WorldWideScience

Sample records for sonogashira-modified emivirine mkc-442

  1. Synthesis and Anti-HIV-1 Evaluation of New Sonogashira-Modified Emivirine (MKC-442) Analogues

    DEFF Research Database (Denmark)

    Danel, Krzystof; Jørgensen, Per Trolle; La Colla, Paolo

    2009-01-01

    The MKC-442 analogue 6-(3,5-dimethylbenzyl)-5-ethyluracil substituted with a (propargyloxo)methyl group at N(1) has previously been found highly active against HIV-1. The C C bond in the substituent at N(1) is here utilized in a series of chemical reactions in order to develop new agents with hig......The MKC-442 analogue 6-(3,5-dimethylbenzyl)-5-ethyluracil substituted with a (propargyloxo)methyl group at N(1) has previously been found highly active against HIV-1. The C C bond in the substituent at N(1) is here utilized in a series of chemical reactions in order to develop new agents...... with higher activity against HIV-1-resistant mutants. The syntheses involved Pd-catalyzed C,C-coupling reactions, addition of disulfides, and click chemistry on the terminal C C bond as well as addition of bromine to the so formed internal C C bonds. Sonogashira coupling were performed with silyl...

  2. Synthesis and Anti-HIV-1 Activity of New MKC-442 Analogues with an Alkynyl-Substituted 6-Benzyl Group

    DEFF Research Database (Denmark)

    Aly, Youssef L.; Pedersen, Erik Bjerreg.; La Colla, Paolo

    2007-01-01

    Synthesis and antiviral activities are reported of a series of 6-(3-alkynyl benzyl)-substituted analogues of MKC-442 (6-benzyl-1-(ethoxymethyl)-5-isopropyluracil), a highly potent agent against HIV. The 3-alkynyl group is assumed to give a better stacking of the substituted benzyl group to reverse...... transcriptase (RT) and this was believed to improve antiviral activity against HIV-1. The bromo derivatives, 5-alkyl-6-(3-bromo-benzyl)-1-ethoxymethyl derivatives 7a, b and 5-alkyl-6-(3-bromobenzyl)-1-allyloxymethyl derivatives 9a, b, showed activity against HIV on the same level as their corresponding...

  3. Phase I study of continuous MKC-1 in patients with advanced or metastatic solid malignancies using the modified Time-to-Event Continual Reassessment Method (TITE-CRM) dose escalation design.

    Science.gov (United States)

    Tevaarwerk, Amye; Wilding, George; Eickhoff, Jens; Chappell, Rick; Sidor, Carolyn; Arnott, Jamie; Bailey, Howard; Schelman, William; Liu, Glenn

    2012-06-01

    MKC-1 is an oral cell-cycle inhibitor with broad antitumor activity in preclinical models. Clinical studies demonstrated modest antitumor activity using intermittent dosing schedule, however additional preclinical data suggested continuous dosing could be efficacious with additional effects against the mTor/AKT pathway. The primary objectives were to determine the maximum tolerated dose (MTD) and response of continuous MKC-1. Secondary objectives included characterizing the dose limiting toxicities (DLTs) and pharmacokinetics (PK). Patients with solid malignancies were eligible, if they had measurable disease, ECOG PS ≤1, and adequate organ function. Exclusions included brain metastases and inability to receive oral drug. MKC-1 was dosed twice daily, continuously in 28-day cycles. Other medications were eliminated if there were possible drug interactions. Doses were assigned using a TITE-CRM algorithm following enrollment of the first 3 pts. Disease response was assessed every 8 weeks. Between 5/08-9/09, 24 patients enrolled (15 M/9 F, median 58 years, range 44-77). Patients 1-3 received 120 mg/d of MKC-1; patients 4-24 were dosed per the TITE-CRM algorithm: 150 mg [n = 1], 180 [2], 200 [1], 230 [1], 260 [5], 290 [6], 320 [5]. The median time on drug was 8 weeks (range 4-28). The only DLT occurred at 320 mg (grade 3 fatigue). Stable disease occurred at 150 mg/d (28 weeks; RCC) and 320 mg/d (16 weeks; breast, parotid). Escalation halted at 320 mg/d. Day 28 pharmacokinetics indicated absorption and active metabolites. Continuous MKC-1 was well-tolerated; there were no RECIST responses, although clinical benefit occurred in 3/24 pts. Dose escalation stopped at 320 mg/d, and this is the MTD as defined by the CRM dose escalation algorithm; this cumulative dose/cycle exceeds that determined from intermittent dosing studies. A TITE-CRM allowed for rapid dose escalation and was able to account for late toxicities with continuous dosing via a modified algorithm.

  4. Pd-catalyzed coupling reaction on the organic monolayer: Sonogashira reaction on the silicon (1 1 1) surfaces

    International Nuclear Information System (INIS)

    Qu Mengnan; Zhang Yuan; He Jinmei; Cao Xiaoping; Zhang Junyan

    2008-01-01

    Iodophenyl-terminated organic monolayers were prepared by thermally induced hydrosilylation on hydrogen-terminated silicon (1 1 1) surfaces. The films were characterized by ellipsometry, contact-angle goniometry, and X-ray photoelectron spectroscopy (XPS). To modify the surface chemistry and the structure of the monolayers, the Sonogashira coupling reaction was performed on the as-prepared monolayers. The iodophenyl groups on the film surfaces reacted with 1-ethynyl-4-fluorobenzene or the 1-chloro-4-ethynylbenzene under the standard Sonogashira reaction conditions for attaching conjugated molecules via the formation of C-C bonds. It is expected that this surface coupling reaction will present a new method to modify the surface chemistry and the structure of monolayers

  5. Sonogashira Coupling Reaction with Palladium Powder and Potassium Fluoride in Methanol

    Institute of Scientific and Technical Information of China (English)

    王磊; 李品华

    2003-01-01

    A Sonogashira coupling reaction of aromatic halides with terminal alkynes in the presence of palladium powder,potassium fluoride,cuprous iodide and triphenylphosphine in methanol,giving the corresponding coupling products aryl alkynes in good to excellent yiekls,was investigated.

  6. Cu(OAc)2 catalyzed Sonogashira cross-coupling reaction in amines

    Institute of Scientific and Technical Information of China (English)

    Sheng Mei Guo; Chen Liang Deng; Jin Heng Li

    2007-01-01

    A simple Cu(OAc)2 catalyzed Sonogashira coupling protocol is presented. It was found that the couplings of a variety of aryl halides with terminal alkynes were conducted smoothly to afford the corresponding desired products in moderate to excellent yields, using Cu(OAc)2 as the catalyst and Et3N as the solvent.

  7. Insights into Sonogashira cross-coupling by high-throughput kinetics and descriptor modeling

    NARCIS (Netherlands)

    an der Heiden, M.R.; Plenio, H.; Immel, S.; Burello, E.; Rothenberg, G.; Hoefsloot, H.C.J.

    2008-01-01

    A method is presented for the high-throughput monitoring of reaction kinetics in homogeneous catalysis, running up to 25 coupling reactions in a single reaction vessel. This method is demonstrated and validated on the Sonogashira reaction, analyzing the kinetics for almost 500 coupling reactions.

  8. Modular Three-Component Synthesis of 4-Aminoquinolines via an Imidoylative Sonogashira/Cyclization Cascade

    NARCIS (Netherlands)

    Collet, Jurriën W.; Ackermans, Kelly; Lambregts, Jeffrey; Maes, Bert U.W.; Orru, Romano V.A.; Ruijter, Eelco

    2018-01-01

    We developed a one-pot, two-stage synthetic route to substituted 4-aminoquinolines involving an imidoylative Sonogashira coupling followed by acid-mediated cyclization. This three-component reaction affords pharmaceutically valuable 4-aminoquinolines in a one-pot procedure from readily available

  9. Polystyrene-Supported Acyclic Diaminocarbene Palladium Complexes in Sonogashira Cross-Coupling: Stability vs. Catalytic Activity

    Directory of Open Access Journals (Sweden)

    Vladimir N. Mikhaylov

    2018-04-01

    Full Text Available Two types of immobilized on the amino-functionalized polystyrene-supported acyclic diaminocarbene palladium complexes (ADC-PdII are investigated under Sonogashira cross-coupling conditions. Depending on substituents in the diaminocarbene fragment immobilized ADC-PdII, systems are found to have different catalytic activity and stability regarding Pd-leaching. PdII-diaminocarbenes possessing protons at both nitrogen atoms smoothly decompose into Pd0-containing species providing a catalytic “cocktail system” with high activity and ability to reuse within nine runs. Polymer-supported palladium (II complex bearing NBn–Ccarbene–NH-moiety exhibits greater stability while noticeably lower activity under Sonogashira cross-coupling. Four molecular ADC-PdII complexes are also synthesized and investigated with the aim of confirming proposed base-promoted pathway of ADC-PdII conversion through carbodiimide into an active Pd0 forms.

  10. Sonogashira cross-coupling under non-basic conditions. Flow chemistry as a new paradigm in reaction control

    Czech Academy of Sciences Publication Activity Database

    Voltrová, Svatava; Šrogl, Jiří

    2014-01-01

    Roč. 1, č. 9 (2014), s. 1067-1071 ISSN 2052-4129 R&D Projects: GA MŠk LH12013 Institutional support: RVO:61388963 Keywords : Sonogashira * cross-coupling * flow chemistry Subject RIV: CC - Organic Chemistry

  11. Dicty_cDB: SLF442 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLF442 (Link to dictyBase) slf442 - - Contig-U16022-1 SLF442P ...(Link to Original site) SLF442F 294 SLF442Z 570 SLF442P 864 - - Show SLF442 Library SL (Link to library) Clone ID SLF4...42 (Link to dictyBase) Atlas ID slf442 NBRP ID - dictyBase ID - Link to Contig Contig-U16022-1 Ori...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLF4-B/SLF442Q.Seq.d/ Re...presentative seq. ID SLF442P (Link to Original site) Representative DNA sequence >SLF442 (SLF442Q) /CSM/SL/SLF4-B/SLF4

  12. Dicty_cDB: SLC442 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC442 (Link to dictyBase) - - - Contig-U16430-1 SLC442Z (Link... to Original site) - - SLC442Z 467 - - - - Show SLC442 Library SL (Link to library) Clone ID SLC442 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLC4-B/SLC442Q.Seq.d/ Representative seq. ID SLC44...2Z (Link to Original site) Representative DNA sequence >SLC442 (SLC442Q) /CSM/SL/SLC4-B/SLC442Q.Seq.d/ XXXXX... 4.0 %: extracellular, including cell wall 4.0 %: peroxisomal >> prediction for SLC4

  13. Functionalization of protected tyrosine via Sonogashira reaction: synthesis of 3-(1,2,3-triazolyl)-tyrosine.

    Science.gov (United States)

    Vasconcelos, Stanley N S; Shamim, Anwar; Ali, Bakhat; de Oliveira, Isadora M; Stefani, Hélio A

    2016-05-01

    1,2,3-Triazol tyrosines were synthesized from tyrosine alkynes that were in turn prepared via Sonogashira cross-coupling reaction. The tyrosine alkynes were subjected to click-chemistry reaction conditions leading to the corresponding 3-(1,2,3-triazolyl)-tyrosines in yields ranging from moderate to good.

  14. 49 CFR 172.442 - CORROSIVE label.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false CORROSIVE label. 172.442 Section 172.442... SECURITY PLANS Labeling § 172.442 CORROSIVE label. (a) Except for size and color, the CORROSIVE label must... CORROSIVE label must be white in the top half and black in the lower half. [Amdt. 172-123, 56 FR 66259, Dec...

  15. An efficient protocol for copper-free palladium-catalyzed Sonogashira cross-coupling in aqueous media at low temperatures

    KAUST Repository

    Marziale, Alexander N.; Schlü ter, Johannes; Eppinger, Jö rg

    2011-01-01

    A thorough study on copper-free Sonogashira cross-couplings in water was carried out using the palla-dacycle, [{Pd(μ-Cl){K2-P,C-P(iPr) 2(OC6H3-2-Ph)}}2] as pre-catalyst with different bases and palladium concentrations. The highly active pre

  16. A Facile Stereospecific Synthesis of 1, 3-Enynylsulfides via Sonogashira Coupling of (E)-α-Iodovinyl Sulfides with 1-Alkynes

    Institute of Scientific and Technical Information of China (English)

    Jian Wen JIANG; Ming Zhong CAI

    2006-01-01

    (E)-α-Iodovinyl sulfides 1 underwent the Sonogashira coupling reactions with terminal alkynes 2 in piperidine at room temperature in the presence of 5 mol % of Pd(PPh3)4 and 10 mol %of CuI to afford the corresponding 1, 3-enynylsulfides 3 stereospecifically in high yields.

  17. Reusable Polymer-Supported Terpyridine Palladium Complex for Suzuki-Miyaura, Mizoroki-Heck, Sonogashira, and Tsuji-Trost Reaction in Water

    Directory of Open Access Journals (Sweden)

    Takuya Nagamine

    2011-03-01

    Full Text Available A novel heterogeneous transition-metal catalyst comprising a polymer-supported terpyridine palladium(II complex was prepared and found to promote the Suzuki-Miyaura, Mizoroki-Heck, Sonogashira, and Tsuji-Trost, reactions in water under aerobic conditions with a high to excellent yield. The catalyst was recovered by simple filtration and directly reused several times without loss of catalytic activity.

  18. Optimization of an Efficient and Sustainable Sonogashira Cross-Coupling Protocol

    KAUST Repository

    Walter, Philipp E.

    2012-12-01

    Cross coupling reactions are a well-established tool in modern organic synthesis and play a crucial role in the synthesis of a high number of organic compounds. Their importance is highlighted by the Nobel Prize in chemistry to Suzuki, Heck and Negishi in 2010. The increasing importance of sustainability requirements in chemical production has furthermore promoted the development of cross-coupling protocols that comply with the principles of “Green Chemistry”1. The Sonogashira reaction is today the most versatile and powerful way to generate aryl alkynes, a moiety recurring in many pharmaceutical and natural products. Despite many improvements to the original reaction, reports on generally applicable protocols that work under sustainable conditions are scarce. Our group recently reported an efficient protocol for a copperfree Sonogashira cross-coupling at low temperature, in aqueous medium and with no addition of organic solvents or additives2. The goal of this work was to further investigate the effects of different reaction parameters on the catalytic activity in order to optimize the protocol. Limitations of the protocol were tested in respect to reaction temperature, heating method, atmosphere, base type and amount, catalyst loading, reaction time and work up procedure. The reaction worked successfully under air and results were not affected by the presence of oxygen in the water phase. Among a variety of bases tested, triethylamine was confirmed to give the best results and its required excess could be reduced from nine to four equivalents. Catalyst loading could also be reduced by up to 90%: Good to near quantitative yields for a broad range of substrates were achieved using a catalyst concentration of 0.25mol% and 5 eq of Et3N at 50°C while more reactive substrates could be coupled with a catalyst concentration as low as 0.025mol%. Filtration experiments showed the possibility of a simplified work up procedure and a protocol completely free of organic

  19. 7 CFR 28.442 - Middling Yellow Stained Color.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Middling Yellow Stained Color. 28.442 Section 28.442... Stained Color. Middling Yellow Stained Color is American Upland cotton which in color is deeper than Middling Tinged Color. [57 FR 34498, Aug. 5, 1992] below color grade cotton ...

  20. An efficient protocol for copper-free palladium-catalyzed Sonogashira cross-coupling in aqueous media at low temperatures

    KAUST Repository

    Marziale, Alexander N.

    2011-11-01

    A thorough study on copper-free Sonogashira cross-couplings in water was carried out using the palla-dacycle, [{Pd(μ-Cl){K2-P,C-P(iPr) 2(OC6H3-2-Ph)}}2] as pre-catalyst with different bases and palladium concentrations. The highly active pre-catalyst imparts good to near quantitative yields using a concentration of 0.25 mol % at 40 °C. This broadly applicable protocol exhibits high tolerance of functional groups and substitution patterns. © 2011 Elsevier Ltd. All rights reserved.

  1. Silica gel-Supported Palladium Catalyst for the Acyl Sonogashira Reaction

    Energy Technology Data Exchange (ETDEWEB)

    Hossain, Shahin; Park, Jihoon; Park, Minkyu; Jin, Myungjong [Inha Univ., Incheon (Korea, Republic of)

    2013-06-15

    We have demonstrated an efficient and eco-friendly procedure for the synthesis of ynones using silica supported thiol-palladium complex as a recyclable catalyst under copper free mild reaction conditions. The material was synthesized by post grafting of 3-mercaptopropyltrimethoxysilane on amorphous silica and subsequently Pd(II) attached onto thiol groups. This synthetic method has notable advantages because it involves easily available, less costly and produces an easily recyclable catalyst in high yields of the products. The mild reaction conditions encouraged us to further extension for the development of novel multicomponent reactions. Thus we have explained the three component synthesis of pyrazoles in one-pot fashion with good yields. Specifically, this simple procedure for the ynone synthesis and this approach to synthesize N-containing heterocycles may be valuable tool in future. The acyl Sonogashira reaction between acyl chlorides and terminal alkynes is one of the most useful method for the preparation of ynones which are important intermediates to prepare versatile pharmaceutically and biologically active heterocyclic compounds such as pyrroles, pyrazoles, furans, furanones, isoxazoles, pyrimidines, quinolines, indolizidinones.

  2. Silica gel-Supported Palladium Catalyst for the Acyl Sonogashira Reaction

    International Nuclear Information System (INIS)

    Hossain, Shahin; Park, Jihoon; Park, Minkyu; Jin, Myungjong

    2013-01-01

    We have demonstrated an efficient and eco-friendly procedure for the synthesis of ynones using silica supported thiol-palladium complex as a recyclable catalyst under copper free mild reaction conditions. The material was synthesized by post grafting of 3-mercaptopropyltrimethoxysilane on amorphous silica and subsequently Pd(II) attached onto thiol groups. This synthetic method has notable advantages because it involves easily available, less costly and produces an easily recyclable catalyst in high yields of the products. The mild reaction conditions encouraged us to further extension for the development of novel multicomponent reactions. Thus we have explained the three component synthesis of pyrazoles in one-pot fashion with good yields. Specifically, this simple procedure for the ynone synthesis and this approach to synthesize N-containing heterocycles may be valuable tool in future. The acyl Sonogashira reaction between acyl chlorides and terminal alkynes is one of the most useful method for the preparation of ynones which are important intermediates to prepare versatile pharmaceutically and biologically active heterocyclic compounds such as pyrroles, pyrazoles, furans, furanones, isoxazoles, pyrimidines, quinolines, indolizidinones

  3. 7 CFR 58.442 - Laboratory and quality control tests.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Laboratory and quality control tests. 58.442 Section... Service 1 Operations and Operating Procedures § 58.442 Laboratory and quality control tests. (a) Chemical... Methods or by other methods giving equivalent results. (b) Weight or volume control. Representative...

  4. Experimental gonococcal infection in male volunteers: Cumulative experience with Neisseria gonorrhoeae strains FA1090 and MS11mkC

    Directory of Open Access Journals (Sweden)

    Marcia Metzgar Hobbs

    2011-05-01

    Full Text Available Experimental infection of male volunteers with Neisseria gonorrhoeae is safe and reproduces the clinical features of naturally acquired gonococcal urethritis. Human inoculation studies have helped define the natural history of experimental infection with two well-characterized strains of N. gonorrhoeae, FA1090 and MS11mkC. The human model has proved useful for testing the importance of putative gonococcal virulence factors for urethral infection in men. Studies with isogenic mutants have improved our understanding of the requirements for gonococcal LOS structures, pili, opacity proteins, IgA1 protease and the ability of infecting organisms to obtain iron from human transferrin and lactoferrin during uncomplicated urethritis. The model also presents opportunities to examine innate host immune responses that may be exploited or improved in development and testing of gonococcal vaccines. Here we review results to date with human experimental gonorrhea.

