presented for this compound. Evaluation of different C-terminal functional groups, i.e., hydroxamic acid, acyl sulfonamide, acyl cyanamide, acyl hydrazine, and oxadiazole, suggested hydroxamic acid as a bioisosteric replacement for the original primary amide.

Pharmacological characterisation of the highly NaV1.7 selective spider venom peptide Pn3a

OpenAIRE

Jennifer R. Deuis; Zoltan Dekan; Joshua S. Wingerd; Jennifer J. Smith; Nehan R. Munasinghe; Rebecca F. Bhola; Wendy L. Imlach; Volker Herzig; David A. Armstrong; K. Johan Rosengren; Frank Bosmans; Stephen G. Waxman; Sulayman D. Dib-Hajj; Pierre Escoubas; Michael S. Minett

2017-01-01

Human genetic studies have implicated the voltage-gated sodium channel NaV1.7 as a therapeutic target for the treatment of pain. A novel peptide, ?-theraphotoxin-Pn3a, isolated from venom of the tarantula Pamphobeteus nigricolor, potently inhibits NaV1.7 (IC50 0.9?nM) with at least 40?1000-fold selectivity over all other NaV subtypes. Despite on-target activity in small-diameter dorsal root ganglia, spinal slices, and in a mouse model of pain induced by NaV1.7 activation, Pn3a alone displayed...

The (x, T) magnetic phase diagram of Y2Co17-xCrx (1.17-bar x-bar 3) compounds by neutron diffraction

International Nuclear Information System (INIS)

Schobinger-Papamantellos, P.; Buschow, K.H.J.; Fuquan, B.; Tegus, O.; Brueck, E.; Boer, F.R. de; Ritter, C.

2006-01-01

We present the (x, T) phase diagram of the ferromagnetic Y 2 Co 17-x Cr x (x=1.17, 1.76, 2.34, 3) compounds with rhombohedral structure (space group R3-bar m, Th 2 Zn 17 -type), determined for the entire magnetically ordered regime from high-resolution neutron-diffraction data. Substitution of small amounts of Cr for Co was found to have drastic effects on the magnetic properties such as a decrease of the Curie (T C ) and spin reorientation (T SR ) temperatures as well as a decrease of the ordered-moment values. These effects could be brought into connection to the fact that Cr was found to have a preference for the four Co sites in the following order 6c>18f>9d>18h. The number of Cr atoms found occupying the latter two sites, however, is within experimental error negligible. The magnetic phase diagram comprises three distinct regions of magnetic order in addition to the paramagnetic state: (a) the HT range (easy axis) (b) the LT (easy plane) for 0 C and T SR . It also leads to the formation of varying portions of the hexagonal Th 2 Ni 17 -modification (with similar magnetic properties) in samples with x>=1.76. The crystal and magnetic structure of both modifications were refined simultaneously

SO3 formation from the X-ray photolysis of SO2 astrophysical ice analogues: FTIR spectroscopy and thermodynamic investigations.

Science.gov (United States)

de Souza Bonfim, Víctor; Barbosa de Castilho, Roberto; Baptista, Leonardo; Pilling, Sergio

2017-10-11

In this combined experimental-theoretical work we focus on the physical and chemical changes induced by soft X-rays on sulfur dioxide (SO 2 ) ice at a very low temperature, in an attempt to clarify and quantify its survival and chemical changes in some astrophysical environments. SO 2 is an important constituent of some Jupiter moons and has also been observed in ices around protostars. The measurements were performed at the Brazilian Synchrotron Light Source (LNLS/CNPEM), in Campinas, Brazil. The SO 2 ice sample (12 K) was exposed to a broadband beam of mainly soft X-rays (6-2000 eV) and in situ analyses were performed by IR spectroscopy. The X-ray photodesorption yield (upper limit) was around 0.25 molecules per photon. The values determined for the effective destruction (SO 2 ) and formation (SO 3 ) cross sections were 2.5 × 10 -18 cm 2 and 2.1 × 10 -18 cm 2 , respectively. The chemical equilibrium (88% of SO 2 and 12% of SO 3 ) was reached after the fluence of 1.6 × 10 18 photons cm -2 . The SO 3 formation channels were studied at the second-order Møller-Plesset perturbation theory (MP2) level, which showed the three most favorable reaction routes (ΔH < -79 kcal mol -1 ) in simulated SO 2 ice: (i) SO + O 2 → SO 3 , (ii) SO 2 + O → SO 3 , and (iii) SO 2 + O + → SO 3 + + e - → SO 3 . The amorphous solid environment effect decreases the reactivity of intermediate species towards SO 3 formation, and ionic species are even more affected. The experimentally determined effective cross sections and theoretical reaction channels identified in this work allow us to better understand the chemical evolution of certain sulfur-rich astrophysical environments.