  5. Synthesis and characterization of a novel Mg–Al hydrotalcite-loaded kaolin clay and its adsorption properties for phosphate in aqueous solution

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Lin, E-mail: denglinlyn@126.com; Shi, Zhou, E-mail: 369329062@qq.com

    2015-07-15

    Highlights: • Kaolin clay was coalesced with Mg–Al hydrotalcite to form composite adsorbent (MKC). • MKC was synthesized through modified co-precipitation method. • MKC gave high adsorption of phosphate over a wide pH range of 2.5–9.5. • MKC is an economical and environmentally friendly adsorbent for phosphate removal and recycling. - Abstract: The mesoporous modified kaolin clay (MKC) was synthesized by loading Mg–Al hydrotalcite onto kaolin clay through coprecipitation method and applied for adsorption of phosphate from aqueous solution. Several techniques, including Brunauer–Emmett–Teller (BET), thermal analysis (TG–DTA), and Fourier transform infrared spectroscopy (FTIR) were employed to characterize the adsorbents. The effects of adsorbent dosage, solution pH, initial phosphate concentration, contact time, temperature, and coexistent anions on phosphate adsorption have been investigated. MKC exhibited a strong uptake affinity to phosphate in a wide pH range of 2.5–9.5, with the maximum adsorptive removal of 98.03%, at adsorbent dosage of 0.2 g/50 mL, pH 7.5, and initial phosphate concentration 25 mg L{sup −1}. The adsorption kinetics followed the pseudo-second-order kinetic model. The Langmuir isothermal model well described the adsorption isotherm data, showing a maximum adsorption capacity for phosphate up to 11.92 mg g{sup −1} at 298 K. The obtained thermodynamic parameters revealed that the adsorption of phosphate onto MKC was an exothermic and spontaneous process. Coexistent chloride, nitrate, and sulfate ions displayed an adverse effect on phosphate adsorption following the order of SO{sub 4}{sup 2−} > NO{sub 3}{sup −} > Cl{sup −}. A mechanism of adsorption that involved (i) electrostatic attraction of hydroxyl groups of the adsorbent with negatively charged phosphate ions, and (ii) anion exchange of NO{sub 3}{sup −} ions that were associated with the surface or interlayer of the adsorbent with anionic phosphate ions in

  6. Synthesis and characterization of a novel Mg–Al hydrotalcite-loaded kaolin clay and its adsorption properties for phosphate in aqueous solution

    International Nuclear Information System (INIS)

    Deng, Lin; Shi, Zhou

    2015-01-01

    Highlights: • Kaolin clay was coalesced with Mg–Al hydrotalcite to form composite adsorbent (MKC). • MKC was synthesized through modified co-precipitation method. • MKC gave high adsorption of phosphate over a wide pH range of 2.5–9.5. • MKC is an economical and environmentally friendly adsorbent for phosphate removal and recycling. - Abstract: The mesoporous modified kaolin clay (MKC) was synthesized by loading Mg–Al hydrotalcite onto kaolin clay through coprecipitation method and applied for adsorption of phosphate from aqueous solution. Several techniques, including Brunauer–Emmett–Teller (BET), thermal analysis (TG–DTA), and Fourier transform infrared spectroscopy (FTIR) were employed to characterize the adsorbents. The effects of adsorbent dosage, solution pH, initial phosphate concentration, contact time, temperature, and coexistent anions on phosphate adsorption have been investigated. MKC exhibited a strong uptake affinity to phosphate in a wide pH range of 2.5–9.5, with the maximum adsorptive removal of 98.03%, at adsorbent dosage of 0.2 g/50 mL, pH 7.5, and initial phosphate concentration 25 mg L −1 . The adsorption kinetics followed the pseudo-second-order kinetic model. The Langmuir isothermal model well described the adsorption isotherm data, showing a maximum adsorption capacity for phosphate up to 11.92 mg g −1 at 298 K. The obtained thermodynamic parameters revealed that the adsorption of phosphate onto MKC was an exothermic and spontaneous process. Coexistent chloride, nitrate, and sulfate ions displayed an adverse effect on phosphate adsorption following the order of SO 4 2− > NO 3 − > Cl − . A mechanism of adsorption that involved (i) electrostatic attraction of hydroxyl groups of the adsorbent with negatively charged phosphate ions, and (ii) anion exchange of NO 3 − ions that were associated with the surface or interlayer of the adsorbent with anionic phosphate ions in solution, was proposed

  7. Synthesis of 1,4-naphthoquinone derivatives using 1,3-dipolar cycloaddition and Sonogashira reactions

    Directory of Open Access Journals (Sweden)

    Wilson Silva do Nascimento

    2010-04-01

    Full Text Available Naphthoquinones are known according to their important bio-activities, such as their antitumoral and topoisomerase inhibition properties. From 2-azido (3 or 2,3-diacetylene-1,4-naphthoquinone (4 it was possible to obtain triazole derivatives (naphthoquinonic. This work describes the synthesis of two novel molecules, with triazole groups linked to 1,4-naphthoquinone using the 1,3-dipolar cycloaddition and Sonogashira reactions. The synthetic strategy followed two routes (Scheme 1. First, we synthesized the 2-bromo-1,4-naphthoquinone (2, yield 98% by using Br2 and CH3CO2H, and then used it to obtain 2-azido-1,4-naphthoquinone (3, yield 62% from compound 1, along with ethanolic solution (reflux and NaN3. Finally, we prepared 1,2,3-triazole compounds (4a, b by 1,3-dipolar cycloaddition, involving compound (3 and terminal acetylenes (phenylacetylene, a and glycoside (b using Cu(OAc2 and ascorbate, under argon atmosphere. During the second step, 2,3-dibromo-1,4-naphthoquinone was prepared using Br2/CH2Cl2 at room temperature. From compound (5 it was possible to synthesize (6, catalyzed by Pd(PPh32Cl2/CuI/Et3N, under argon atmosphere, in 40% yield. The 1,3-dipolar cycloaddition reactions involving 2-azido-1,4-naphthoquinone (3 and alkynes (a, yield 23% and b, yield 30% were conducted using the solvent system, (1:1 terc-BuOH/H2O/r.t/ 20 mol% of Cu(OAc2 and sodium ascorbate, under stirring during 24 hours. The reaction involving 2,3-dibromo-1,4-naphthoquinone (5, yield 65% and phenylacetylene was prepared using the solvent mixture (2:1 DMSO/CHCl3 and catalytic amount of CuI/Pd(PPh32Cl2. The final products were characterized by elemental analysis and spectrometric techniques (IR, NMR 1H and 13C. Two novel triazole compounds were synthesized from naphthoquinones by 1,3-dipolar cycloaddition from suitable 1,4-naphthoquinones obtained by Sonogashira couplings.

  8. 42 CFR 442.2 - Terms.

    Science.gov (United States)

    2010-10-01

    ... ASSISTANCE PROGRAMS STANDARDS FOR PAYMENT TO NURSING FACILITIES AND INTERMEDIATE CARE FACILITIES FOR THE MENTALLY RETARDED General Provisions § 442.2 Terms. In this part— Facility refers to a nursing facility..., harm, impairment, or death to an individual receiving care in a facility. New admission means the...

  9. 40 CFR 442.40 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... TRANSPORTATION EQUIPMENT CLEANING POINT SOURCE CATEGORY Tanks Transporting Food Grade Cargos § 442.40 Applicability. This subpart applies to discharges resulting from the cleaning of tank trucks, intermodal tank containers, rail tank cars, tank barges and ocean/sea tankers which have been used to transport food grade...

  10. Synthesis of substituted mono- and diindole C-nucleoside analogues from sugar terminal alkynes by sequential sonogashira/heteroannulation reaction.

    Science.gov (United States)

    Zhang, Fuyi; Mu, Delong; Wang, Liming; Du, Pengfei; Han, Fen; Zhao, Yufen

    2014-10-17

    The synthesis of substituted mono- and diindole C-nucleoside analogues has been achieved in good to excellent yields by sequential Sonogashira coupling/NaAuCl4-catalyzed heteroannulation reactions of substituted 2-iodoanilines with various sugar terminal alkynes in one pot. The method is general, mild, and efficient and suitable for a wide range of sugar substrates, and 42 examples are given. The amino group of the substituted 2-iodoanilines is unprotected. The sugar terminal alkynes include furanosides, pyranosides, and acyclic glycosides with free hydroxyl groups, sensitive functional subtituents, and various protecting groups having different steric hindrance.

  11. A facile stereospecific synthesis of (Z)-2-sulfonyl-substituted 1,3-enynes via Sonogashira coupling of (E)-α-iodovinyl sulfones with 1-alkynes

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    (E)-α-Iodovinyl sulfones 1 underwent the Sonogashira coupling reactions with terminal alkynes 2 in piperidine at room temperature in the presence of 5 mol% of Pd(PPh3)4 and 10 mol% of CuI to stereospecifically afford the corresponding (Z)-2-sulfonyl-substituted 1,3-enynes 3 in high yields.(C) 2007 Ming Zhong Cai. Published by Elsevier B.V. on behalf of Chinese Chemical Society. All rights reserved.

  12. 7 CFR 1980.442 - Feasibility studies.

    Science.gov (United States)

    2010-01-01

    ... management, nature and extent of market area, marketing plans for sale of projected output, extent of... Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS...) PROGRAM REGULATIONS (CONTINUED) GENERAL Business and Industrial Loan Program § 1980.442 Feasibility...

  13. Sonogashira Reaction of Aryl and Heteroaryl Halides with Terminal Alkynes Catalyzed by a Highly Efficient and Recyclable Nanosized MCM-41 Anchored Palladium Bipyridyl Complex

    Directory of Open Access Journals (Sweden)

    Chung-Yuan Mou

    2010-12-01

    Full Text Available A heterogeneous catalyst, nanosized MCM-41-Pd, was used to catalyze the Sonogashira coupling of aryl and heteroaryl halides with terminal alkynes in the presence of CuI and triphenylphosphine. The coupling products were obtained in high yields using low Pd loadings to 0.01 mol%, and the nanosized MCM-41-Pd catalyst was recovered by centrifugation of the reaction solution and re-used in further runs without significant loss of reactivity.

  14. Wind Turbine Generator System Power Performance Test Report for the ARE442 Wind Turbine

    Energy Technology Data Exchange (ETDEWEB)

    van Dam, J.; Jager, D.

    2010-02-01

    This report summarizes the results of a power performance test that NREL conducted on the ARE 442 wind turbine. This test was conducted in accordance with the International Electrotechnical Commission's (IEC) standard, Wind Turbine Generator Systems Part 12: Power Performance Measurements of Electricity Producing Wind Turbines, IEC 61400-12-1 Ed.1.0, 2005-12. However, because the ARE 442 is a small turbine as defined by IEC, NREL also followed Annex H that applies to small wind turbines. In these summary results, wind speed is normalized to sea-level air density.

  15. Maternal mood and concordant maternal and infant salivary cortisol during heel lance while in kangaroo care.

    Science.gov (United States)

    Castral, T C; Warnock, F; Dos Santos, C B; Daré, M F; Moreira, A C; Antonini, S R R; Scochi, C G S

    2015-03-01

    Maternal kangaroo care (MKC) is a naturalistic intervention that alleviates neonatal pain, and mothers are assumed to play a stress regulatory role in MKC. Yet, no MKC infant pain study has examined relationship between maternal and infant stress reactivity concurrently, or whether post-partum depression and/or anxiety (PPDA) alters maternal and neonatal stress response and the regulatory effects of MKC. To examine the concordance of salivary cortisol reactivity between 42 mothers and their stable preterm infants during routine infant heel lance (HL) while in MKC and to compare salivary cortisol between groups of mothers with and without PPDA and their infants. Maternal and infant salivary cortisol samples were collected pre-HL and 20 min post-HL with two additional maternal samples at night and in the morning. Mothers and infants were allocated to with PPDA versus without PPDA study groups on the basis of maternal post-natal mental health assessment scores. Higher mothers' cortisol pre-HL was weakly associated with higher infants' salivary cortisol in response to the HL procedure. Maternal depression and/or anxiety were not associated with infants' cortisol. During HL, both groups of mothers and infants showed no change in salivary cortisol. Concordance between mother and infant salivary cortisol supports the maternal stress regulatory role in MKC. MKC may have stress regulatory benefits for mothers and their preterm infants during HL independent of PPDA. Future MKC studies that target mothers with altered mood will help to build on these findings. © 2014 European Pain Federation - EFIC®

  16. Effect of equal channel angular pressing on in vitro degradation of LAE442 magnesium alloy

    Energy Technology Data Exchange (ETDEWEB)

    Minárik, Peter, E-mail: peter.minarik@mff.cuni.cz [Department of Physics of Materials, Faculty of Mathematics and Physics, Charles University, Ke Karlovu 5, 121 16 Prague 2 (Czech Republic); Jablonská, Eva [Department of Biochemistry and Microbiology, University of Chemistry and Technology Prague, Technická 5, 166 28 Prague 6 (Czech Republic); Král, Robert [Department of Physics of Materials, Faculty of Mathematics and Physics, Charles University, Ke Karlovu 5, 121 16 Prague 2 (Czech Republic); Lipov, Jan; Ruml, Tomáš [Department of Biochemistry and Microbiology, University of Chemistry and Technology Prague, Technická 5, 166 28 Prague 6 (Czech Republic); Blawert, Carsten [Helmholtz-Zentrum Geesthacht, Zentrum für Material- und Küstenforschung GmbH, Institut für Werkstoffforschung, Max-Planck-Straße 1, Geesthacht (Germany); Hadzima, Branislav [University of Žilina, Univerzitná 8215/1, 010 26 Žilina (Slovakia); Chmelík, František [Department of Physics of Materials, Faculty of Mathematics and Physics, Charles University, Ke Karlovu 5, 121 16 Prague 2 (Czech Republic)

    2017-04-01

    Effect of processing by equal channel angular pressing (ECAP) on the degradation behaviour of extruded LAE442 magnesium alloy was investigated in a 0.1 M NaCl solution, Kirkland's biocorrosion medium (KBM) and Minimum Essential Medium (MEM), both with and without 10% of foetal bovine serum (FBS). Uniform degradation of as extruded and ECAP processed samples in NaCl solution was observed, nevertheless higher corrosion resistance was found in the latter material. The increase of corrosion resistance due to ECAP was observed also after 14-days immersion in all media used. Higher compactness of the corrosion layer formed on the samples after ECAP was responsible for the observed decrease of corrosion resistance, which was proven by scanning electron microscope investigation. Lower corrosion rate in media with FBS was observed and was explained by additional effect of protein incorporation on the corrosion layer stability. A cytotoxicity test using L929 cells was carried out to investigate possible effect of processing on the cell viability. Sufficient cytocompatibility of the extruded samples was observed with no adverse effects of the subsequent ECAP processing. In conclusion, this in vitro study proved that the degradation behaviour of the LAE442 alloy could be improved by subsequent ECAP processing and this material is a good candidate for future in vivo investigation. - Highlights: • ECAP processing decelerates the corrosion rate of the LAE442 magnesium alloy. • Corrosion layers formed on the samples after ECAP have higher compactness. • No cytotoxic effect of extracts prepared from LAE442 after both types of processing was observed.

  17. Effect of equal channel angular pressing on in vitro degradation of LAE442 magnesium alloy

    International Nuclear Information System (INIS)

    Minárik, Peter; Jablonská, Eva; Král, Robert; Lipov, Jan; Ruml, Tomáš; Blawert, Carsten; Hadzima, Branislav; Chmelík, František

    2017-01-01

    Effect of processing by equal channel angular pressing (ECAP) on the degradation behaviour of extruded LAE442 magnesium alloy was investigated in a 0.1 M NaCl solution, Kirkland's biocorrosion medium (KBM) and Minimum Essential Medium (MEM), both with and without 10% of foetal bovine serum (FBS). Uniform degradation of as extruded and ECAP processed samples in NaCl solution was observed, nevertheless higher corrosion resistance was found in the latter material. The increase of corrosion resistance due to ECAP was observed also after 14-days immersion in all media used. Higher compactness of the corrosion layer formed on the samples after ECAP was responsible for the observed decrease of corrosion resistance, which was proven by scanning electron microscope investigation. Lower corrosion rate in media with FBS was observed and was explained by additional effect of protein incorporation on the corrosion layer stability. A cytotoxicity test using L929 cells was carried out to investigate possible effect of processing on the cell viability. Sufficient cytocompatibility of the extruded samples was observed with no adverse effects of the subsequent ECAP processing. In conclusion, this in vitro study proved that the degradation behaviour of the LAE442 alloy could be improved by subsequent ECAP processing and this material is a good candidate for future in vivo investigation. - Highlights: • ECAP processing decelerates the corrosion rate of the LAE442 magnesium alloy. • Corrosion layers formed on the samples after ECAP have higher compactness. • No cytotoxic effect of extracts prepared from LAE442 after both types of processing was observed.

  18. General and efficient one-pot synthesis of novel sugar/heterocyclic(aryl) 1,2-diketones from sugar terminal alkynes by Sonogashira/tetra-n- butylammonium permanganate oxidation.

    Science.gov (United States)

    Zhang, Fuyi; Wu, Xiaopei; Wang, Liming; Liu, Hong; Zhao, Yufen

    2015-11-19

    A new approach for one-pot synthesis of novel sugar/heterocyclic(aryl) 1,2-diketones has been achieved by the reaction of various sugar terminal alkynes with heterocyclic(aryl) iodides at room temperature. This one-pot protocol includes Sonogashira coupling and mild n-Bu4NMnO4 oxidation reaction. This method is mild, general and efficient. Fifty-six examples have been given and the sugar/heterocyclic(aryl) 1,2-diketones were obtained in 71-94% yields. The sugar terminal alkynes include 9 structurally different sugars in pyranose, furanose, and acyclic form which have various protecting groups, sensitive groups, and sterically bulky substituents. The heterocyclic(aryl) iodides include sterically bulky heterocyclic compounds and iodobenzenes with electron-donating, electron-neutral, and electron-withdrawing substituents. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. Nanopartículas de paladio soportadas en hidroxisales laminares: uso potencial en reacciones de Sonogashira

    Directory of Open Access Journals (Sweden)

    Cristian Camilo Giraldo Londoño

    2017-05-01

    Full Text Available En este artículo se reporta la síntesis de nanopartículas de paladio soportadas en hidroxisales de acetato de zinc y modificadas con un surfactante (LHS-Zn-Ac/Pd0 y LHS-Zn-Suf/Pd0 respectivamente, mediante inserción de [PdCl4]2- y su posterior reducción con etanol en reflujo. Con la inserción de surfactante, la distancia interlaminar de la hidroxisal de partida (LHS-Zn-Ac se incrementó de 13,8 Å a 29,8 Å, mientras que los materiales finales, que contenían paladio metálico registraron distancias interlaminares de 22,4 Å y 29,4 Å para LHS-Zn-Ac/Pd0 y LHS-Zn-Suf/Pd0 respectivamente. Las hidroxisales de acetato de zinc y de surfactante con nanopartículas metálicas de paladio incorporadas fueron ensayadas como potenciales catalizadores en la reacción de Sonogashira partiendo de fenilacetileno y yoduros de arilo, particularmente yodobenceno o 2-yodofenol, dando lugar a difenilacetileno (32% de rendimiento de producto aislado y purificado o 2-fenilbenzofurano (18%. Todos los materiales inorgánicos fueron caracterizados mediante las siguientes técnicas: difracción de rayos X (XRD, microscopia electrónica de barrido (SEM y SEM-EDS, microscopia electrónica de transmisión (TEM y espectroscopía de Infrarrojo con Transformada de Fourier (FT-IR. Por su parte los compuestos orgánicos se caracterizaron por resonancia magnética nuclear (1H-NMR y 13C-NMR y cromatografía de gases acoplada a espectrometría de masas (GC-MS.

  20. SDF7, a group of Scoparia dulcis Linn. derived flavonoid compounds, stimulates glucose uptake and regulates adipocytokines in 3T3-F442a adipocytes.

    Science.gov (United States)

    Beh, Joo Ee; Khoo, Li Teng; Latip, Jalifah; Abdullah, Mohd Paud; Alitheen, Noorjahan Baru Mohamed; Adam, Zainah; Ismail, Amin; Hamid, Muhajir

    2013-10-28

    Adipocytes are major tissues involved in glucose uptake second to skeletal muscle and act as the main adipocytokines mediator that regulates glucose uptake mechanism and cellular differentiation. The objective of this study were to examine the effect of the SDF7, which is a fraction consists of four flavonoid compounds (quercetin: p-coumaric acid: luteolin: apigenin=8: 26: 1: 3) from Scoparia dulcis Linn., on stimulating the downstream components of insulin signalling and the adipocytokines expression on different cellular fractions of 3T3-F442a adipocytes. Morphology and lipid accumulation of differentiated 3T3-F442a adipocytes by 100 nM insulin treated with different concentrations of SDF7 and rosiglitazone were examined followed by the evaluation of glucose uptake activity expressions of insulin signalling downstream components (IRS-1, PI3-kinase, PKB, PKC, TC10 and GLUT4) from four cellular fractions (plasma membrane, cytosol, high density microsome and low density microsome). Next, the expression level of adipocytokines (TNF-α, adiponectin and leptin) and immunoblotting of treated 3T3-F442 adipocytes was determined at 30 min and 480 min. Glucose transporter 4 (GLUT4) translocation of 3T3-F442a adipocytes membrane was also determined. Lastly, mRNA expression of adiponectin and PPAR-γ of 3T3-F442a adipocytes were induced and compared with basal concentration. It was found that SDF7 was able to induce adipocytes differentiation with great extends of morphological changes, lipid synthesis and lipid stimulation in vitro. SDF7 stimulation of glucose transport on 3T3-F442a adipocytes are found to be dose independent, time-dependent and plasma membrane GLUT4 expression-dependent. Moreover, SDF7 are observed to be able to suppress TNF-α and leptin expressions that were mediated by 3T3-F442a adipocytes, while stimulated adiponectin secretion on the cells. There was a significant expression (p<0.01) of protein kinase C and small G protein TC10 on 3T3-F442a adipocytes

  1. 9 CFR 442.3 - Scale requirements for accurate weights, repairs, adjustments, and replacements after inspection.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Scale requirements for accurate... PROCEDURES AND REQUIREMENTS FOR ACCURATE WEIGHTS § 442.3 Scale requirements for accurate weights, repairs, adjustments, and replacements after inspection. (a) All scales used to determine the net weight of meat and...

  2. Fulltext PDF

    Indian Academy of Sciences (India)

    Admin

    demise of Prof. M K Chandrashekaran, former chief editor of the journal. MKC, as he was fondly referred to by his students and friends, passed away on July 2 after ... Nehru Centre for Advanced Scientific Research, Bangalore, when ... to Germany, MKC accepted a faculty position at the newly founded School of Biological.

  3. PKC signaling regulates drug resistance of the fungal pathogen Candida albicans via circuitry comprised of Mkc1, calcineurin, and Hsp90.

    Directory of Open Access Journals (Sweden)

    Shantelle L LaFayette

    2010-08-01

    Full Text Available Fungal pathogens exploit diverse mechanisms to survive exposure to antifungal drugs. This poses concern given the limited number of clinically useful antifungals and the growing population of immunocompromised individuals vulnerable to life-threatening fungal infection. To identify molecules that abrogate resistance to the most widely deployed class of antifungals, the azoles, we conducted a screen of 1,280 pharmacologically active compounds. Three out of seven hits that abolished azole resistance of a resistant mutant of the model yeast Saccharomyces cerevisiae and a clinical isolate of the leading human fungal pathogen Candida albicans were inhibitors of protein kinase C (PKC, which regulates cell wall integrity during growth, morphogenesis, and response to cell wall stress. Pharmacological or genetic impairment of Pkc1 conferred hypersensitivity to multiple drugs that target synthesis of the key cell membrane sterol ergosterol, including azoles, allylamines, and morpholines. Pkc1 enabled survival of cell membrane stress at least in part via the mitogen activated protein kinase (MAPK cascade in both species, though through distinct downstream effectors. Strikingly, inhibition of Pkc1 phenocopied inhibition of the molecular chaperone Hsp90 or its client protein calcineurin. PKC signaling was required for calcineurin activation in response to drug exposure in S. cerevisiae. In contrast, Pkc1 and calcineurin independently regulate drug resistance via a common target in C. albicans. We identified an additional level of regulatory control in the C. albicans circuitry linking PKC signaling, Hsp90, and calcineurin as genetic reduction of Hsp90 led to depletion of the terminal MAPK, Mkc1. Deletion of C. albicans PKC1 rendered fungistatic ergosterol biosynthesis inhibitors fungicidal and attenuated virulence in a murine model of systemic candidiasis. This work establishes a new role for PKC signaling in drug resistance, novel circuitry through which

  4. AcEST: DK949530 [AcEST

    Lifescience Database Archive (English)

    Full Text Available L + R+ID G Sbjct: 451 PRTRFGAFARGAKVVLYTKKSGAHLRIIDGG 481 >sp|Q9NQ79|CRAC1_HUMAN Cartilage acidic protein 1 OS=Homo sapiens GN=CRTAC1...ovel protein similar to H.sapiens CRTAC1... 146 1e-33 tr|B6MKC0|B6MKC0_BRAFL Putative uncharacterized protei

  5. VizieR Online Data Catalog: BD+46 442 optical spectra (Bollen+, 2017)

    Science.gov (United States)

    Bollen, D.; van Winckel, H.; Kamath, D.

    2017-08-01

    Reduced high-resolution (R~85000) optical spectra of BD+46 442. These 104 spectra were obtained between July 2009 and January 2016 from the HERMES spectrograph, mounted on the 1.2m Flemish Mercator telescope at La Palma, Canary Islands, Spain. The spectra cover a wavelength range from 3770 to 9000 angstrom in logscale. The flux is given in arbitrary units. The spectra are collected as FITS files. The numbering of the spectra corresponds to the numbering in Table B.1 in the article (e.g. spec_15.fits corresponds to N=15). (2 data files).

  6. Jet creation in post-AGB binaries: the circum-companion accretion disk around BD+46°442

    Science.gov (United States)

    Bollen, Dylan; Van Winckel, Hans; Kamath, Devika

    2017-11-01

    Aims: We aim at describing and understanding binary interaction processes in systems with very evolved companions. Here, we focus on understanding the origin and determining the properties of the high-velocity outflow observed in one such system. Methods: We present a quantitative analysis of BD+46°442, a post-AGB binary that shows active mass transfer that leads to the creation of a disk-driven outflow or jet. We obtained high-resolution optical spectra from the HERMES spectrograph, mounted on the 1.2 m Flemish Mercator Telescope. By performing a time-series analysis of the Hα profile, we identified the different components of the system. We deduced the jet geometry by comparing the orbital phased data with our jet model. In order to image the accretion disk around the companion of BD+46°442, we applied the technique of Doppler tomography. Results: The orbital phase-dependent variations in the Hα profile can be related to an accretion disk around the companion, from which a high-velocity outflow or jet is launched. Our model shows that there is a clear correlation between the inclination angle and the jet opening angle. The latitudinally dependent velocity structure of our jet model shows a good correspondence to the data, with outflow velocities higher than at least 400 km s-1. The intensity peak in the Doppler map might be partly caused by a hot spot in the disk, or by a larger asymmetrical structure in the disk. Conclusions: We show that BD+46°442 is a result of a binary interaction channel. The origin of the fast outflow in this system might be to a gaseous disk around the secondary component, which is most likely a main-sequence star. Our analysis suggests that the outflow has a rather wide opening angle and is not strongly collimated. Our time-resolved spectral monitoring reveals the launching site of the jet in the binary BD+46°442. Similar orbital phase-dependent Hα profiles are commonly observed in post-AGB binaries. Post-AGB binaries provide ideal

  7. Uncertainty analysis of the SWEPP PAN assay system for glass waste (content codes 440, 441 and 442)

    International Nuclear Information System (INIS)

    Blackwood, L.G.; Harker, Y.D.; Meachum, T.R.; Yoon, W.Y.

    1996-10-01

    INEL is being used as a temporary storage facility for transuranic waste generated by the Nuclear Weapons program at the Rocky Flats Plant. Currently, there is a large effort in progress to prepare to ship this waste to WIPP. In order to meet the TRU Waste Characterization Quality Assurance Program Plan nondestructive assay compliance requirements and quality assurance objectives, it is necessary to determine the total uncertainty of the radioassay results produced by the Stored Waste Examination Pilot Plant (SWEPP) Passive Action Neutron (PAN) radioassay system. This paper discusses a modified statistical sampling and verification approach used to determine the total uncertainty of SWEPP PAN measurements for glass waste (content codes 440, 441, and 442) contained in 208 liter drums. In the modified statistical sampling and verification approach, the total performance of the SWEPP PAN nondestructive assay system for specifically selected waste conditions is simulated using computer models. A set of 100 cases covering the known conditions exhibited in glass waste was compiled using a combined statistical sampling and factorial experimental design approach. Parameter values assigned in each simulation were derived from reviews of approximately 100 real-time radiography video tapes of RFP glass waste drums, results from previous SWEPP PAN measurements on glass waste drums, and shipping data from RFP where the glass waste was generated. The data in the 100 selected cases form the multi-parameter input to the simulation model. The reported plutonium masses from the simulation model are compared with corresponding input masses. From these comparisons, the bias and total uncertainty associated with SWEPP PAN measurements on glass waste drums are estimated. The validity of the simulation approach is verified by comparing simulated output against results from calibration measurements using known plutonium sources and two glass waste calibration drums

  8. Uncertainty analysis of the SWEPP PAN assay system for glass waste (content codes 440, 441 and 442)

    Energy Technology Data Exchange (ETDEWEB)

    Blackwood, L.G.; Harker, Y.D.; Meachum, T.R.; Yoon, W.Y.

    1996-10-01

    INEL is being used as a temporary storage facility for transuranic waste generated by the Nuclear Weapons program at the Rocky Flats Plant. Currently, there is a large effort in progress to prepare to ship this waste to WIPP. In order to meet the TRU Waste Characterization Quality Assurance Program Plan nondestructive assay compliance requirements and quality assurance objectives, it is necessary to determine the total uncertainty of the radioassay results produced by the Stored Waste Examination Pilot Plant (SWEPP) Passive Action Neutron (PAN) radioassay system. This paper discusses a modified statistical sampling and verification approach used to determine the total uncertainty of SWEPP PAN measurements for glass waste (content codes 440, 441, and 442) contained in 208 liter drums. In the modified statistical sampling and verification approach, the total performance of the SWEPP PAN nondestructive assay system for specifically selected waste conditions is simulated using computer models. A set of 100 cases covering the known conditions exhibited in glass waste was compiled using a combined statistical sampling and factorial experimental design approach. Parameter values assigned in each simulation were derived from reviews of approximately 100 real-time radiography video tapes of RFP glass waste drums, results from previous SWEPP PAN measurements on glass waste drums, and shipping data from RFP where the glass waste was generated. The data in the 100 selected cases form the multi-parameter input to the simulation model. The reported plutonium masses from the simulation model are compared with corresponding input masses. From these comparisons, the bias and total uncertainty associated with SWEPP PAN measurements on glass waste drums are estimated. The validity of the simulation approach is verified by comparing simulated output against results from calibration measurements using known plutonium sources and two glass waste calibration drums.

  9. Crystal structures of three 4-substituted-2,2′-bipyridines synthesized by Sonogashira and Suzuki–Miyaura cross-coupling reactions

    Directory of Open Access Journals (Sweden)

    Thuy Luong Thi Thu

    2017-04-01

    Full Text Available Facile synthetic routes for three 4-substituted 2,2′-bipyridine derivatives, 4-[2-(4-methylphenylethynyl]-2,2′-bipyridine, C19H14N2, (I, 4-[2-(pyridin-3-ylethynyl]-2,2′-bipyridine, C17H11N3, (II, and 4-(indol-4-yl-2,2′-bipyridine, C18H13N3, (III, via Sonogashira and Suzuki–Miyaura cross-coupling reactions, respectively, are described. As indicated by X-ray analysis, the 2,2′-bipyridine core, the ethylene linkage and the substituents of (I and (II are almost planar [dihedral angles between the two ring systems: 8.98 (5 and 9.90 (6° for the two molecules of (I in the asymmetric unit and 2.66 (14° for (II], allowing π-conjugation. On the contrary, in (III, the indole substituent ring is rotated significantly out of the bipyridine plane [dihedral angle = 55.82 (3°], due to steric hindrance. The crystal packings of (I and (II are dominated by π–π interactions, resulting in layers of molecules parallel to (30-2 in (I and columns of molecules along the a axis in (II. The packing of (III exhibits zigzag chains of molecules along the c axis interacting through N—H...N hydrogen bonds and π–π interactions. The contributions of unknown disordered solvent molecules to the diffraction intensities in (II were removed with the SQUEEZE [Spek (2015. Acta Cryst. C71, 9–18] algorithm of PLATON. The given chemical formula and other crystal data do not take into account these solvent molecules.

  10. ANALYTICAL RESULTS OF MOX COLEMANITE CONCRETE SAMPLE PBC-44.2

    Energy Technology Data Exchange (ETDEWEB)

    Best, D.; Cozzi, A.; Reigel, M.

    2012-12-20

    The Mixed Oxide Fuel Fabrication Facility (MFFF) will use colemanite bearing concrete neutron absorber panels credited with attenuating neutron flux in the criticality design analyses and shielding operators from radiation. The Savannah River National Laboratory is tasked with measuring the total density, partial hydrogen density, and partial boron density of the colemanite concrete. Sample PBC-44.2 was received on 9/20/2012 and analyzed. The average total density measured by the ASTM method C 642 was 2.03 g/cm{sup 3}, within the lower bound of 1.88 g/cm3. The average partial hydrogen density was 6.64E-02 g/cm{sup 3} as measured using method ASTM E 1311 and met the lower bound of 6.04E-02 g/cm{sup 3}. The average measured partial boron density was 1.70E-01 g/cm{sup 3} which met the lower bound of 1.65E-01 g/cm{sup 3} measured by the ASTM C 1301 method.

  11. The Mkk2 MAPKK Regulates Cell Wall Biogenesis in Cooperation with the Cek1-Pathway in Candida albicans.

    Directory of Open Access Journals (Sweden)

    Elvira Román

    Full Text Available The cell wall integrity pathway (CWI plays an important role in the biogenesis of the cell wall in Candida albicans and other fungi. In the present work, the C. albicans MKK2 gene that encodes the putative MAPKK of this pathway was deleted in different backgrounds and the phenotypes of the resultant mutants were characterised. We show here that Mkk2 mediates the phosphorylation of the Mkc1 MAPK in response to cell wall assembly interfering agents such as zymolyase or tunicamycin and also to oxidative stress. Remarkably, mkk2 and mkc1 mutants display related but distinguishable- cell wall associated phenotypes and differ in the pattern of MAPK phosphorylation under different stress conditions. mkk2 and mkc1 mutants display an altered expression of GSC1, CEK1 and CRH11 genes at different temperatures. Combined deletion of MKK2 with HST7 supports a cooperative role for the Cek1-mediated and CWI pathways in regulating cell wall architecture under vegetative growth. However, and in contrast to Mkc1, Mkk2 does not seem to play a role in the virulence of C. albicans in the mouse systemic model or the Galleria mellonella model of infection.

  12. Modified Kidner procedure utilizing a Mitek bone anchor.

    Science.gov (United States)

    Dawson, D M; Julsrud, M E; Erdmann, B B; Jacobs, P M; Ringstrom, J B

    1998-01-01

    The recent development of small bone suture anchors has created several potential applications in reconstructive surgery of the foot. Mitek bone anchors are simple to insert, require less aggressive dissection and surgical time than reefing of the redundant posterior tibial tendon, and are a reliable method of tendon-to-bone fixation. Mitek bone anchors are an excellent technique for the treatment of redundant tibialis posterior tendon following a modified Kidner procedure. In modified Kidner procedures involving an excessively large os tibiale externum, Mitek anchoring of the redundant tibialis posterior tendon to the navicular bone is an excellent means for secure plication of the posterior tibial tendon in cases involving intraoperative tendon laxity. A description of the Mitek Anchor System and technique of application in a modified Kinder procedure is presented. The purpose of this study was to describe patient satisfaction and long-term clinical outcomes of the modified Kinder procedure with and without the Mitek bone anchoring system. A retrospective study of the modified Kinder procedure was performed with 13 patients being evaluated, seven with Mitek anchoring and six without. The University of Maryland 100-point Painful Foot Center Scoring System was modified to be more specific to the modified Kinder procedure for assessment of subjective long-term results. Patient overall satisfaction was rated good to excellent by 85.6% of patients in the Mitek group and by 100% of patients in the non-Mitek group. Use of the Mitek anchor allowed for quicker postoperative recovery to resumption of ambulation without assistive devices (average of 3 weeks vs. 4.42 weeks) and a quicker return to pain-free ambulation in normal shoegear (average of 4 weeks vs. 6 weeks). Mitek anchoring of the tibialis posterior tendon, theoretically, increases medial arch support as evidenced by 14% of the Mitek group and 67% of the non-Mitek group requiring postoperative orthotics.

  13. Existential contextuality and the models of Meyer, Kent, and Clifton

    International Nuclear Information System (INIS)

    Appleby, D.M.

    2002-01-01

    It is shown that the models recently proposed by Meyer, Kent, and Clifton (MKC) exhibit a novel kind of contextuality, which we term existential contextuality. In this phenomenon it is not simply the pre-existing value but the actual existence of an observable which is context dependent. This result confirms the point made elsewhere, that the MKC models do not, as the authors claim, 'nullify' the Kochen-Specker theorem. It may also be of some independent interest

  14. Wind Turbine Generator System Acoustic Noise Test Report for the ARE 442 Wind Turbine

    Energy Technology Data Exchange (ETDEWEB)

    Huskey, A.; van Dam, J.

    2010-11-01

    This test was conducted on the ARE 442 as part of the U.S. Department of Energy's (DOE's) Independent Testing project. This project was established to help reduce the barriers of wind energy expansion by providing independent testing results for small turbines. In total, five turbines are being tested at the National Wind Technology Center (NWTC) as a part of this project. Acoustic noise testing is one of up to five tests that may be performed on the turbines, including duration, safety and function, power performance, and power quality tests. The acoustic noise test was conducted to the IEC 61400-11 Edition 2.1.

  15. Mutation at codon 442 in the rpoB gene of Mycobacterium leprae does not confer resistance to rifampicin.

    Science.gov (United States)

    Lavania, Mallika; Hena, Abu; Reja, Hasanoor; Nigam, Astha; Biswas, Nibir Kumar; Singh, Itu; Turankar, Ravindra P; Gupta, Ud; Kumar, Senthil; Rewaria, Latika; Patra, Pradip K R; Sengupta, Utpal; Bhattacharya, Basudeb

    2016-03-01

    Rifampicin is the major drug in the treatment of leprosy. The rifampicin resistance of Mycobacterium leprae results from a mutation in the rpoB gene, encoding the β subunit of RNA polymerase. As M. leprae is a non-cultivable organism observation of its growth using mouse food-pad (MFP) is the only Gold Standard assay used for confirmation of "in-vivo" drug resistance. Any mutation at molecular level has to be verified by MFP assay for final confirmation of drug resistance in leprosy. In the present study, M. leprae strains showing a mutation only at codon 442 Gln-His and along with mutation either at codon 424 Val-Gly or at 438 Gln-Val within the Rifampicin Resistance Determining Region (RRDR) confirmed by DNA sequencing and by high resolution melting (HRM) analysis were subjected for its growth in MFP. The M. leprae strain having the new mutation at codon 442 Gln-His was found to be sensitive to all the three drugs and strains having additional mutations at 424 Val-Gly and 438 Gln-Val were conferring resistance with Multi drug therapy (MDT) in MFP. These results indicate that MFP is the gold standard method for confirming the mutations detected by molecular techniques.

  16. Degradation behaviour of LAE442-based plate-screw-systems in an in vitro bone model.

    Science.gov (United States)

    Wolters, Leonie; Besdo, Silke; Angrisani, Nina; Wriggers, Peter; Hering, Britta; Seitz, Jan-Marten; Reifenrath, Janin

    2015-04-01

    The use of absorbable implant materials for fixation after bone fracture helps to avoid a second surgery for implant removal and the risks and costs involved. Magnesium (Mg) is well known as a potential metallic material for degradable implants. The aim of the present in vitro study was to evaluate if degradable LAE442-based magnesium plate-screw-systems are suitable candidates for osteosynthesis implants in load-bearing bones. The corrosion behaviour was tested concerning the influence of different surface treatments, coatings and screw torques. Steel plates and screws of the same size served as control. Plates without special treatment screwed on up to a specified torque of 15cNm or 7cNm, NaOH treated plates (15cNm), magnesium fluoride coated plates (15cNm) and steel plates as control (15cNm) were examined in pH-buffered, temperature-controlled SBF solution for two weeks. The experimental results indicate that the LAE442 plates and screws coated with magnesium fluoride revealed a lower hydrogen evolution in SBF solution as well as a lower weight loss and volume decrease in μ-computed tomography (μCT). The nanoindentation and SEM/EDX measurements at several plate areas showed no significant differences. Summarized, the different screw torques did not affect the corrosion behaviour differently. Also the NaOH treatment seemed to have no essential influence on the degradation kinetics. The plates coated with magnesium fluoride showed a decreased corrosion rate. Hence, it is recommended to consider this coating for the next in vivo study. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. Obese gene expression at in vivo levels by fat pads derived from s.c. implanted 3T3-F442A preadipocytes

    DEFF Research Database (Denmark)

    Mandrup, S; Loftus, T M; MacDougald, O A

    1997-01-01

    3T3-F442A preadipocytes implanted s.c. into athymic mice develop into fat pads that are indistinguishable from normal adipose tissue. Implanted preadipocytes harboring a beta-galactosidase transgene gave rise to fat pads in which almost all adipocytes expressed beta-galactosidase. This finding pr...

  18. Effects of modified penoplasty for concealed penis in children.

    Science.gov (United States)

    Chen, Chao; Li, Ning; Luo, Yi-Ge; Wang, Hong; Tang, Xian-Ming; Chen, Jia-Bo; Dong, Chun-Qiang; Liu, Qiang; Dong, Kun; Su, Cheng; Yang, Ti-Quan

    2016-10-01

    To evaluate the effect of modified penoplasty in the management of concealed penis. We retrospectively reviewed 96 consecutive patients with concealed penis, which had been surgically corrected between July 2013 and July 2015. All patients underwent modified Shiraki phalloplasty. All patients were scheduled for regular follow-up at 1, 3, and 6 months after the surgery. Data on the patients' age, operative time, postoperative complications, and parents' satisfaction grade were collected and analyzed. The mean follow-up period was 17.4 months (range 7-31 months). The mean operative time was 63.2 ± 8.7 min. The mean perpendicular penile length was 1.89 ± 0.77 cm preoperatively and 4.42 ± 0.87 cm postoperatively, with an improved mean length of 2.5 ± 0.68 cm in the flaccid state postoperatively (p penis can achieve maximum utilization of prepuce to assure coverage of the exposed penile shaft. It has fewer complications, achieving marked asthetics, and functional improvement. It is a relatively ideal means for treating concealed penis.

  19. Remaining Sites Verification Package for the 100-F-44:2, Discovery Pipeline Near 108-F Building. Attachment to Waste Site Reclassification Form 2007-006

    International Nuclear Information System (INIS)

    Capron, J.M.

    2008-01-01

    The 100-F-44:2 waste site is a steel pipeline that was discovered in a junction box during confirmatory sampling of the 100-F-26:4 pipeline from December 2004 through January 2005. The 100-F-44:2 pipeline feeds into the 100-F-26:4 subsite vitrified clay pipe (VCP) process sewer pipeline from the 108-F Biology Laboratory at the junction box. In accordance with this evaluation, the confirmatory sampling results support a reclassification of this site to No Action. The current site conditions achieve the remedial action objectives and the corresponding remedial action goals established in the Remaining Sites ROD. The results of confirmatory sampling show that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results also demonstrate that residual contaminant concentrations are protective of groundwater and the Columbia River

  20. Study of e(+)e(-) -> omega chi(cJ) at Center of Mass Energies from 4.21 to 4.42 GeV

    NARCIS (Netherlands)

    Ablikim, M.; Achasov, M. N.; Ai, X. C.; Albayrak, O.; Albrecht, M.; Ambrose, D. J.; Amoroso, A.; An, F. F.; An, Q.; Bai, J. Z.; Ferroli, R. Baldini; Ban, Y.; Bennett, D. W.; Bennett, J. V.; Bertani, M.; Bettoni, D.; Bian, J. M.; Bianchi, F.; Boger, E.; Bondarenko, O.; Boyko, I.; Briere, R. A.; Cai, H.; Cai, X.; Cakir, O.; Calcaterra, A.; Cao, G. F.; Cetin, S. A.; Chang, J. F.; Chelkov, G.; Chen, G.; Chen, H. S.; Chen, H. Y.; Chen, J. C.; Chen, M. L.; Chen, S. J.; Chen, X.; Chen, X. R.; Chen, Y. B.; Cheng, H. P.; Chu, X. K.; Chu, Y. P.; Cibinetto, G.; Cronin-Hennessy, D.; Dai, H. L.; Dai, J. P.; Dedovich, D.; Deng, Z. Y.; Denig, A.; Denysenko, I.; Destefanis, M.; De Mori, F.; Ding, Y.; Dong, C.; Dong, J.; Dong, L. Y.; Dong, M. Y.; Du, S. X.; Duan, P. F.; Fan, J. Z.; Fang, J.; Fang, S. S.; Fang, X.; Fang, Y.; Fava, L.; Feldbauer, F.; Felici, G.; Feng, C. Q.; Fioravanti, E.; Fu, C. D.; Gao, Q.; Gao, Y.; Garzia, I.; Goetzen, K.; Gong, W. X.; Gradl, W.; Greco, M.; Gu, M. H.; Gu, Y. T.; Guan, Y. H.; Guo, A. Q.; Guo, L. B.; Guo, T.; Guo, Y.; Guo, Y. P.; Haddadi, Z.; Hafner, A.; Han, S.; Han, Y. L.; Harris, F. A.; He, K. L.; He, Z. Y.; Held, T.; Heng, Y. K.; Hou, Z. L.; Hu, C.; Hu, H. M.; Hu, J. F.; Hu, T.; Hu, Y.; Huang, G. M.; Huang, G. S.; Huang, H. P.; Huang, J. S.; Huang, X. T.; Huang, Y.; Hussain, T.; Ji, Q.; Ji, Q. P.; Ji, X. B.; Ji, X. L.; Jiang, L. L.; Jiang, L. W.; Jiang, X. S.; Jiao, J. B.; Jiao, Z.; Jin, D. P.; Jin, S.; Johansson, T.; Julin, A.; Kalantar-Nayestanaki, N.; Kang, X. L.; Kang, X. S.; Kavatsyuk, M.; Ke, B. C.; Kliemt, R.; Kloss, B.; Kolcu, O. B.; Kopf, B.; Kornicer, M.; Kuehn, W.; Kupsc, A.; Lai, W.; Lange, J. S.; Lara, M.; Larin, P.; Li, Cheng; Li, C. H.; Li, D. M.; Li, F.; Li, G.; Li, H. B.; Li, J. C.; Li, Jin; Li, K.; Li, K.; Li, P. R.; Li, T.; Li, W. D.; Li, W. G.; Li, X. L.; Li, X. M.; Li, X. N.; Li, X. Q.; Li, Z. B.; Liang, H.; Liang, Y. F.; Liang, Y. T.; Liao, G. R.; Lin, D. X.; Liu, B. J.; Liu, C. L.; Liu, C. X.; Liu, F. H.; Liu, Fang; Liu, Feng; Liu, H. B.; Liu, H. H.; Liu, H. H.; Liu, H. M.; Liu, J.; Liu, J. P.; Liu, J. Y.; Liu, K.; Liu, K. Y.; Liu, L. D.; Liu, Q.; Liu, S. B.; Liu, X.; Liu, X. X.; Liu, Y. B.; Liu, Z. A.; Liu, Zhiqiang; Liu, Zhiqing; Loehner, H.; Lou, X. C.; Lu, H. J.; Lu, J. G.; Lu, R. Q.; Lu, Y.; Lu, Y. P.; Luo, C. L.; Luo, M. X.; Luo, T.; Luo, X. L.; Lv, M.; Lyu, X. R.; Ma, F. C.; Ma, H. L.; Ma, L. L.; Ma, Q. M.; Ma, S.; Ma, T.; Ma, X. N.; Ma, X. Y.; Maas, F. E.; Maggiora, M.; Malik, Q. A.; Mao, Y. J.; Mao, Z. P.; Marcello, S.; Messchendorp, J. G.; Min, J.; Min, T. J.; Mitchell, R. E.; Mo, X. H.; Mo, Y. J.; Moeini, H.; Morales, C. Morales; Moriya, K.; Muchnoi, N. Yu.; Muramatsu, H.; Nefedov, Y.; Nerling, F.; Nikolaev, I. B.; Ning, Z.; Nisar, S.; Niu, S. L.; Niu, X. Y.; Olsen, S. L.; Ouyang, Q.; Pacetti, S.; Patteri, P.; Pelizaeus, M.; Peng, H. P.; Peters, K.; Ping, J. L.; Ping, R. G.; Poling, R.; Pu, Y. N.; Qi, M.; Qian, S.; Qiao, C. F.; Qin, L. Q.; Qin, N.; Qin, X. S.; Qin, Y.; Qin, Z. H.; Qiu, J. F.; Rashid, K. H.; Redmer, C. F.; Ren, H. L.; Ripka, M.; Rong, G.; Ruan, X. D.; Santoro, V.; Sarantsev, A.; Savrie, M.; Schoenning, K.; Schumann, S.; Shan, W.; Shao, M.; Shen, C. P.; Shen, P. X.; Shen, X. Y.; Sheng, H. Y.; Shepherd, M. R.; Song, W. M.; Song, X. Y.; Sosio, S.; Spataro, S.; Spruck, B.; Sun, G. X.; Sun, J. F.; Sun, S. S.; Sun, Y. J.; Sun, Y. Z.; Sun, Z. J.; Sun, Z. T.; Tang, C. J.; Tang, X.; Tapan, I.; Thorndike, E. H.; Tiemens, M.; Toth, D.; Ullrich, M.; Uman, I.; Varner, G. S.; Wang, B.; Wang, B. L.; Wang, D.; Wang, D. Y.; Wang, K.; Wang, L. L.; Wang, L. S.; Wang, M.; Wang, P.; Wang, P. L.; Wang, Q. J.; Wang, S. G.; Wang, W.; Wang, X. F.; Wang, Y. D.; Wang, Y. F.; Wang, Y. Q.; Wang, Z.; Wang, Z. G.; Wang, Z. H.; Wang, Z. Y.; Wei, D. H.; Wei, J. B.; Weidenkaff, P.; Wen, S. P.; Wiedner, U.; Wolke, M.; Wu, L. H.; Wu, Z.; Xia, L. G.; Xia, Y.; Xiao, D.; Xiao, Z. J.; Xie, Y. G.; Xiu, Q. L.; Xu, G. F.; Xu, L.; Xu, Q. J.; Xu, Q. N.; Xu, X. P.; Yan, L.; Yan, W. B.; Yan, W. C.; Yan, Y. H.; Yang, H. X.; Yang, L.; Yang, Y.; Yang, Y. X.; Ye, H.; Ye, M.; Ye, M. H.; Yin, J. H.; Yu, B. X.; Yu, C. X.; Yu, H. W.; Yu, J. S.; Yuan, C. Z.; Yuan, W. L.; Yuan, Y.; Yuncu, A.; Zafar, A. A.; Zallo, A.; Zeng, Y.; Zhang, B. X.; Zhang, B. Y.; Zhang, C.; Zhang, C. C.; Zhang, D. H.; Zhang, H. H.; Zhang, H. Y.; Zhang, J. J.; Zhang, J. L.; Zhang, J. Q.; Zhang, J. W.; Zhang, J. Y.; Zhang, J. Z.; Zhang, K.; Zhang, L.; Zhang, S. H.; Zhang, X. J.; Zhang, X. Y.; Zhang, Y.; Zhang, Y. H.; Zhang, Z. H.; Zhang, Z. P.; Zhang, Z. Y.; Zhao, G.; Zhao, J. W.; Zhao, J. Y.; Zhao, J. Z.; Zhao, Lei; Zhao, Ling; Zhao, M. G.; Zhao, Q.; Zhao, Q. W.; Zhao, S. J.; Zhao, T. C.; Zhao, Y. B.; Zhao, Z. G.; Zhemchugov, A.; Zheng, B.; Zheng, J. P.; Zheng, W. J.; Zheng, Y. H.; Zhong, B.; Zhou, L.; Zhou, Li; Zhou, X.; Zhou, X. K.; Zhou, X. R.; Zhou, X. Y.; Zhu, K.; Zhu, K. J.; Zhu, S.; Zhu, X. L.; Zhu, Y. C.; Zhu, Y. S.; Zhu, Z. A.; Zhuang, J.; Zou, B. S.; Zou, J. H.

    2015-01-01

    Based on data samples collected with the BESIII detector at the BEPCII collider at nine center of mass energies from 4.21 to 4.42 GeV, we search for the production of e(+)e(-) -> omega chi(cJ) (J = 0, 1, 2). The process e(+)e(-) -> omega chi(c0) is observed for the first time, and the Born cross

  1. Ring strain and total syntheses of modified macrocycles of the isoplagiochin type

    Directory of Open Access Journals (Sweden)

    Andreas Speicher

    2009-12-01

    Full Text Available Macrocycles of the bisbibenzyl-type are natural products that are found exclusively in bryophytes (liverworts. The molecular framework of the subtype “isoplagiochin” is of substantial structural interest because of the chirality of the entire molecule, which arises from two biaryl axes in combination with two helical two-carbon units in a cyclic arrangement. From a structural as well as a synthetic point of view we report on the total synthesis of compounds which possess more rigid two-carbon biaryl bridges like stilbene (E or Z or even tolane moieties which were introduced starting with a Sonogashira protocol. The McMurry method proved to be a powerful tool for the cyclization to these considerably ring-strained macrocycles.

  2. Degradation behaviour of LAE442-based plate–screw-systems in an in vitro bone model

    International Nuclear Information System (INIS)

    Wolters, Leonie; Besdo, Silke; Angrisani, Nina; Wriggers, Peter; Hering, Britta; Seitz, Jan-Marten; Reifenrath, Janin

    2015-01-01

    The use of absorbable implant materials for fixation after bone fracture helps to avoid a second surgery for implant removal and the risks and costs involved. Magnesium (Mg) is well known as a potential metallic material for degradable implants. The aim of the present in vitro study was to evaluate if degradable LAE442-based magnesium plate–screw-systems are suitable candidates for osteosynthesis implants in load-bearing bones. The corrosion behaviour was tested concerning the influence of different surface treatments, coatings and screw torques. Steel plates and screws of the same size served as control. Plates without special treatment screwed on up to a specified torque of 15 cNm or 7 cNm, NaOH treated plates (15 cNm), magnesium fluoride coated plates (15 cNm) and steel plates as control (15 cNm) were examined in pH-buffered, temperature-controlled SBF solution for two weeks. The experimental results indicate that the LAE442 plates and screws coated with magnesium fluoride revealed a lower hydrogen evolution in SBF solution as well as a lower weight loss and volume decrease in μ-computed tomography (μCT). The nanoindentation and SEM/EDX measurements at several plate areas showed no significant differences. Summarized, the different screw torques did not affect the corrosion behaviour differently. Also the NaOH treatment seemed to have no essential influence on the degradation kinetics. The plates coated with magnesium fluoride showed a decreased corrosion rate. Hence, it is recommended to consider this coating for the next in vivo study. - Highlights: • Mg-based plate screw systems were examined in an in vitro corrosion setup. • Different screw torques did not affect the corrosion behaviour. • Pretreatment with NaOH showed no increase in corrosion resistance. • Fluoride coating slowed down the corrosion rate of plates. • Fluoride coating might be an alternative for decrease of corrosion rate in vivo

  3. Degradation behaviour of LAE442-based plate–screw-systems in an in vitro bone model

    Energy Technology Data Exchange (ETDEWEB)

    Wolters, Leonie [Small Animal Clinic, University of Veterinary Medicine Hannover, Foundation, Bünteweg 9, 30559 Hannover (Germany); Besdo, Silke [Institute of Continuum Mechanics, Leibniz Universität Hannover, Appelstraße 11, 30167 Hannover (Germany); Angrisani, Nina [Small Animal Clinic, University of Veterinary Medicine Hannover, Foundation, Bünteweg 9, 30559 Hannover (Germany); Wriggers, Peter [Institute of Continuum Mechanics, Leibniz Universität Hannover, Appelstraße 11, 30167 Hannover (Germany); Hering, Britta [Institute of Production Engineering and Machine Tools, Leibniz Universität Hannover, An der Universität 2, 30823 Garbsen (Germany); Seitz, Jan-Marten [Institute of Materials Science, Leibniz Universität Hannover, An der Universität 2, 30823 Garbsen (Germany); Reifenrath, Janin, E-mail: janin.reifenrath@tiho-hannover.de [Small Animal Clinic, University of Veterinary Medicine Hannover, Foundation, Bünteweg 9, 30559 Hannover (Germany)

    2015-04-01

    The use of absorbable implant materials for fixation after bone fracture helps to avoid a second surgery for implant removal and the risks and costs involved. Magnesium (Mg) is well known as a potential metallic material for degradable implants. The aim of the present in vitro study was to evaluate if degradable LAE442-based magnesium plate–screw-systems are suitable candidates for osteosynthesis implants in load-bearing bones. The corrosion behaviour was tested concerning the influence of different surface treatments, coatings and screw torques. Steel plates and screws of the same size served as control. Plates without special treatment screwed on up to a specified torque of 15 cNm or 7 cNm, NaOH treated plates (15 cNm), magnesium fluoride coated plates (15 cNm) and steel plates as control (15 cNm) were examined in pH-buffered, temperature-controlled SBF solution for two weeks. The experimental results indicate that the LAE442 plates and screws coated with magnesium fluoride revealed a lower hydrogen evolution in SBF solution as well as a lower weight loss and volume decrease in μ-computed tomography (μCT). The nanoindentation and SEM/EDX measurements at several plate areas showed no significant differences. Summarized, the different screw torques did not affect the corrosion behaviour differently. Also the NaOH treatment seemed to have no essential influence on the degradation kinetics. The plates coated with magnesium fluoride showed a decreased corrosion rate. Hence, it is recommended to consider this coating for the next in vivo study. - Highlights: • Mg-based plate screw systems were examined in an in vitro corrosion setup. • Different screw torques did not affect the corrosion behaviour. • Pretreatment with NaOH showed no increase in corrosion resistance. • Fluoride coating slowed down the corrosion rate of plates. • Fluoride coating might be an alternative for decrease of corrosion rate in vivo.

  4. 1-, 2-, and 4-Ethynylpyrenes in the Structure of Twisted Intercalating Nucleic Acids: Structure, Thermal Stability, and Fluorescence Relationship

    DEFF Research Database (Denmark)

    Filichev, Vyacheslav V; Astakhova, Irina V.; Malakhov, Andrei D.

    2008-01-01

    to ortho in homopyrimidine TINAs. Thus, for para-TINAs the bulge insertion of an intercalator led to high thermal stability of Hoogsteen-type parallel triplexes and duplexes, whereas Watson-Cricktype duplexes were destabilized. In the case of ortho-TINA, both Hoogsteen and Watson-Crick-type complexes were......A postsynthetic, on-column Sonogashira reaction was applied on DNA molecules modified by 2- or 4-iodophenylmethylglycerol in the middle of the sequence, to give the corresponding ortho- and para-twisted intercalating nucleic acids (TINA) with 1-, 2-, and 4-ethynylpyrene residues. The convenient...

  5. PIE on Safety-Tested Loose Particles from Irradiated Compact 4-4-2

    Energy Technology Data Exchange (ETDEWEB)

    Hunn, John D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Gerczak, Tyler J. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Morris, Robert Noel [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Baldwin, Charles A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Montgomery, Fred C. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States)

    2016-04-01

    Post-irradiation examination (PIE) is being performed in support of tristructural isotropic (TRISO) coated particle fuel development and qualification for High Temperature Gas-cooled Reactors (HTGRs). This work is sponsored by the Department of Energy Office of Nuclear Energy (DOE-NE) through the Advanced Reactor Technologies (ART) Office under the Advanced Gas Reactor Fuel Development and Qualification (AGR) Program. The AGR-1 experiment was the first in a series of TRISO fuel irradiation tests initiated in 2006. The AGR-1 TRISO particles and fuel compacts were fabricated at Oak Ridge National Laboratory (ORNL) in 2006 using laboratory-scale equipment and irradiated for 3 years in the Advanced Test Reactor (ATR) at Idaho National Laboratory (INL) to demonstrate and evaluate fuel performance under HTGR irradiation conditions. Post-irradiation examination was performed at INL and ORNL to study how the fuel behaved during irradiation, and to test fuel performance during exposure to elevated temperatures at or above temperatures that could occur during a depressurized conduction cooldown event. This report summarizes safety testing and post-safety testing PIE conducted at ORNL on loose particles extracted from irradiated AGR-1 Compact 4-4-2.

  6. Pd@HNTs-CDNS-g-C3N4: A novel heterogeneous catalyst for promoting ligand and copper-free Sonogashira and Heck coupling reactions, benefits from halloysite and cyclodextrin chemistry and g-C3N4 contribution to suppress Pd leaching.

    Science.gov (United States)

    Sadjadi, Samahe; Heravi, Majid M; Malmir, Masoumeh

    2018-04-15

    For the first time, a ternary hybrid system composed of halloysite nanotubes, HNTs, cyclodextrin nanosponges, CDNS, and g-C 3 N 4 is prepared and used for immobilization of Pd(0) nanoparticles and development of a heterogeneous catalyst, Pd@HNTs-CDNS-g-C 3 N 4 for promoting ligand and copper-free Sonogashira and Heck coupling reactions in aqueous media. HNT as a porous tubular clay with outstanding thermal, mechanical and textural properties can act as a support for immobilizing Pd nanoparticles. The role of CDNS can be explained on the base of its capability to form inclusion complexe with substrates and bringing them in the vicinity of the catalytic active sites. Regarding the role of g-C 3 N 4 in catalysis, it is proved that its presence can suppress the Pd leaching dramatically. The contribution of each component as well as synergistic effect between them results in high catalytic activity and recyclability (up to 10 reaction runs) of the catalyst. Copyright © 2018 Elsevier Ltd. All rights reserved.

  7. The influence of bile salts on the distribution of simvastatin in the octanol/buffer system.

    Science.gov (United States)

    Đanić, Maja; Pavlović, Nebojša; Stanimirov, Bojan; Vukmirović, Saša; Nikolić, Katarina; Agbaba, Danica; Mikov, Momir

    2016-01-01

    Distribution coefficient (D) is useful parameter for evaluating drugs permeability properties across biological membranes, which are of importance for drugs bioavailability. Given that bile acids are intensively studied as drug permeation-modifying and -solubilizing agents, the aim of this study was to estimate the influence of sodium salts of cholic (CA), deoxycholic (DCA) and 12-monoketocholic acids (MKC) on distribution coefficient of simvastatin (SV) (lactone [SVL] and acid form [SVA]) which is a highly lipophilic compound with extremely low water solubility and bioavailability. LogD values of SVA and SVL with or without bile salts were measured by liquid-liquid extraction in n-octanol/buffer systems at pH 5 and 7.4. SV concentrations in aqueous phase were determined by HPLC-DAD. Chem3D Ultra program was applied for computation of physico-chemical properties of analyzed compounds and their complexes. Statistically significant decrease in both SVA and SVL logD was observed for all three studied bile salts at both selected pH. MKC exerted the most pronounced effect in the case of SVA while there were no statistically significant differences between observed bile salts for SVL. The calculated physico-chemical properties of analyzed compounds and their complexes supported experimental results. Our data indicate that the addition of bile salts into the n-octanol/buffer system decreases the values of SV distribution coefficient at both studied pH values. This may be the result of the formation of hydrophilic complexes increasing the solubility of SV that could consequently impact the pharmacokinetic parameters of SV and the final drug response in patients.

  8. Microencapsulation of alginate-immobilized bagasse with Lactobacillus rhamnosus NRRL 442: enhancement of survivability and thermotolerance.

    Science.gov (United States)

    Shaharuddin, Shahrulzaman; Muhamad, Ida Idayu

    2015-03-30

    The aim of this research was to enhance the survivability of Lactobacillus rhamnosus NRRL 442 against heat exposure via a combination of immobilization and microencapsulation processes using sugarcane bagasse (SB) and sodium alginate (NaA), respectively. The microcapsules were synthesized using different alginate concentration of 1, 2 and 3% and NaA:SB ratio of 1:0, 1:1 and 1:1.5. This beneficial step of probiotic immobilization before microencapsulation significantly enhanced microencapsulation efficiency and cell survivability after heat exposure of 90°C for 30s. Interestingly, the microcapsule of SB-immobilized probiotic could obtain protection from heat using microencapsulation of NaA concentration as low as 1%. SEM images illustrated the incorporation of immobilized L. rhamnosus within alginate matrices and its changes after heat exposure. FTIR spectra confirmed the change in functional bonding in the presence of sugarcane bagasse, probiotic and alginate. The results demonstrated a great potential in the synthesis of heat resistant microcapsules for probiotic. Copyright © 2014 Elsevier Ltd. All rights reserved.

  9. Synthesis and optoelectronic characterization of some triphenylamine-based compounds containing strong acceptor substituents

    Energy Technology Data Exchange (ETDEWEB)

    Grigoras, Mircea, E-mail: grim@icmpp.ro; Ivan, Teofilia; Vacareanu, Loredana; Catargiu, Ana Maria; Tigoianu, Radu

    2014-09-15

    Three novel triphenylamine-based compounds containing strong electron acceptor groups have been synthesized and their comparative photophysical properties are presented. These compounds were obtained by a two-step method: (i) triphenylamine compounds with one, two and three phenylacetylene arms were synthesized by Sonogashira reaction between iodine-substituted triphenylamines and phenylacetylene, followed by (ii) post-modification of these electron-rich alkynes by addition of the strong electron acceptor, tetracyanoethylene. Characterization of all oligomers was made by FTIR, {sup 1}H-NMR, UV–vis and fluorescence spectroscopy. A batochromic shifting of the UV and photoluminescence maxima was observed with the increase of the acceptor group number. The electrochemical behavior was studied by cyclic voltammetry. The cyclic voltammograms have evidenced that triphenylamine-phenylacetylene compounds undergo only oxidation processes while compounds modified with tetracyanoethylene show both oxidation and reduction peaks associated with donor and acceptor groups, respectively. The donor–acceptor compounds coordinate metal ions (i.e., Hg{sup 2+} and Sn{sup 2+}) by cyano groups resulting in the decreasing of charge transfer band intensity, and they can be used as chemosensors. - Highlights: • Three triphenylamine-based ethynylene compounds were prepared by Sonogashira reaction. • Post-modification of ethynylene linkages by tetracyanethylene cycloaddition and retroconversion led to donor–acceptor compounds. • Photophysical properties of donor–acceptor oligomers were studied in different solvents.

  10. African Journal of Environmental Science and Technology - Vol 4 ...

    African Journals Online (AJOL)

    Increase in healthcare facilities and rapid environmental degradation: A technological paradox in Nigeria's urban centres · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. A Coker, MKC Sridhar, 577-585 ...

  11. Donor-Acceptor Chromophores based on Acetylenic Scaffolds and Indenofluorenes

    DEFF Research Database (Denmark)

    Christensen, Mikkel Andreas

    -valence salt). [BILLEDE UDELADT] In the third chapter the reactivity of chloroalkynes is explored. A number of chloroalkynes is prepared and subjected to palladium-catalyzed cross coupling with a terminal alkyne. The chloroalkynes turned out to couple very well using the same conditions as for the Sonogashira...... cross-coupling. The reactivity of chloroalkynes was compared to that of Sonogashira substrates and the chloroalkynes turned out to react as fast as an aryl iodide. Some of the couplings gave reductive homo-coupling of the chloroalkyne as a byproducts. This was avoided by using a large copper...

  12. Corrigendum to "Sinusoidal potential cycling operation of a direct ethanol fuel cell to improving carbon dioxide yields" [J. Power Sources 268 (5 December 2014) 439-442

    Science.gov (United States)

    Majidi, Pasha; Pickup, Peter G.

    2016-09-01

    The authors regret that Equation (5) is incorrect and has resulted in errors in Fig. 4 and the efficiencies stated on p. 442. The corrected equation, figure and text are presented below. In addition, the title should be 'Sinusoidal potential cycling operation of a direct ethanol fuel cell to improve carbon dioxide yields', and the reversible cell potential quoted on p. 441 should be 1.14 V. The authors would like to apologise for any inconvenience caused.

  13. Discovery of Variable Hydrogen Balmer Absorption Lines with Inverse Decrement in PG 1411+442

    Energy Technology Data Exchange (ETDEWEB)

    Shi, Xi-Heng; Pan, Xiang; Zhang, Shao-Hua; Sun, Lu-Ming; Ji, Tuo; Liu, Bo; Zhou, Hong-Yan [Polar Research Institute of China, Jinqiao Road 451, Shanghai 200136 (China); Wang, Jian-Guo [Yunnan Observatories, Chinese Academy of Sciences, Kunming, Yunnan 650011 (China); Yang, Chen-Wei; Jiang, Ning, E-mail: zhouhongyan@pric.org.cn, E-mail: shixiheng@pric.org.cn [Key Laboratory for Research in Galaxies and Cosmology, Department of Astronomy, University of Science and Technology of China, Chinese Academy of Sciences, Hefei, Anhui 230026 (China)

    2017-07-01

    We present new optical spectra of the well-known broad absorption line (BAL) quasar PG 1411+442, using the DBSP spectrograph at the Palomar 200 inch telescope in 2014 and 2017 and the YFOSC spectrograph at the Lijiang 2.4 m telescope in 2015. A blueshifted narrow absorption line system is clearly revealed in 2014 and 2015 consisting of hydrogen Balmer series and metastable He i lines. The velocity of these lines is similar to the centroid velocity of the UV BALs, suggesting that both originate from the outflow. The Balmer lines vary significantly between the two observations and vanished in 2017. They were also absent in the archived spectra obtained before 2001. The variation is thought to be driven by photoionization change. Besides, the absorption lines show inversed Balmer decrement, i.e., the apparent optical depths of higher-order Balmer absorption lines are larger than those of lower-order lines, which is inconsistent with the oscillator strengths of the transitions. We suggest that such anomalous line ratios can be naturally explained by the thermal structure of a background accretion disk, which allows the obscured part of the disk to contribute differently to the continuum flux at different wavelengths. High-resolution spectroscopic and photometric monitoring would be very useful to probe the structure of the accretion disk as well as the geometry and physical conditions of the outflow.

  14. The problem of contextuality and the impossibility of experimental metaphysics thereof

    Science.gov (United States)

    Hermens, Ronnie

    Recently a new impulse has been given to the experimental investigation of contextuality. In this paper we show that for a widely used definition of contextuality there can be no decisive experiment on the existence of contextuality. To this end, we give a clear presentation of the hidden variable models due to Meyer, Kent and Clifton (MKC), which would supposedly nullify the Kochen-Specker theorem. Although we disagree with this last statement, the models do play a significant role in the discussion on the meaning of contextuality. In fact, we introduce a specific MKC-model of which we show that it is non-contextual and completely in agreement with quantum mechanical predictions. We also investigate the possibility of other definitions of non-contextuality-with an emphasis on operational definitions-and argue that any useful definition relies on the specification of a theoretical framework. It is therefore concluded that no experimental test can yield any conclusions about contextuality on a metaphysical level.

  15. Immobilization of the enzyme {beta}-lactamase by self-assembly on thin films of a poly(phenyleneethynylene) sequenced with flexible segments containing sulfur atoms

    Energy Technology Data Exchange (ETDEWEB)

    Vazquez, Erika [Centro de Investigacion en Quimica Aplicada (CIQA), Blvd. Enrique Reyna 140, 25253, Saltillo (Mexico); Aguilar, Abdieel Esquivel [Centro de Investigacion en Quimica Aplicada (CIQA), Blvd. Enrique Reyna 140, 25253, Saltillo (Mexico); Facultad de Ciencias Quimicas, Universidad Autonoma de Coahuila, Blvd. V. Carranza and Ing. J. Cardenas, 25000 Saltillo (Mexico); Moggio, Ivana [Centro de Investigacion en Quimica Aplicada (CIQA), Blvd. Enrique Reyna 140, 25253, Saltillo (Mexico)]. E-mail: imoggio@ciqa.mx; Arias, Eduardo [Centro de Investigacion en Quimica Aplicada (CIQA), Blvd. Enrique Reyna 140, 25253, Saltillo (Mexico); Romero, Jorge [Centro de Investigacion en Quimica Aplicada (CIQA), Blvd. Enrique Reyna 140, 25253, Saltillo (Mexico); Barrientos, Hector [Centro de Investigacion en Quimica Aplicada (CIQA), Blvd. Enrique Reyna 140, 25253, Saltillo (Mexico); Torres, Jose Roman [Centro de Investigacion en Quimica Aplicada (CIQA), Blvd. Enrique Reyna 140, 25253, Saltillo (Mexico); Luz Reyes Vega, Maria de la [Facultad de Ciencias Quimicas, Universidad Autonoma de Coahuila, Blvd. V. Carranza and Ing. J. Cardenas, 25000 Saltillo (Mexico)

    2007-05-16

    A novel poly(phenyleneethynylene) sequenced in the main conjugated chain with flexible groups containing sulfur atoms has been synthesized by Heck-Sonogashira coupling reaction. Layer-by-layer films of the polymer have been prepared with a linear growth in thickness up to four layers as evidenced by UV-Vis spectroscopy and perfilometry. On the top of these multilayers, the enzyme {beta}-lactamase was deposited by self-assembly. The enzymatic activity was measured by a modified spectrophotometric standard assay method for penicillin G, ampicillin and amoxicillin. A higher and faster activity was obtained for penicillin G and thus preliminary study of the biosensor response by fluorescence was carried out for this antibiotic revealing a decrease in the polymer fluorescence as function of the penicillin G concentration.

  16. Immobilization of the enzyme β-lactamase by self-assembly on thin films of a poly(phenyleneethynylene) sequenced with flexible segments containing sulfur atoms

    International Nuclear Information System (INIS)

    Vazquez, Erika; Aguilar, Abdieel Esquivel; Moggio, Ivana; Arias, Eduardo; Romero, Jorge; Barrientos, Hector; Torres, Jose Roman; Luz Reyes Vega, Maria de la

    2007-01-01

    A novel poly(phenyleneethynylene) sequenced in the main conjugated chain with flexible groups containing sulfur atoms has been synthesized by Heck-Sonogashira coupling reaction. Layer-by-layer films of the polymer have been prepared with a linear growth in thickness up to four layers as evidenced by UV-Vis spectroscopy and perfilometry. On the top of these multilayers, the enzyme β-lactamase was deposited by self-assembly. The enzymatic activity was measured by a modified spectrophotometric standard assay method for penicillin G, ampicillin and amoxicillin. A higher and faster activity was obtained for penicillin G and thus preliminary study of the biosensor response by fluorescence was carried out for this antibiotic revealing a decrease in the polymer fluorescence as function of the penicillin G concentration

  17. Preparation and Application of Immobilized Surfactant-Modified PANi-CNT/TiO2 under Visible-Light Irradiation

    Directory of Open Access Journals (Sweden)

    Ching Yuan

    2017-07-01

    Full Text Available Hydrothermally and sol-gel-synthesized immobilized surfactant-modified polyaniline-carbon nanotubes/TiO2 (PANi-CNT/TiO2 photocatalysts were prepared and their application in the degradation of diethyl phthalate (DEP under visible light at 410 nm was investigated in this sturdy. To improve the dispersion of nanoparticles and the transfer of electrons, the TiO2 surface was modified with both sodium dodecyl sulfate (SDS and functionalized carbon nanotubes (CNT-COOH and CNT-COCl. With the addition of PANi, which was increased from 1%–5%, the adsorption edge of the prepared photocatalysts shifted to 442 nm. The SDS linked the PANi polymers to achieve a thickness of coating of the film of up to 314–400 nm and 1301–1600 nm for sol-gel hydrolysis and hydrothermally-synthesized photocatalysts, respectively. An appropriate film thickness would extend the transfer path of the electrons and inhibit the recombination of the electrons and the electron-holes. The photo-degradation performance of DEP by the hydrothermally-synthesized photocatalysts was better than those by sol-gel hydrolysis. The results revealed that the hydroxyl radicals were the key oxidant in the degradation of DEP using hydrothermally-synthesized PANi-CNT/TiO2 photocatalysts. The morphology and functional groups of the raw materials of photocatalysts were characterized and a comparison of photocatalytic activity with other TiO2-based photocatalysts was also provided.

  18. Multiple roles for nuclear localization signal (NLS, aa 442-472) of receptor interacting protein 3 (RIP3)

    International Nuclear Information System (INIS)

    Li Mei; Feng Shanshan; Wu Mian

    2008-01-01

    RIP3, a Ser/Thr kinase of RIP (Receptor Interacting Protein) family, is recruited to the TNFR1 signaling complex through RIP and has been shown to mediate apoptosis induction and NF-κB activation. RIP3 is a nucleocytoplasmic shuttling protein and its unconventional nuclear localization signal (NLS, 442-472 aa) is sufficient to trigger apoptosis in the nucleus. In this study, we demonstrate that this NLS exhibits several other roles besides apoptotic function. Firstly, this NLS was found to be required for both RIP3-induced apoptosis and RIP3-mediated NF-κB activation. Next, similar to RHIM motif (RIP homotypic interaction motif), NLS of RIP3 was found to be involved in RIP3-RIP interaction. Furthermore, this NLS was found to be both sufficient and necessary for RIP3 self-association. Our primary data also showed that RIP3 might form a homodimer within cells, and its apoptotic activity may not be required for this dimerization, rather the intactness of NLS determines RIP3-induced apoptosis, since a point mutation at amino acid residue 452 (Ile to Ala) within NLS greatly reduced its apoptotic ability, despite that RIP3 point mutant RIP3/I452A is able to dimerize with wild type RIP3 or itself

  19. Hsp90 orchestrates transcriptional regulation by Hsf1 and cell wall remodelling by MAPK signalling during thermal adaptation in a pathogenic yeast.

    Directory of Open Access Journals (Sweden)

    Michelle D Leach

    2012-12-01

    Full Text Available Thermal adaptation is essential in all organisms. In yeasts, the heat shock response is commanded by the heat shock transcription factor Hsf1. Here we have integrated unbiased genetic screens with directed molecular dissection to demonstrate that multiple signalling cascades contribute to thermal adaptation in the pathogenic yeast Candida albicans. We show that the molecular chaperone heat shock protein 90 (Hsp90 interacts with and down-regulates Hsf1 thereby modulating short term thermal adaptation. In the longer term, thermal adaptation depends on key MAP kinase signalling pathways that are associated with cell wall remodelling: the Hog1, Mkc1 and Cek1 pathways. We demonstrate that these pathways are differentially activated and display cross talk during heat shock. As a result ambient temperature significantly affects the resistance of C. albicans cells to cell wall stresses (Calcofluor White and Congo Red, but not osmotic stress (NaCl. We also show that the inactivation of MAP kinase signalling disrupts this cross talk between thermal and cell wall adaptation. Critically, Hsp90 coordinates this cross talk. Genetic and pharmacological inhibition of Hsp90 disrupts the Hsf1-Hsp90 regulatory circuit thereby disturbing HSP gene regulation and reducing the resistance of C. albicans to proteotoxic stresses. Hsp90 depletion also affects cell wall biogenesis by impairing the activation of its client proteins Mkc1 and Hog1, as well as Cek1, which we implicate as a new Hsp90 client in this study. Therefore Hsp90 modulates the short term Hsf1-mediated activation of the classic heat shock response, coordinating this response with long term thermal adaptation via Mkc1- Hog1- and Cek1-mediated cell wall remodelling.

  20. Fulltext PDF

    Indian Academy of Sciences (India)

    I was delighted when the editor of Resonance requested me to review the book Time in the. Living World by M K Chandrashekaran for the journal, of which MKC was the Chief. Editor till December 2005. I am glad that. Professor CNR Rao encouraged him success- fully to write this book, which is an educa-.

  1. Microwave-assisted efficient synthesis of 2-arylbenzo[b]furans and 2 ...

    Indian Academy of Sciences (India)

    ferrocenylbenzo[b]furans from readily prepared propargylic alcohols, ... reported microwave-enhanced Sonogashira coupling and cyclization reactions on alumina,10c but his method needs expensive trimethylsilyl-acetylene as monopro-.

  2. Fulltext PDF

    Indian Academy of Sciences (India)

    I was delighted when the editor of Resonance requested me to review the book Time in the. Living World by M K Chandrashekaran for the journal, of which MKC was the Chief. Editor till December 200S. I am glad that. Professor Rao encouraged him successfully to write this book, which is an educational monograph ...

  3. 4-[4-(2-Etilhekziloksi)benzoiloksi]benzoik asid Sıvı Kristalinin Bazı Çözücülerle Termodinamik Etkileşimleri

    OpenAIRE

    OCAK, Hale; MUTLU, Serap; ÖZTÜRK, Emine; AYGÜN, Özge; BİLGİN ERAN, Belkıs; CANKURTARAN, Özlem; KARAMAN, Ferdane

    2012-01-01

    Bu çalışmada 4-[4-(2-Etilhekziloksi)benzoiloksi]benzoik asid’in n-alkanlar ile termodinamik etkileşimleri ters gaz kromatografi metoduyla incelendi. Çözücülerin alıkonma hacimlerinden, 170oC-195oC sıcaklık aralığında, sonsuz seyreltiklikteki ağırlık kesri aktivite katsayısı, Ω1∞, Flory-Hugginsve hal denklemi etkileşim parametreleri ((X12∞ ve X12*), etkin değişim enerji parametresi X12-, kısmi molar sorpsiyon ısısı, ΔHs-, kısmi molar karışma ısısı, ΔH1∞-, molar buharlaşma ısısı, ΔHv- gibitermo...

  4. The perspectives for genetically modified cellulosic biofuels in the Central European conditions

    Czech Academy of Sciences Publication Activity Database

    Bláhová, P.; Janda, K.; Krištoufek, Ladislav

    2014-01-01

    Roč. 60, č. 6 (2014), s. 247-259 ISSN 0139-570X Grant - others:GA ČR(CZ) GAP402/11/0948 Program:GA Institutional support: RVO:67985556 Keywords : ellulosic biofuels * genetic modifications Subject RIV: AH - Economics Impact factor: 0.442, year: 2014 http://library.utia.cas.cz/separaty/2014/E/kristoufek-0433521.pdf

  5. Synthesis, crystal structure and photophysical properties of (E)-4-(4-(2-hydroxybenzylideneamino)benzyl)oxazolidin-2-one

    International Nuclear Information System (INIS)

    Kumari, Rekha; Varghese, Anitha; George, Louis

    2016-01-01

    A new Schiff base, (4-(benzylideneamino)benzyl)oxazolidin-2-one has been synthesised from 4-(4-aminobenzyl)oxazolidin-2-one and salicylaldehyde by a simple condensation reaction. Single-crystal X-ray analysis of (E)-4-(4-(2-hydroxybenzylideneamino) benzyl)oxazolidin-2-one (HBOA) revealed that there is a 1-D, slipped, face-to-face motif with off-set, head-to-tail stacked columns. Detailed studies on photophysical properties of the synthesised compound in solutions indicate their potential applications in the field of organic light emitting devices and nonlinear optical materials. Absorption and fluorescence study of HBOA has been conducted in a series of solvents with increasing polarity at room temperature. Ground and excited state dipole moments have been determined experimentally by using Lippert–Mataga polarity function, Bakhshiev solvent polarity parameter, Kawskii–Chamma–Viallet solvent polarity parameter and RichardtГ—Віs microscopic solvent polarity parameter. Due to the considerable π-electron density redistribution, the excited state dipole moment was found to be larger than that of the ground state. The ground state dipole moment value was determined by quantum chemical method which was used to estimate excited state dipole moment through solvatochromic correlations. Kamlet–Taft and Catalan methods were used to get the information of both non-specific solute–solvent interactions and hydrogen bonding interactions. TD-DFT (B3LYP/6-311G(d,p)) has been used for the determination of HOMO–LUMO energies. Mulliken charges and Molecular electrostatic potential were also evaluated from DFT calculations.

  6. Novel phosphine-peptide hybrids as selective catalysts

    DEFF Research Database (Denmark)

    Nygaard, David

    (His(Trt), Gln, Gln(Trt), Cys(tBu), Thr(OtBu), azido- Dab, Asp(OtBu), Arg(Pmc))) yielding a range of novel modified peptides. Peptides containing one secondary amine were phosphinylated and captured as either phosphine-boranes or oxides. Both borane and oxide protection of phosphine-peptide hybrids...... was discovered and the compounds were structurally elucidated via NMR and mass spectroscopy. Two of these compounds were incorporated into peptides. An existing method of obtaining peptides containing secondary amines in the peptide backbone have been expanded for incorporation of functional amino acids as well...... palladium chloride dimer did not yield an observable phosphine-palladium complex. A peptide containing two secondary amine sites was synthesized, phosphinylated and complexed to respectively palladium and copper. The palladium complex was utilized successfully as a palladium catalyst in a model Sonogashira...

  7. Synthesis of pyridyl substituted pyrazolo[4,3-c]pyridines as potential inhibitors of protein kinases

    Czech Academy of Sciences Publication Activity Database

    Vilkauskaite, G.; Schaaf, P.; Sackus, A.; Kryštof, Vladimír; Holzer, W.

    -, č. 2 (2014), s. 135-149 ISSN 1551-7004 Institutional support: RVO:61389030 Keywords : Pyrazolones * Sonogashira reaction * multi-component reactions Subject RIV: CC - Organic Chemistry Impact factor: 1.165, year: 2014 http://www.arkat-usa.org/get-file/48428/

  8. Diversity Oriented Synthesis of Natural 2-Arylbenzofuran, Moracin F

    International Nuclear Information System (INIS)

    Yun, So-Ra; Jun, Jong-Gab

    2016-01-01

    Diversity oriented synthesis of natural 2-arylbenzofuran, moracin F (1) has been carried out from the commercially available starting materials using Sonogashira coupling, Suzuki coupling, neutral Al 2 O 3 mediated cyclization, and intramolecular Wittig reaction as key steps.

  9. Planar geometry of 4-substituted-2,2'-bipyridines synthesized by Sonogashira and Suzuki cross-coupling reactions

    Energy Technology Data Exchange (ETDEWEB)

    Luong Thi, T. T., E-mail: thuyltt@hnue.edu.vn; Nguyen Bich, N.; Nguyen, H. [Hanoi National University of Education, Chemistry Department (Viet Nam); Van Meervelt, L., E-mail: luc.vanmeervelt@chem.kuleuven.be [KU Leuven, Chemistry Department (Belgium)

    2015-12-15

    Two 4-substituted 2,2'-bipyridines, namely 4-(ferrocenylethynyl)-2,2'-bipyridine (I) and 4-ferrocenyl-2,2'-bipyridine (II) have been synthesized and fully characterized via single-crystal X-ray diffraction and {sup 1}H and {sup 13}C NMR analyses. The π-conjugated system designed from 2,2'-bipyridine modified with the ferrocenylethynyl and ferrocenyl groups shows the desired planarity. In the crystal packing of I and II, the molecules arrange themselves in head-to-tail and head-to-head motifs, respectively, resulting in consecutive layers of ferrocene and pyridine moieties.

  10. Egg white hydrolysate shows insulin mimetic and sensitizing effects in 3T3-F442A pre-adipocytes.

    Directory of Open Access Journals (Sweden)

    Forough Jahandideh

    Full Text Available Insulin resistance and inflammation in adipose tissue is a key mechanism underlying metabolic syndrome, a growing health problem characterized by diabetes, obesity and hypertension. Previous work from our research group has demonstrated the potential of egg white ovotransferrin derived bioactive peptides against hypertension, oxidative stress and inflammation in vitro and in vivo. Egg white hydrolysate (EWH has also shown anti-hypertensive effects in spontaneously hypertensive rats. Given the interplay among hypertension, inflammation, oxidative stress and metabolic syndrome, the objective of the study was to test the EWH on differentiation, insulin signaling and inflammatory responses in 3T3-F442A pre-adipocytes. Our study suggested that EWH could promote adipocyte differentiation as shown by increased lipid accumulation, increased release of adiponectin and upregulation of peroxisome proliferator associated receptor gamma (PPARγ and CCAAT/ enhancer binding protein alpha (C/EBP-α. In addition to enhanced insulin effects on the upregulation of protein kinase B/Akt phosphorylation, EWH treatment increased extracellular signal regulated kinase 1/2 (ERK1/2 phosphorylation to a level similar to that of insulin, indicating insulin sensitizing and mimetic properties of the EWH. EWH further attenuated cytokine induced inflammatory marker; cyclooxygenase -2 (COX-2 by 48.78%, possibly through the AP-1 pathway by down regulating c-Jun phosphorylation in adipocytes. Given the critical role of adipose in the pathogenesis of insulin resistance and metabolic syndrome, EWH may have potential applications in the prevention and management of metabolic syndrome and its complications.

  11. Synthesis and biological evaluation of flexible and conformationally constrained LpxC inhibitors

    DEFF Research Database (Denmark)

    Löppenberg, Marius; Müller, Hannes; Pulina, Carla

    2013-01-01

    , conformationally constrained C-glycosidic as well as open chained hydroxamic acids with a defined stereochemistry were prepared. Diversity was introduced by performing C–C coupling reactions like the Sonogashira and Suzuki cross-coupling reactions. The biological evaluation of the synthesized compounds revealed...

  12. Cu(II)-mediated ortho C-H alkynylation of (hetero)arenes with terminal alkynes.

    Science.gov (United States)

    Shang, Ming; Wang, Hong-Li; Sun, Shang-Zheng; Dai, Hui-Xiong; Yu, Jin-Quan

    2014-08-20

    Cu(II)-promoted ortho alkynylation of arenes and heteroarenes with terminal alkynes has been developed to prepare aryl alkynes. A variety of arenes and terminal alkynes bearing different substituents are compatible with this reaction, thus providing an alternative disconnection to Sonogashira coupling.

  13. Synthesis of Helquats Based on Phenanthridinium Units: Four-Step Procedure to Novel Extended Helical Dications

    Czech Academy of Sciences Publication Activity Database

    Sonawane, Manoj R.; Vávra, Jan; Šaman, David; Císařová, I.; Teplý, Filip

    2015-01-01

    Roč. 47, č. 22 (2015), s. 3479-3488 ISSN 0039-7881 Grant - others:GA AV ČR(CZ) M200551208 Institutional support: RVO:61388963 Keywords : helical structures * rhodium * catalysis * cycloadditions * heterocycles * Sonogashira coupling Subject RIV: CC - Organic Chemistry Impact factor: 2.652, year: 2015

  14. Divergent synthesis and optoelectronic properties of oligodiacetylene building blocks

    NARCIS (Netherlands)

    Pilzak, G.S.; Lagen, van B.; Sudhölter, E.J.R.; Zuilhof, H.

    2008-01-01

    A new and divergent synthetic route to oligodiacetylene (ODA) building blocks has been developed via Sonogashira reactions under a reductive atmosphere. These central building blocks provide a new way for rapid preparation of long ODAs. In addition, we report on their optoelectronic properties which

  15. Sulfonamide bearing oligonucleotides: Simple synthesis and efficient RNA recognition

    DEFF Research Database (Denmark)

    Kumar, P.; Chandak, N.; Nielsen, P.

    2012-01-01

    Four pyrimidine nucleosides wherein a benzensulfonamide group is linked to the C-5 position of the uracil nucleobase through a triazolyl or an alkynyl linker were prepared by Cu(I)-assisted azide-alkyne cycloadditions (CuAAC) or Sonogashira reactions, respectively, and incorporated into oligonucl...

  16. ÉTUDE DE CAS — mondiale : Repenser les stratégies de recherche ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    24 déc. 2010 ... Le composite qui en a résulté -- appelé MKC, pour Maria Kaherero Composite -- a servi de base au programme national de sélection végétale du pays. Sperling fait une mise en garde : la non-participation des femmes à la sélection végétale pourrait avoir des conséquences néfastes, pas seulement ...

  17. An efficient synthesis of isocoumarins via a CuI catalyzed cascade reaction process

    Institute of Scientific and Technical Information of China (English)

    2009-01-01

    3-Alkyl isocoumarins are provided by CuI/amino acid-catalyzed Sonogashira coupling reaction of o-bromo benzoic acids and terminal alkynes and the subsequent additive cyclization. This cascade process allows synthesis of diverse isocoumarins by varying both coupling partners bearing a wide range of functional groups.

  18. Cu(I)/Diamine-catalyzed Aryl-alkyne Coupling Reactions

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    CuI/ethylene diamine/K2CO3/dioxane is shown to be a useful system for the cross coupling reactions of various aryl iodides and bromides with aryl and alkyl alkynes. Compared to the conventional Sonogashira reactions, the new procedure is free of palladium and phosphines.

  19. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The analysis revealed that the complexes possess a distorted octahedral geometry with the ligand coordinating in a uni-negative tridentate ONS fashion. The catalytic activity of complexes towards some C–C coupling reactions (viz., Kumada-Corriu, Suzuki-Miyaura and Sonogashira) has been examined. The complexes ...

  20. Optical properties of new 5-(4-phenylethynyl)-substituted-1,10-phenanthroline derivatives

    International Nuclear Information System (INIS)

    Guerin, Juliette; Aronica, Christophe; Boeuf, Gaelle; Chauvin, Jerome; Moreau, Juliette; Lemercier, Gilles

    2011-01-01

    The synthesis and optical properties of a novel family of 5-substituted-1,10-phenanthroline derivatives are reported herein. One carbon-carbon triple-bond function was introduced using a Sonogashira cross-coupling reaction. The effects on optical properties, of the substitution with electro-withdrawing or -donating substituents in the 5th position of the 1,10-phenanthroline are investigated. Experimental chemical structure-polarisability relationship is analyzed according to the Lippert-Mataga correlation and compared to a theoretical study carried out with DFT calculations. These compounds are promising candidates for a fine-tuning of the internal charge-transfers but also as potential nonlinear chromophores and ligands within multifunctional coordination complexes. - Highlights: → Synthesis and optical properties of new 5-substituted-1,10-phenanthroline derivatives. → Sonogashira reaction was used for the substitution. → Structure-polarisability relationship analyzed according to Lippert-Mataga correlation. → Theoretical study was carried out with DFT calculations. → Fine-tuning of the internal charge-transfers within nonlinear compounds.

  1. Modified cyanobacteria

    Science.gov (United States)

    Vermaas, Willem F J.

    2014-06-17

    Disclosed is a modified photoautotrophic bacterium comprising genes of interest that are modified in terms of their expression and/or coding region sequence, wherein modification of the genes of interest increases production of a desired product in the bacterium relative to the amount of the desired product production in a photoautotrophic bacterium that is not modified with respect to the genes of interest.

  2. Efficient Sonogashira and Suzuki-Miyaura coupling reaction ...

    Indian Academy of Sciences (India)

    with short reaction time and good-to-excellent product yield. Keywords. Electrochemistry .... We started optimization study with variety of solvents (table 1, entry 1–6) ... did not show any significant increase in product yield. (table 1, entries 8 and ...

  3. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Chemical Sciences. Akhilesh Kumar Verma. Articles written in Journal of Chemical Sciences. Volume 123 Issue 6 November 2011 pp 937-942. Di(1-benzo[][1,2,3]triazol-1-yl)methane: An efficient ligand for copper and amine-free palladium-catalysed Sonogashira coupling reaction.

  4. Synthesis and biological evaluation of acyclic nucleotide analogues with a furo[2,3-d]pyrimidin-2(3H)-one base

    Czech Academy of Sciences Publication Activity Database

    Janeba, Zlatko; Holý, Antonín; Pohl, Radek; Snoeck, R.; Andrei, G.; De Clercq, E.; Balzarini, J.

    2010-01-01

    Roč. 88, č. 7 (2010), s. 628-638 ISSN 0008-4042 R&D Projects: GA MŠk 1M0508 Institutional research plan: CEZ:AV0Z40550506 Keywords : acyclic nucleoside phosphonates * Sonogashira reaction * intramolecular cyclization Subject RIV: CC - Organic Chemistry Impact factor: 1.374, year: 2010

  5. Synthesis of a new intercalating nucleic acid 6H-INDOLO[2,3-b] quinoxaline oligonucleotides to improve thermal stability of Hoogsteen-type triplexes

    DEFF Research Database (Denmark)

    Osman, Amany M A; Pedersen, Erik Bjerregaard; Bergman, Jan

    2013-01-01

    A new intercalating nucleic acid monomer X was obtained in high yield starting from alkylation of 4-iodophenol with (S)-(+)-2-(2,2-dimethyl-1,3-dioxolan-4-yl)ethanol under Mitsunobu conditions followed by hydrolysis with 80% aqueous acetic acid to give a diol which was coupled under Sonogashira c...

  6. Gout: a review of non-modifiable and modifiable risk factors

    Science.gov (United States)

    MacFarlane, Lindsey A.; Kim, Seoyoung C.

    2014-01-01

    Gout is a common inflammatory arthritis triggered by the crystallization of uric acid within the joints. Gout affects millions worldwide and has an increasing prevalence. Recent research has been carried out to better qualify and quantify the risk factors predisposing individuals to gout. These can largely be broken into non-modifiable risk factors such as sex, age, race, and genetics, and modifiable risk factors such as diet and lifestyle. Increasing knowledge of factors predisposing certain individuals to gout could potentially lead to improved preventive practices. This review summarizes the non-modifiable and modifiable risk factors associated with development of gout. PMID:25437279

  7. Detection of Genetically Modified Food: Has Your Food Been Genetically Modified?

    Science.gov (United States)

    Brandner, Diana L.

    2002-01-01

    Explains the benefits and risks of genetically-modified foods and describes methods for genetically modifying food. Presents a laboratory experiment using a polymerase chain reaction (PCR) test to detect foreign DNA in genetically-modified food. (Contains 18 references.) (YDS)

  8. Palladium-catalyzed aerobic oxidative cross-coupling of arylhydrazines with terminal alkynes.

    Science.gov (United States)

    Zhao, Yingwei; Song, Qiuling

    2015-09-04

    The palladium-catalyzed Sonogashira-type aerobic oxidative coupling of arylhydrazines with terminal alkynes via C-N bond cleavage has been developed; internal alkynes were afforded with a broad substrate scope. This reaction proceeds under copper- and base-free conditions with molecular oxygen as the sole oxidant and nitrogen and water as the only by-products.

  9. Easily oxidizable triarylamine materials with naphthalene and binaphthalene core: structure-properties relationship

    Czech Academy of Sciences Publication Activity Database

    Kerner, L.; Gmucová, K.; Kožíšek, J.; Petříček, Václav; Putala, M.

    2016-01-01

    Roč. 72, č. 44 (2016), s. 7081-7092 ISSN 0040-4020 R&D Projects: GA ČR(CZ) GA14-03276S Institutional support: RVO:68378271 Keywords : triphenylamine * carbazole * regioselective amination * Sonogashira coupling * Negishi alkynylation * hole-transporting materials * OLED * cyclic voltammetry Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.651, year: 2016

  10. Gold-catalyzed Alkyne Hydroxylation: Synthesis of 2-Substituted Benzo[b]furan Compounds

    Institute of Scientific and Technical Information of China (English)

    ZHANG Yuan; XIN Zhi-Jun; XUE Ji-Jun; LI Ying

    2008-01-01

    A strategy concerning the synthesis of 2-substituted benzo[b]furan compounds from o-alkynyl phenols via a gold-catalyzed alkyne hydroxylation is described, which allows the rapid synthesis of various 2-substituted benzo[b]furan derivatives in excellent yields under mild conditions. The o-alkynyl phenol precursors were readily prepared with a Sonogashira coupling reaction.

  11. Convergent synthesis of the right-hand segment of ciguatoxin.

    Science.gov (United States)

    Hamajima, Akinari; Isobe, Minoru

    2006-03-16

    [reaction: see text] A convergent synthesis of the right-hand half of ciguatoxin (the HIJKLM ring system) has been achieved with complete stereocontrol in the introduction of the stereocenters on the eight-membered I ring. Key steps are Sonogashira coupling, dicobalt complexation, intramolecular conjugate addition, and hydrogenation of an endo-olefin to provide the 39-alpha-methyl group.

  12. Further assessment of seismic hazard/risk in the Bushveld Complex platinum mines and the implication for regional and local support design.

    CSIR Research Space (South Africa)

    Brink, AVZ

    2002-03-01

    Full Text Available Final Project Report Further assessment of seismic hazard/risk in the Bushveld Complex platinum mines and the implication for regional and local support design. A.v.Z Brink, M.K.C. Roberts, S.M Spottiswoode Research Agency: CSIR: Division of Mining... on the VCR. An industry workshop on local support requirements in areas of higher seismic risk resulted in the specification of support requirements. A maximum design parameter for yielding support in terms of the ground motion velocity is 1 m...

  13. Biological response modifiers

    Energy Technology Data Exchange (ETDEWEB)

    Weller, R.E.

    1991-10-01

    Much of what used to be called immunotherapy is now included in the term biological response modifiers. Biological response modifiers (BRMs) are defined as those agents or approaches that modify the relationship between the tumor and host by modifying the host's biological response to tumor cells with resultant therapeutic effects.'' Most of the early work with BRMs centered around observations of spontaneous tumor regression and the association of tumor regression with concurrent bacterial infections. The BRM can modify the host response in the following ways: Increase the host's antitumor responses through augmentation and/or restoration of effector mechanisms or mediators of the host's defense or decrease the deleterious component by the host's reaction; Increase the host's defenses by the administration of natural biologics (or the synthetic derivatives thereof) as effectors or mediators of an antitumor response; Augment the host's response to modified tumor cells or vaccines, which might stimulate a greater response by the host or increase tumor-cell sensitivity to an existing response; Decrease the transformation and/or increase differentiation (maturation) of tumor cells; or Increase the ability of the host to tolerate damage by cytotoxic modalities of cancer treatment.

  14. Modified Allergens for Immunotherapy.

    Science.gov (United States)

    Satitsuksanoa, Pattraporn; Głobińska, Anna; Jansen, Kirstin; van de Veen, Willem; Akdis, Mübeccel

    2018-02-16

    During the past few decades, modified allergens have been developed for use in allergen-specific immunotherapy (AIT) with the aim to improve efficacy and reduce adverse effects. This review aims to provide an overview of the different types of modified allergens, their mechanism of action and their potential for improving AIT. In-depth research in the field of allergen modifications as well as the advance of recombinant DNA technology have paved the way for improved diagnosis and research on human allergic diseases. A wide range of structurally modified allergens has been generated including allergen peptides, chemically altered allergoids, adjuvant-coupled allergens, and nanoparticle-based allergy vaccines. These modified allergens show promise for the development of AIT regimens with improved safety and long-term efficacy. Certain modifications ensure reduced IgE reactivity and retained T cell reactivity, which facilities induction of immune tolerance to the allergen. To date, multiple clinical trials have been performed using modified allergens. Promising results were obtained for the modified cat, grass and birch pollen, and house dust mite allergens. The use of modified allergens holds promise for improving AIT efficacy and safety. There is however a need for larger clinical studies to reliably assess the added benefit for the patient of using modified allergens for AIT.

  15. On Modified Bar recursion

    DEFF Research Database (Denmark)

    Oliva, Paulo Borges

    2002-01-01

    Modified bar recursion is a variant of Spector's bar recursion which can be used to give a realizability interpretation of the classical axiom of dependent choice. This realizability allows for the extraction of witnesses from proofs of forall-exists-formulas in classical analysis. In this talk I...... shall report on results regarding the relationship between modified and Spector's bar recursion. I shall also show that a seemingly weak form of modified bar recursion is as strong as "full" modified bar recursion in higher types....

  16. Recent Applications of Polymer Supported Organometallic Catalysts in Organic Synthesis

    Directory of Open Access Journals (Sweden)

    Nina Kann

    2010-09-01

    Full Text Available Recent developments concerning the application of polymer supported organometallic reagents in solid phase synthesis are reviewed, with a special focus on methodology for carbon-carbon formation. Examples of reactions that are covered include the classical Suzuki, Sonogashira and Heck coupings, but also aryl amination, epoxide opening, rearrangements, metathesis and cyclopropanation. Applications in the field of asymmetric synthesis are also discussed.

  17. Probing the dynamic interface between trimethylamine dehydrogenase (TMADH) and electron transferring flavoprotein (ETF) in the TMADH-2ETF complex: role of the Arg-alpha237 (ETF) and Tyr-442 (TMADH) residue pair.

    Science.gov (United States)

    Burgess, Selena G; Messiha, Hanan Latif; Katona, Gergely; Rigby, Stephen E J; Leys, David; Scrutton, Nigel S

    2008-05-06

    We have used multiple solution state techniques and crystallographic analysis to investigate the importance of a putative transient interaction formed between Arg-alpha237 in electron transferring flavoprotein (ETF) and Tyr-442 in trimethylamine dehydrogenase (TMADH) in complex assembly, electron transfer, and structural imprinting of ETF by TMADH. We have isolated four mutant forms of ETF altered in the identity of the residue at position 237 (alphaR237A, alphaR237K, alphaR237C, and alphaR237E) and with each form studied electron transfer from TMADH to ETF, investigated the reduction potentials of the bound ETF cofactor, and analyzed complex formation. We show that mutation of Arg-alpha237 substantially destabilizes the semiquinone couple of the bound FAD and impedes electron transfer from TMADH to ETF. Crystallographic structures of the mutant ETF proteins indicate that mutation does not perturb the overall structure of ETF, but leads to disruption of an electrostatic network at an ETF domain boundary that likely affects the dynamic properties of ETF in the crystal and in solution. We show that Arg-alpha237 is required for TMADH to structurally imprint the as-purified semiquinone form of wild-type ETF and that the ability of TMADH to facilitate this structural reorganization is lost following (i) redox cycling of ETF, or simple conversion to the oxidized form, and (ii) mutagenesis of Arg-alpha237. We discuss this result in light of recent apparent conflict in the literature relating to the structural imprinting of wild-type ETF. Our studies support a mechanism of electron transfer by conformational sampling as advanced from our previous analysis of the crystal structure of the TMADH-2ETF complex [Leys, D. , Basran, J. , Sutcliffe, M. J., and Scrutton, N. S. (2003) Nature Struct. Biol. 10, 219-225] and point to a key role for the Tyr-442 (TMADH) and Arg-alpha237 (ETF) residue pair in transiently stabilizing productive electron transfer configurations. Our work

  18. Characterization of modified clinoptilolite

    International Nuclear Information System (INIS)

    Novosad, J.; Jandl, J.; Woollins, J.D.

    1992-01-01

    Samples of clinoptilolite were modified using insoluble hexacyanoferrate from aqueous solution. The modified samples were characterized by elemental analysis, powder X-ray diffraction, solid state NMR and vibrational spectroscopy. The sorption properties of modified clinoptilolite were studied, too. Higher affinity for 137 Cs sorption in comparison with the natural clinoptilolite has been proved. (author) 5 refs.; 3 figs.; 2 tabs

  19. In vivo evaluation of [123I]-4-iodo-N-(4-(4-(2-methoxyphenyl)-piperazin-1-yl)butyl)-benzamide: a potential sigma receptor ligand for SPECT studies

    International Nuclear Information System (INIS)

    Staelens, Ludovicus; Oltenfreiter, Ruth; Dumont, Filip; Waterhouse, Rikki N.; Vandenbulcke, Katia; Blanckaert, Peter; Dierckx, Rudi A.; Slegers, Guido

    2005-01-01

    In this study, in vivo evaluation in mice and rabbits of [ 123 I]-4-iodo-N-(4-(4-(2-methoxyphenyl)-piperazin-1-yl)butyl)-benzamide ([ 123 I]-BPB), a potential radioligand for visualisation of the sigma receptor by single photon emission computed tomography (SPECT), is reported. The compound possesses appropriate lipophilicity (log P=2.2) and binds sigma-1 and sigma-2 receptors (pKi=6.51 and 6.79, respectively). In mice, this new radioiodinated tracer exhibited high brain uptake (4.99% ID/g tissue at 10 min postinjection) and saturable binding (3.06% ID/g tissue at 10 min postinjection) as determined by pretreatment with unlabeled [ 123 I]-BPB. A metabolite study demonstrated no (less than 5%) labeled metabolites in the brain. In rabbits, regional brain distribution was investigated and the tracer displayed high, homogeneous central nervous system uptake. Selectivity was assessed by competition experiments with known sigma ligands. Metabolite analysis showed no (less than 8%) labeled metabolites in the rabbit brain. In conclusion, our findings indicate that [ 123 I]-BPB is not a suitable tracer for visualisation of D 3 receptors while its potential for sigma receptor imaging is severely hampered by its affinity for dopamine receptors

  20. Shifted-modified Chebyshev filters

    OpenAIRE

    ŞENGÜL, Metin

    2013-01-01

    This paper introduces a new type of filter approximation method that utilizes shifted-modified Chebyshev filters. Construction of the new filters involves the use of shifted-modified Chebyshev polynomials that are formed using the roots of conventional Chebyshev polynomials. The study also includes 2 tables containing the shifted-modified Chebyshev polynomials and the normalized element values for the low-pass prototype filters up to degree 6. The transducer power gain, group dela...

  1. Pokroky v syntéze molekulárních vodičů na bázi helicenových konjugátů

    Czech Academy of Sciences Publication Activity Database

    Rybáček, Jiří; Stará, Irena G.; Starý, Ivo

    2007-01-01

    Roč. 101, č. 11 (2007), s. 969 ISSN 0009-2770. [Pokroky v organické, bioorganické a farmaceutické chemii /42./. 16.11.2007-18.11.2007, Liblice] R&D Projects: GA MŠk LC512; GA ČR GA203/06/1792 Institutional research plan: CEZ:AV0Z40550506 Keywords : helicenes * cyclotrimerisation * alkynes * Sonogashira reaction * molecular wires Subject RIV: CC - Organic Chemistry

  2. Synthesis of novel kavain-like derivatives and evaluation of their cytotoxic activity

    Energy Technology Data Exchange (ETDEWEB)

    Amaral, Patricia de A.; Agustini, Taciane; Eifler-Lima, Vera L. [Universidade Federal do Rio Grande do Sul (UFRGS), Porto Alegre (Brazil). Faculdade de Farmacia. Lab. de Sintese Organica Medicinal; Petrignet, Julien; Cariou, Alexandre; Gree, Rene [Universite de Rennes 1, Rennes (France). Lab. de Chimie Therapeutique; Gouault, Nicolas; Lohezic-Ledevehat, Francoise; David, Michele [CNRS UMR, Universite de Rennes 1, Rennes (France). Lab. de Chimie et Photonique Moleculaires

    2009-07-01

    Palladium-catalyzed cross coupling reactions (Sonogashira-Hagihara, Suzuki-Miyaura, and Heck) coupling and nickel hydride-mediated tandem isomerization aldolisation have been used for the synthesis of three series of {delta}-valerolactones substituted in positions 3, 4, 5 and 6 of the lactone ring. The 26 kavaien-like derivatives were tested against three cell lines and five of them exhibited a weak cytotoxic activity. (author)

  3. Modified SEAGULL

    Science.gov (United States)

    Salas, M. D.; Kuehn, M. S.

    1994-01-01

    Original version of program incorporated into program SRGULL (LEW-15093) for use on National Aero-Space Plane project, its duty being to model forebody, inlet, and nozzle portions of vehicle. However, real-gas chemistry effects in hypersonic flow fields limited accuracy of that version, because it assumed perfect-gas properties. As a result, SEAGULL modified according to real-gas equilibrium-chemistry methodology. This program analyzes two-dimensional, hypersonic flows of real gases. Modified version of SEAGULL maintains as much of original program as possible, and retains ability to execute original perfect-gas version.

  4. S.442: a bill to grant the consent of the Congress to the Rocky Mountain Low-Level Radioactive Waste Compact. Introduced in the Senate of the United States, Ninety-Ninth Congress, First Session, February 7, 1985

    International Nuclear Information System (INIS)

    Anon.

    1985-01-01

    Congress grants the States of Arizona, Colorado, Nevada, New Mexico, Utah, and Wyoming the right to enter into the Rocky Mountain Interstate Low-Level Radioactive Waste Compact under S.442. Under the compact, each state assumes responsibility for cooperating in the management of low-level radioactive wastes. The bill summarizes this purpose, defines pertinent terms, and outlines the rights and obligations of the member states. It stipulates that within six years after the law is enacted in Nevada and one other state, a regional facility must be operating in a state other than Nevada. The facility board will impose a surcharge on each unit of waste received, and the host state may impose a state surcharge against expenses. The bill outlines board duties, conditions for Congressional consent, and the circumstances for withdrawal or exclusion

  5. Genetically modified foods and allergy.

    Science.gov (United States)

    Lee, T H; Ho, H K; Leung, T F

    2017-06-01

    2015 marked the 25th anniversary of the commercial use and availability of genetically modified crops. The area of planted biotech crops cultivated globally occupies a cumulative two billion hectares, equivalent to twice the land size of China or the United States. Foods derived from genetically modified plants are widely consumed in many countries and genetically modified soybean protein is extensively used in processed foods throughout the industrialised countries. Genetically modified food technology offers a possible solution to meet current and future challenges in food and medicine. Yet there is a strong undercurrent of anxiety that genetically modified foods are unsafe for human consumption, sometimes fuelled by criticisms based on little or no firm evidence. This has resulted in some countries turning away food destined for famine relief because of the perceived health risks of genetically modified foods. The major concerns include their possible allergenicity and toxicity despite the vigorous testing of genetically modified foods prior to marketing approval. It is imperative that scientists engage the public in a constructive evidence-based dialogue to address these concerns. At the same time, improved validated ways to test the safety of new foods should be developed. A post-launch strategy should be established routinely to allay concerns. Mandatory labelling of genetically modified ingredients should be adopted for the sake of transparency. Such ingredient listing and information facilitate tracing and recall if required.

  6. Konstruksi vektor biner untuk ekspresi gen dip22 yang diisolasi dari tebu varietas M 442-51 pada tanaman

    Directory of Open Access Journals (Sweden)

    Wiwit Budi Widyasari

    2012-02-01

    Full Text Available Sugarcane is the principle plant for producing sugar in Indonesia. Water supply is one key element in the agronomy of sugarcane. Sugarcane is a high biomass crop which requires large amounts of water. Low yields of sugar observed in water stressed plants indicate that sugarcane is very sensititive to drought. A number of genes that respond to drought, salt, and cold stress at the trasnscriptional level have been reported. dip22 (drought inducible protein protein isolated from drought resistance variety M 442-51 was predicted to be a protein regulator to water stress in sugarcane. Increasing of tolerance to water stress by over expression of dip22 genes in high yield sugarcane variety hopefully will maintain sugar production. The goal of this research was to construct a binary vector for dip22 gene expression in plant. dip22 gene from mutated PCR was cloned to pGEM ® €“T Easy and transformed to Escherichia coli strain DH5a. And then, these gene was isolated again from pGEM ® €“T Easy-dip22 (pGdip plasmid using restriction enzymes NcoI and PmlI. pCAMBIA 1303 plasmid is an expression vector which has the constitutive promoter CaMV35S. Recombinant plasmid was transformed to Escherichia coli strain DH5a for plasmid propagation through DNA replication. Recombinant plasmid was isolated, and digested with NcoI and PmlI to examine the presence of dip22 gene in the pCAMBIA 1303 plasmid. The recombinant plasmid was transformed to A. tumefaciens strain LBA 4404. Plasmid isolated from A. tumefaciens was digested with Bst XI and Bst EII to examine the similarity between pCAMBIA 1303-dip22 (pCdip from Escherichia coli and A. tumefaciens. The result by electrophoresis showed that both plasmids had the same size after digested. It was concluded that the transformed A. tumefaciens strain LBA 4404 bacteria has pCAMBIA 1303-dip22 (pCdip plasmid indeed. Therefore, this construct of dip22 gene in binary vector can be used for improving drought tolerance in

  7. Phosphonium modified clay/polyimide nanocomposites

    International Nuclear Information System (INIS)

    Ceylan, Hatice; Çakmakçi, Emrah; Beyler-Çiǧil, Asli; Kahraman, Memet Vezir

    2014-01-01

    In this study, octyltriphenylphosphonium bromide [OTPP-Br] was prepared from the reaction of triphenylphosphine and 1 -bromooctane. The modification of clay was done by ion exchange reaction using OTPP-Br in water medium. Poly(amic acid) was prepared from the reaction of 3,3',4,4'-Benzophenonetetracarboxylic dianhydride (BTDA) and 4,4'-Oxydianiline (ODA). Polyimide(PI)/clay hybrids were prepared by blending of poly(amic acid) and organically modified clay as a type of layered clays. The morphology of the Polyimide/ phosphonium modified clay hybrids was characterized by scanning electron microscopy (SEM). Chemical structures of polyimide and Polyimide/ phosphonium modified clay hybrids were characterized by FTIR. SEM and FTIR results showed that the Polyimide/ phosphonium modified clay hybrids were successfully prepared. Thermal properties of the Polyimide/ phosphonium modified clay hybrids were characterized by thermogravimetric analysis (TGA)

  8. Adsorption of polynuclear aromatic hydrocarbons from aqueous solution: Agrowaste-modified kaolinite vs surfactant modified bentonite

    Directory of Open Access Journals (Sweden)

    E. I. Unuabonah

    2017-01-01

    Full Text Available The adsorption efficiency of a new hybrid clay adsorbent for polynuclear aromatic hydrocarbons (PAHs is compared with known modified clay adsorbents. The new hybrid clay adsorbent (HYCA showed far higher adsorption capacities for the adsorption of various PAH molecules compared with sodium dodecyl sulfate modified and humic acid modified Bentonite clay adsorbents. With the new hybrid clay adsorbent (HYCA, the adsorption of some of the larger PAH molecules was complete in the first 1 h as compared with ≈ 62% and ≈ 76% observed for both humic acid modified and sodium dodecyl sulfate modified Bentonite clay adsorbents respectively. In 24 h adsorption of the PAHs was complete for all adsorbents with HYCA adsorbent showing better efficiency in the removal of the PAH molecules from aqueous solutions. No significant change was observed with increase in time up to 48 h. The adsorption was observed to be more spontaneous with HYCA adsorbent than with either modified Bentonite adsorbents. The enthalpy of adsorption did not follow any specific order and were not consistent for all PAH molecules considered.

  9. Self-Assembly of Reconfigurable By-Design Optical Materials with Molecular-Level Control

    Science.gov (United States)

    2014-09-21

    19   Figure  19.    Strategies  to  generate  1D  nanoparticle   polymers  using  various  AuNP@COP  architectures...anhydride treatment provided intermediate 2, which was further subjected to Sonogashira coupling, bromination and thiolation to provide the thioether...the polymerization does occur and furthermore we have observed some semblance of trimer formation in the TEM images (Figure 20). The optimization

  10. Synthesis of methoxy substituted centrally chiral triynes as precursors of functionalised nonracemic helicene-like compounds

    Czech Academy of Sciences Publication Activity Database

    Krausová, Zuzana; Sehnal, Petr; Teplý, Filip; Stará, Irena G.; Starý, Ivo; Šaman, David; Cvačka, Josef; Fiedler, Pavel

    2007-01-01

    Roč. 72, č. 11 (2007), s. 1499-1522 ISSN 0010-0765 R&D Projects: GA MŠk LC512; GA ČR GA203/06/1792; GA ČR GA203/07/1664; GA MPO FI-IM/073; GA MŠk ME 857 Institutional research plan: CEZ:AV0Z40550506 Keywords : helical chirality * helicenes * Sonogashira reaction * alkynes Subject RIV: CC - Organic Chemistry Impact factor: 0.879, year: 2007

  11. A stereo-controlled route to conjugated E-enediynes

    Institute of Scientific and Technical Information of China (English)

    ZHOU Lei; JIANG Huanfeng

    2007-01-01

    3-Ene-1,5-diynes are important components of many enediyne antitumor agents and luminescent materials.A stereo-controlled approach to the synthesis of E-enediynes was developed,and it consists of the following two steps:(1)a mild and economical synthesis of dihalo vinyl derivatives via addition of CuBr2 to alkynes;(2) the Sonogashira coupling reaction of the dihalo vinyl derivatives with terminal alkynes to form conjugated enediynes.

  12. Surface-modified electrodes (SME)

    NARCIS (Netherlands)

    Schreurs, J.P.G.M.; Barendrecht, E.

    1984-01-01

    This review deals with the literature (covered up to August 1983), the characterization and the applications of Surface-Modified Electrodes (SME). As a special class of SME's, the Enzyme-Modified Electrode (EME) is introduced. Three types of modification procedures are distinguished; i.e. covalent

  13. Modified blank ammunition injuries.

    Science.gov (United States)

    Ogunc, Gokhan I; Ozer, M Tahir; Coskun, Kagan; Uzar, Ali Ihsan

    2009-12-15

    Blank firing weapons are designed only for discharging blank ammunition cartridges. Because they are cost-effective, are easily accessible and can be modified to live firearms plus their unclear legal situation in Turkish Law makes them very popular in Turkey. 2004 through 2008, a total of 1115 modified blank weapons were seized in Turkey. Blank firing weapons are easily modified by owners, making them suitable for discharging live firearm ammunition or modified blank ammunitions. Two common methods are used for modification of blank weapons. After the modification, these weapons can discharge the live ammunition. However, due to compositional durability problems with these types of weapons; the main trend is to use the modified blank ammunitions rather than live firearm ammunition fired from modified blank firing weapons. In this study, two types of modified blank weapons and two types of modified blank cartridges were tested on three different target models. Each of the models' shooting side was coated with 1.3+/-2 mm thickness chrome tanned cowhide as a skin simulant. The first model was only coated with skin simulant. The second model was coated with skin simulant and 100% cotton police shirt. The third model was coated with skin simulant and jean denim. After the literature evaluation four high risky anatomic locations (the neck area; the eyes; the thorax area and inguinal area) were pointed out for the steel and lead projectiles are discharged from the modified blank weapons especially in close range (0-50 cm). The target models were designed for these anatomic locations. For the target models six Transparent Ballistic Candle blocks (TCB) were prepared and divided into two test groups. The first group tests were performed with lead projectiles and second group with steel projectile. The shortest penetration depth (lead projectile: 4.358 cm; steel projectile 8.032 cm) was recorded in the skin simulant and jean denim coated block for both groups. In both groups

  14. High-Performance Ttransparent and Stretchable All-Solid Supercapacitors Based on Highly Aligned Carbon Nanotube Sheets

    Science.gov (United States)

    2014-01-09

    supercapacitors based on poly ( ionic liquid )- modified graphene electrodes. ACS Nano 5, 436–442 (2011). 34. Denisa, H.-J. et al. Highly stable performance of...Niu, Z. et al. A repeated halving approach to fabricate ultrathin single-walled carbon nanotube films for transparent supercapacitors. Small 9, 518–524...PVA-H3PO4/CNT/PDMS multilayer film in either a parallel (Figure 1b) or cross (Figure 1c) configuration, leading to highly transparent devices to be

  15. Fluorescent cellulose nanocrystals via supramolecular assembly of terpyridine-modified cellulose nanocrystals and terpyridine-modified perylene

    International Nuclear Information System (INIS)

    Hassan, Mohammad L.; Moorefield, Charles M.; Elbatal, Hany S.; Newkome, George R.; Modarelli, David A.; Romano, Natalie C.

    2012-01-01

    Highlights: ► Surfaces of cellulose nanocrystals were modified with terpyridine ligands. ► Fluorescent nanocrystals could be obtained via self-assembly of terpyridine-modified perylene dye onto the terpyridine-modified cellulose nanocrystals. ► Further self-assembly of azide-functionalized terpyridine onto the fluorescent cellulose nanocrystals was possible to obtain nanocellulosic material with expected use in bioimaging. - Abstract: Due to their natural origin, biocompatibility, and non-toxicity, cellulose nanocrystals are promising candidates for applications in nanomedicine. Highly fluorescent nanocellulosic material was prepared via surface modification of cellulose nanocrystals with 2,2′:6′,2″-terpyridine side chains followed by supramolecular assembly of terpyridine-modified perylene dye onto the terpyridine-modified cellulose nanocrystals (CTP) via Ru III /Ru II reduction. The prepared terpyridine-modified cellulose-Ru II -terpyridine-modified perylene (CTP-Ru II -PeryTP) fluorescent nanocrystals were characterized using cross-polarized/magic angle spin 13 C nuclear magnetic resonance (CP/MAS 13 C NMR), Fourier transform infrared (FTIR), UV–visible, and fluorescence spectroscopy. In addition, further self-assembly of terpyridine units with azide functional groups onto CTP-Ru II -PeryTP was possible via repeating the Ru III /Ru II reduction protocol to prepare supramolecular fluorescent nanocrystals with azide functionality (CTP-Ru II -PeryTP-Ru II -AZTP). The prepared derivative may have potential application in bio-imaging since the terminal azide groups can be easily reacted with antigens via “Click” chemistry reaction.

  16. Modified Firefly Algorithm

    Directory of Open Access Journals (Sweden)

    Surafel Luleseged Tilahun

    2012-01-01

    Full Text Available Firefly algorithm is one of the new metaheuristic algorithms for optimization problems. The algorithm is inspired by the flashing behavior of fireflies. In the algorithm, randomly generated solutions will be considered as fireflies, and brightness is assigned depending on their performance on the objective function. One of the rules used to construct the algorithm is, a firefly will be attracted to a brighter firefly, and if there is no brighter firefly, it will move randomly. In this paper we modify this random movement of the brighter firefly by generating random directions in order to determine the best direction in which the brightness increases. If such a direction is not generated, it will remain in its current position. Furthermore the assignment of attractiveness is modified in such a way that the effect of the objective function is magnified. From the simulation result it is shown that the modified firefly algorithm performs better than the standard one in finding the best solution with smaller CPU time.

  17. Ageing and chronic intermittent hypoxia mimicking sleep apnea do not modify local brain tissue stiffness in healthy mice.

    Science.gov (United States)

    Jorba, Ignasi; Menal, Maria José; Torres, Marta; Gozal, David; Piñol-Ripoll, Gerard; Colell, Anna; Montserrat, Josep M; Navajas, Daniel; Farré, Ramon; Almendros, Isaac

    2017-07-01

    Recent evidence suggests that obstructive sleep apnea (OSA) may increase the risk of Alzheimer´s disease (AD), with the latter promoting alterations in brain tissue stiffness, a feature of ageing. Here, we assessed the effects of age and intermittent hypoxia (IH) on brain tissue stiffness in a mouse model of OSA. Two-month-old and 18-month-old mice (N=10 each) were subjected to IH (20% O 2 40s - 6% O 2 20s) for 8 weeks (6h/day). Corresponding control groups for each age were kept under normoxic conditions in room air (RA). After sacrifice, the brain was excised and 200-micron coronal slices were cut with a vibratome. Local stiffness of the cortex and hippocampus were assessed in brain slices placed in an Atomic Force Microscope. For both brain regions, the Young's modulus (E) in each animal was computed as the average values from 9 force-indentation curves. Cortex E mean (±SE) values were 442±122Pa (RA) and 455±120 (IH) for young mice and 433±44 (RA) and 405±101 (IH) for old mice. Hippocampal E values were 376±62 (RA) and 474±94 (IH) for young mice and 486±93 (RA) and 521±210 (IH) for old mice. For both cortex and hippocampus, 2-way ANOVA indicated no statistically significant effects of age or challenge (IH vs. RA) on E values. Thus, neither chronic IH mimicking OSA nor ageing up to late middle age appear to modify local brain tissue stiffness in otherwise healthy mice. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Cobalt phthalocyanine modified electrodes utilised in electroanalysis: nano-structured modified electrodes vs. bulk modified screen-printed electrodes.

    Science.gov (United States)

    Foster, Christopher W; Pillay, Jeseelan; Metters, Jonathan P; Banks, Craig E

    2014-11-19

    Cobalt phthalocyanine (CoPC) compounds have been reported to provide electrocatalytic performances towards a substantial number of analytes. In these configurations, electrodes are typically constructed via drop casting the CoPC onto a supporting electrode substrate, while in other cases the CoPC complex is incorporated within the ink of a screen-printed sensor, providing a one-shot economical and disposable electrode configuration. In this paper we critically compare CoPC modified electrodes prepared by drop casting CoPC nanoparticles (nano-CoPC) onto a range of carbon based electrode substrates with that of CoPC bulk modified screen-printed electrodes in the sensing of the model analytes L-ascorbic acid, oxygen and hydrazine. It is found that no "electrocatalysis" is observed towards L-ascorbic acid using either of these CoPC modified electrode configurations and that the bare underlying carbon electrode is the origin of the obtained voltammetric signal, which gives rise to useful electroanalytical signatures, providing new insights into literature reports where "electrocatalysis" has been reported with no clear control experiments undertaken. On the other hand true electrocatalysis is observed towards hydrazine, where no such voltammetric features are witnessed on the bare underlying electrode substrate.

  19. Design and stereoselective synthesis of a C-aryl furanoside as a conformationally constrained CHIR-090 analogue

    DEFF Research Database (Denmark)

    Oddo, Alberto; Holl, Ralph

    2012-01-01

    The UDP-3-O-[(R)-3-hydroxymyristoyl]-N-acetylglucosamine deacetylase (LpxC) is a promising target for the development of novel antibiotic substances against multidrug-resistant Gram-negative bacteria. The C-aryl glycoside 3 was designed as conformationally constrained analogue of the potent LpxC-......, and esterification. A Sonogashira reaction of the aryl iodide 11 led to the alkyne 17 which was transformed with H(2)NOH into the hydroxamic acid 3....

  20. Synthesis of a Tyr-Tyr Dipeptide Library and Evaluation Against Tumor Cells.

    Science.gov (United States)

    Vasconcelos, Stanley Ns; Sciani, Juliana M; Lisboa, Nicole Mambeli; Stefani, Helio A

    2018-03-09

    Structural component of proteins and peptides, amino acids have been used as building blocks in the synthesis of more complex molecules with antitumor activity against several types of cancer. The search for new anticancer compounds is ongoing, especially for cancers that are very aggressive and have poor prognoses, such as leukemia. Here, we report a method to synthesize Tyr-Tyr dipeptides via sonochemistry reactions followed by functionalization of these Tyr-Tyr dipeptides with Suzuki-Miyaura and Sonogashira cross-coupling reactions in good yields. Twelve different Tyr-Tyr dipeptides were investigated against three cell lines: HaCaT; Jurkat-E6; and A2058. Some of Tyr-Tyr dipeptides showed activity against Jurkat-E6 leukaemia cells at low concentration, decreasing their viability, but not against non-tumor HaCaT cells, suggesting a cytotoxicity specific to tumor cells. All dipeptides were able to decrease the viability of Jurkat cell line, however the A2058 cell line did not respond well to treatment with the peptides. Some of the modified Tyr-Tyr dipeptides presented selective activity on leukemic tumor cells. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  1. Cell Wall Remodeling Enzymes Modulate Fungal Cell Wall Elasticity and Osmotic Stress Resistance.

    Science.gov (United States)

    Ene, Iuliana V; Walker, Louise A; Schiavone, Marion; Lee, Keunsook K; Martin-Yken, Hélène; Dague, Etienne; Gow, Neil A R; Munro, Carol A; Brown, Alistair J P

    2015-07-28

    The fungal cell wall confers cell morphology and protection against environmental insults. For fungal pathogens, the cell wall is a key immunological modulator and an ideal therapeutic target. Yeast cell walls possess an inner matrix of interlinked β-glucan and chitin that is thought to provide tensile strength and rigidity. Yeast cells remodel their walls over time in response to environmental change, a process controlled by evolutionarily conserved stress (Hog1) and cell integrity (Mkc1, Cek1) signaling pathways. These mitogen-activated protein kinase (MAPK) pathways modulate cell wall gene expression, leading to the construction of a new, modified cell wall. We show that the cell wall is not rigid but elastic, displaying rapid structural realignments that impact survival following osmotic shock. Lactate-grown Candida albicans cells are more resistant to hyperosmotic shock than glucose-grown cells. We show that this elevated resistance is not dependent on Hog1 or Mkc1 signaling and that most cell death occurs within 10 min of osmotic shock. Sudden decreases in cell volume drive rapid increases in cell wall thickness. The elevated stress resistance of lactate-grown cells correlates with reduced cell wall elasticity, reflected in slower changes in cell volume following hyperosmotic shock. The cell wall elasticity of lactate-grown cells is increased by a triple mutation that inactivates the Crh family of cell wall cross-linking enzymes, leading to increased sensitivity to hyperosmotic shock. Overexpressing Crh family members in glucose-grown cells reduces cell wall elasticity, providing partial protection against hyperosmotic shock. These changes correlate with structural realignment of the cell wall and with the ability of cells to withstand osmotic shock. The C. albicans cell wall is the first line of defense against external insults, the site of immune recognition by the host, and an attractive target for antifungal therapy. Its tensile strength is conferred by

  2. Automated DNA extraction from genetically modified maize using aminosilane-modified bacterial magnetic particles.

    Science.gov (United States)

    Ota, Hiroyuki; Lim, Tae-Kyu; Tanaka, Tsuyoshi; Yoshino, Tomoko; Harada, Manabu; Matsunaga, Tadashi

    2006-09-18

    A novel, automated system, PNE-1080, equipped with eight automated pestle units and a spectrophotometer was developed for genomic DNA extraction from maize using aminosilane-modified bacterial magnetic particles (BMPs). The use of aminosilane-modified BMPs allowed highly accurate DNA recovery. The (A(260)-A(320)):(A(280)-A(320)) ratio of the extracted DNA was 1.9+/-0.1. The DNA quality was sufficiently pure for PCR analysis. The PNE-1080 offered rapid assay completion (30 min) with high accuracy. Furthermore, the results of real-time PCR confirmed that our proposed method permitted the accurate determination of genetically modified DNA composition and correlated well with results obtained by conventional cetyltrimethylammonium bromide (CTAB)-based methods.

  3. Chitosan scaffold modified with D-(+) raffinose and enriched with thiol-modified gelatin for improved osteoblast adhesion

    International Nuclear Information System (INIS)

    Galli, C; Parisi, L; Smerieri, A; Lumetti, S; Manfredi, E; Macaluso, G M; Elviri, L; Bianchera, A; Bettini, R; Lagonegro, P

    2016-01-01

    The aim of the present study was to investigate whether chitosan-based scaffolds modified with D-(+) raffinose and enriched with thiol-modified gelatin could selectively improve osteoblast adhesion and proliferation. 2, 3 and 4.5% chitosan films were prepared. Chitosan suitability for tissue engineering was confirmed by protein adsorption assay. Scaffolds were incubated with a 2.5 mg ml −1 BSA solution and the decrease of protein content in the supernatants was measured by spectrophotometry. Chitosan films were then enriched with thiol-modified gelatin and their ability to bind BSA was also measured. Then, 2% chitosan discs with or without thiol-modified gelatin were used as culture substrates for MC3T3-E1 cells. After 72 h cells were stained with trypan blue or with calcein AM and propidium iodide for morphology, viability and proliferation assays. Moreover, cell viability was measured at 48, 72, 96 and 168 h to obtain a growth curve. Chitosan films efficiently bound and retained BSA proportionally to the concentration of chitosan discs. The amount of protein retained was higher on chitosan enriched with thiol-modified gelatin. Moreover, chitosan discs allowed the adhesion and the viability of cells, but inhibited their proliferation. The functionalization of chitosan with thiol-modified gelatin enhanced cell spreading and proliferation. Our data confirm that chitosan is a suitable material for tissue engineering. Moreover, our data show that the enrichment of chitosan with thiol-modified gelatin enhances its biological properties. (paper)

  4. Implant materials modified by colloids

    Directory of Open Access Journals (Sweden)

    Zboromirska-Wnukiewicz Beata

    2016-03-01

    Full Text Available Recent advances in general medicine led to the development of biomaterials. Implant material should be characterized by a high biocompatibility to the tissue and appropriate functionality, i.e. to have high mechanical and electrical strength and be stable in an electrolyte environment – these are the most important properties of bioceramic materials. Considerations of biomaterials design embrace also electrical properties occurring on the implant-body fluid interface and consequently the electrokinetic potential, which can be altered by modifying the surface of the implant. In this work, the surface of the implants was modified to decrease the risk of infection by using metal colloids. Nanocolloids were obtained using different chemical and electrical methods. It was found that the colloids obtained by physical and electrical methods are more stable than colloids obtained by chemical route. In this work the surface of modified corundum implants was investigated. The implant modified by nanosilver, obtained by electrical method was selected. The in vivo research on animals was carried out. Clinical observations showed that the implants with modified surface could be applied to wounds caused by atherosclerotic skeleton, for curing the chronic and bacterial inflammations as well as for skeletal reconstruction surgery.

  5. Cobalt Phthalocyanine Modified Electrodes Utilised in Electroanalysis: Nano-Structured Modified Electrodes vs. Bulk Modified Screen-Printed Electrodes

    Directory of Open Access Journals (Sweden)

    Christopher W. Foster

    2014-11-01

    Full Text Available Cobalt phthalocyanine (CoPC compounds have been reported to provide electrocatalytic performances towards a substantial number of analytes. In these configurations, electrodes are typically constructed via drop casting the CoPC onto a supporting electrode substrate, while in other cases the CoPC complex is incorporated within the ink of a screen-printed sensor, providing a one-shot economical and disposable electrode configuration. In this paper we critically compare CoPC modified electrodes prepared by drop casting CoPC nanoparticles (nano-CoPC onto a range of carbon based electrode substrates with that of CoPC bulk modified screen-printed electrodes in the sensing of the model analytes L-ascorbic acid, oxygen and hydrazine. It is found that no “electrocatalysis” is observed towards L-ascorbic acid using either of these CoPC modified electrode configurations and that the bare underlying carbon electrode is the origin of the obtained voltammetric signal, which gives rise to useful electroanalytical signatures, providing new insights into literature reports where “electrocatalysis” has been reported with no clear control experiments undertaken. On the other hand true electrocatalysis is observed towards hydrazine, where no such voltammetric features are witnessed on the bare underlying electrode substrate.

  6. Nanoparticles modified with multiple organic acids

    Science.gov (United States)

    Cook, Ronald Lee (Inventor); Luebben, Silvia DeVito (Inventor); Myers, Andrew William (Inventor); Smith, Bryan Matthew (Inventor); Elliott, Brian John (Inventor); Kreutzer, Cory (Inventor); Wilson, Carolina (Inventor); Meiser, Manfred (Inventor)

    2007-01-01

    Surface-modified nanoparticles of boehmite, and methods for preparing the same. Aluminum oxyhydroxide nanoparticles are surface modified by reaction with selected amounts of organic acids. In particular, the nanoparticle surface is modified by reactions with two or more different carboxylic acids, at least one of which is an organic carboxylic acid. The product is a surface modified boehmite nanoparticle that has an inorganic aluminum oxyhydroxide core, or part aluminum oxyhydroxide core and a surface-bonded organic shell. Organic carboxylic acids of this invention contain at least one carboxylic acid group and one carbon-hydrogen bond. One embodiment of this invention provides boehmite nanoparticles that have been surface modified with two or more acids one of which additional carries at least one reactive functional group. Another embodiment of this invention provides boehmite nanoparticles that have been surface modified with multiple acids one of which has molecular weight or average molecular weight greater than or equal to 500 Daltons. Yet, another embodiment of this invention provides boehmite nanoparticles that are surface modified with two or more acids one of which is hydrophobic in nature and has solubility in water of less than 15 by weight. The products of the methods of this invention have specific useful properties when used in mixture with liquids, as filler in solids, or as stand-alone entities.

  7. Nanoparticles modified with multiple organic acids

    Science.gov (United States)

    Cook, Ronald Lee; Luebben, Silvia DeVito; Myers, Andrew William; Smith, Bryan Matthew; Elliott, Brian John; Kreutzer, Cory; Wilson, Carolina; Meiser, Manfred

    2007-07-17

    Surface-modified nanoparticles of boehmite, and methods for preparing the same. Aluminum oxyhydroxide nanoparticles are surface modified by reaction with selected amounts of organic acids. In particular, the nanoparticle surface is modified by reactions with two or more different carboxylic acids, at least one of which is an organic carboxylic acid. The product is a surface modified boehmite nanoparticle that has an inorganic aluminum oxyhydroxide core, or part aluminum oxyhydroxide core and a surface-bonded organic shell. Organic carboxylic acids of this invention contain at least one carboxylic acid group and one carbon-hydrogen bond. One embodiment of this invention provides boehmite nanoparticles that have been surface modified with two or more acids one of which additional carries at least one reactive functional group. Another embodiment of this invention provides boehmite nanoparticles that have been surface modified with multiple acids one of which has molecular weight or average molecular weight greater than or equal to 500 Daltons. Yet, another embodiment of this invention provides boehmite nanoparticles that are surface modified with two or more acids one of which is hydrophobic in nature and has solubility in water of less than 15 by weight. The products of the methods of this invention have specific useful properties when used in mixture with liquids, as filler in solids, or as stand-alone entities.

  8. Synthesis of 2,3-diyne-1,4-naphthoquinone derivatives and evaluation of cytotoxic activity against tumor cell lines

    International Nuclear Information System (INIS)

    Silva, Mauro G.; Camara, Celso A.; Silva, Tania M.S.; Feitosa, Anderson C.S.; Meira, Assuero S.; Pessoa, Claudia

    2013-01-01

    A series of 2,3-diyne-1,4-naphthoquinone derivatives was synthesized from 2,3-dibromo- 1,4-naphthoquinone and various functionalized terminal alkynes using palladium-catalyzed Sonogashira cross-coupling reaction. The diynes were evaluated as potential cytotoxic agents against three tumor cell lines: human ovarian adenocarcinoma (OVCAR-8), human metastatic prostate cancer (PC-3M) and human bronchoalveolar lung carcinoma (NCI-H358M), presenting, in general, satisfactory results for inhibition of cell growth. (author)

  9. Synthesis of 2,3-diyne-1,4-naphthoquinone derivatives and evaluation of cytotoxic activity against tumor cell lines

    Energy Technology Data Exchange (ETDEWEB)

    Silva, Mauro G.; Camara, Celso A.; Silva, Tania M.S., E-mail: ccelso@dcm.ufrpe.br [Universidade Federal Rural de Pernambuco (LSCB/UFRPE), Recife, PE (Brazil). Dept. de Ciencias Moleculares. Lab. de Sintese de Compostos Bioativos; Feitosa, Anderson C.S.; Meira, Assuero S.; Pessoa, Claudia [Universidade Federal do Ceara (LOE/UFC), Fortaleza, CE (Brazil). Dept. de Fisiologia e Farmacologia. Lab. de Oncologia Experimental

    2013-09-15

    A series of 2,3-diyne-1,4-naphthoquinone derivatives was synthesized from 2,3-dibromo- 1,4-naphthoquinone and various functionalized terminal alkynes using palladium-catalyzed Sonogashira cross-coupling reaction. The diynes were evaluated as potential cytotoxic agents against three tumor cell lines: human ovarian adenocarcinoma (OVCAR-8), human metastatic prostate cancer (PC-3M) and human bronchoalveolar lung carcinoma (NCI-H358M), presenting, in general, satisfactory results for inhibition of cell growth. (author)

  10. Horseshoes in modified Chen's attractors

    International Nuclear Information System (INIS)

    Huang Yan; Yang Xiaosong

    2005-01-01

    In this paper we study dynamics of a class of modified Chen's attractors, we show that these attractors are chaotic by giving a rigorous verification for existence of horseshoes in these systems. We prove that the Poincare maps derived from these modified Chen's attractors are semi-conjugate to the 2-shift map

  11. BDML Metadata: 442 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available Ce_AK BDML file for the result of computer simulation of male pronuclear migration ...in C. elegans embryo the result of computer simulation of male pronuclear migration in C. elegans embryo (me

  12. Ammonia synthesis on Au modified Fe(111) and Ag and Cu modified Fe(100) surfaces

    DEFF Research Database (Denmark)

    Lytken, Ole; Waltenburg, Hanne Neergaard; Chorkendorff, Ib

    2003-01-01

    In order to investigate any influence of steps and possible positive effects of making surface alloys the ammonia synthesis has been investigated over Au modified Fe(111) and Ag and Cu modified Fe(100) single crystals in the temperature range 603-773 K, using a system combining ultra-high vacuum...... and a high-pressure cell. Ammonia was synthesized from a stoichiometric (N-2:3H(2)) gas mixture at a pressure of 2 bar. By deposition of small amounts of An, the ammonia production activity of the Fe(1 1 1) surface can be enhanced. More important, for the gold modified surface, the reaction order in ammonia...

  13. Interfacial Modifiers

    Energy Technology Data Exchange (ETDEWEB)

    Martin, Ina; French, Roger H.

    2018-03-19

    Our project objective in the first and only Budget Period was to demonstrate the potential of nm-scale organofunctional silane coatings as a method of extending the lifetime of PV materials and devices. Specifically, the target was to double the lifetime performance of a laminated Cu(In,Ga)Se2 (CIGS) cell under real-world and accelerated aging exposure conditions. Key findings are that modification of aluminum-doped zinc oxide (AZO) films (materials used as transparent conductive oxide (TCO) top contacts) resulted in decreased degradation of optical and electrical properties under damp heat (DH) exposure compared to un-modified AZO. The most significant finding is that modification of the AZO top contact of full CIGS devices resulted in significantly improved properties under DH exposure compared to un-modified devices, by a factor of 4 after 1000 h. Results of this one-year project have demonstrated that surface functionalization is a viable pathway for extending the lifetime of state-of-the-art CIGS devices.

  14. [Genetically modified food--unnecessary controversy?].

    Science.gov (United States)

    Tchórz, Michał; Radoniewicz-Chagowska, Anna; Lewandowska-Stanek, Hanna; Szponar, Elzbieta; Szponar, Jarosław

    2012-01-01

    Fast development of genetic engineering and biotechnology allows use of genetically modified organisms (GMO) more and more in different branches of science and economy. Every year we can see an increase of food amount produced with the use of modification of genetic material. In our supermarkets we can find brand new types of plants, products including genetically modified ingredients or meat from animals fed with food containing GMO. This article presents general information about genetically modified organisms, it also explains the range of genetic manipulation, use of newly developed products and current field area for GMO in the world. Based on scientific data the article presents benefits from development of biotechnology in reference to modified food. It also presents the voice of skeptics who are extremely concerned about the impact of those organisms on human health and natural environment. Problems that appear or can appear as a result of an increase of GMO are very important not only from a toxicologist's or a doctor's point of view but first of all from the point of view of ordinary consumers--all of us.

  15. Modified nasolacrimal duct stenting

    International Nuclear Information System (INIS)

    Tian Min; Jin Mei; Chen Huanjun; Li Yi

    2008-01-01

    Objective: Traditional nasolacrimal duct stenting possesses some shortcoming including difficulty of pulling ball head guide wire from the nasal cavity with turbinate hypertrophy and nasal septal deviation. The new method of nose-oral tube track establishment can overcome the forementioned and increase the successful rate. Methods: 5 F catheter and arterial sheath were modified to be nasolacrimal duct stent delivery device respectively. Antegrade dacryocystography was taken firstly to display the obstructed site and followed by the modified protocol of inserting the guide wire through nasolacrimal duct and nasal cavity, and establishing the stent delivery track for retrograde stent placement. Results: 5 epiphora patients with failure implantation by traditional method were all succeeded through the modified stenting (100%). During 6-mouth follow-up, no serious complications and reocclusion occurred. Conclusion: The establishment of eye-nose-mouth-nose of external nasal guide wire track can improve the successful rate of nasolacrimal duct stenting. (authors)

  16. Normal modified stable processes

    DEFF Research Database (Denmark)

    Barndorff-Nielsen, Ole Eiler; Shephard, N.

    2002-01-01

    Gaussian (NGIG) laws. The wider framework thus established provides, in particular, for added flexibility in the modelling of the dynamics of financial time series, of importance especially as regards OU based stochastic volatility models for equities. In the special case of the tempered stable OU process......This paper discusses two classes of distributions, and stochastic processes derived from them: modified stable (MS) laws and normal modified stable (NMS) laws. This extends corresponding results for the generalised inverse Gaussian (GIG) and generalised hyperbolic (GH) or normal generalised inverse...

  17. Nonlinearities in modified gravity cosmology: Signatures of modified gravity in the nonlinear matter power spectrum

    International Nuclear Information System (INIS)

    Cui Weiguang; Zhang Pengjie; Yang Xiaohu

    2010-01-01

    A large fraction of cosmological information on dark energy and gravity is encoded in the nonlinear regime. Precision cosmology thus requires precision modeling of nonlinearities in general dark energy and modified gravity models. We modify the Gadget-2 code and run a series of N-body simulations on modified gravity cosmology to study the nonlinearities. The modified gravity model that we investigate in the present paper is characterized by a single parameter ζ, which determines the enhancement of particle acceleration with respect to general relativity (GR), given the identical mass distribution (ζ=1 in GR). The first nonlinear statistics we investigate is the nonlinear matter power spectrum at k < or approx. 3h/Mpc, which is the relevant range for robust weak lensing power spectrum modeling at l < or approx. 2000. In this study, we focus on the relative difference in the nonlinear power spectra at corresponding redshifts where different gravity models have the same linear power spectra. This particular statistics highlights the imprint of modified gravity in the nonlinear regime and the importance of including the nonlinear regime in testing GR. By design, it is less susceptible to the sample variance and numerical artifacts. We adopt a mass assignment method based on wavelet to improve the power spectrum measurement. We run a series of tests to determine the suitable simulation specifications (particle number, box size, and initial redshift). We find that, the nonlinear power spectra can differ by ∼30% for 10% deviation from GR (|ζ-1|=0.1) where the rms density fluctuations reach 10. This large difference, on one hand, shows the richness of information on gravity in the corresponding scales, and on the other hand, invalidates simple extrapolations of some existing fitting formulae to modified gravity cosmology.

  18. Acid-degradable and bioerodible modified polyhydroxylated materials

    Energy Technology Data Exchange (ETDEWEB)

    Frechet, Jean M. J.; Bachelder, Eric M.; Beaudette, Tristan T.; Broaders, Kyle E.

    2017-05-09

    Compositions and methods of making a modified polyhydroxylated polymer comprising a polyhydroxylated polymer having reversibly modified hydroxyl groups, whereby the hydroxyl groups are modified by an acid-catalyzed reaction between a polydroxylated polymer and a reagent such as acetals, aldehydes, vinyl ethers and ketones such that the modified polyhydroxylated polymers become insoluble in water but freely soluble in common organic solvents allowing for the facile preparation of acid-sensitive materials. Materials made from these polymers can be made to degrade in a pH-dependent manner. Both hydrophobic and hydrophilic cargoes were successfully loaded into particles made from the present polymers using single and double emulsion techniques, respectively. Due to its ease of preparation, processability, pH-sensitivity, and biocompatibility, of the present modified polyhydroxylated polymers should find use in numerous drug delivery applications.

  19. Modified General Relativity and Cosmology

    Science.gov (United States)

    Abdel-Rahman, A.-M. M.

    1997-10-01

    Aspects of the modified general relativity theory of Rastall, Al-Rawaf and Taha are discussed in both the radiation- and matter-dominated flat cosmological models. A nucleosynthesis constraint on the theory's free parameter is obtained and the implication for the age of the Universe is discussed. The consistency of the modified matter- dominated model with the neoclassical cosmological tests is demonstrated.

  20. Chromatin-modifying proteins in cancer

    DEFF Research Database (Denmark)

    Fog, Cathrine K; Jensen, Klaus T; Lund, Anders Henrik

    2007-01-01

    -despite the fact that all cells in the organism contain the same genetic information. A large amount of data gathered over the last decades has demonstrated that deregulation of chromatin-modifying proteins is etiologically involved in the development and progression of cancer. Here we discuss how epigenetic...... alterations influence cancer development and review known cancer-associated alterations in chromatin-modifying proteins....

  1. 21 CFR 184.1063 - Enzyme-modified lecithin.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Enzyme-modified lecithin. 184.1063 Section 184.1063... Listing of Specific Substances Affirmed as GRAS § 184.1063 Enzyme-modified lecithin. (a) Enzyme-modified lecithin is prepared by treating lecithin with either phospholipase A2 (EC 3.1.1.4) or pancreatin. (b) The...

  2. Penumbra modifier for optimal electron fields combination

    International Nuclear Information System (INIS)

    ElSherbini, N.; Hejazy, M.A.; Khalil, W.

    2003-01-01

    Abutment of two or more electron fields to irradiate extended areas may lead to significant dose inhomogeneities in the junction region. This study describes the geometric and dosimetric characteristics of a device developed to modify the penumbra of an electron beam and therapy improve of dose uniformity in the over lap region when fields are abutted. The device is lipowitz metal block placed on top of the insertion plate of the electron applicator and positioned to stop part of he electron beam on side of field abutment. The air-scattered electrons beyond the block increase the penumbra width from about 1,4 to 2-7-43.4 cm at SSD 100 cm, the modified penumbra is broad and almost linear at all depths for the 6.8, and 15 MeV electron beams used. Film dosimetry was used to obtain profiles, iso-dose distributions, single modified beams and matched fields of 6, 10, and 15 MeV. Wellhofer dosimetry system was used to obtain beam profiles and iso-dose distributions of single modified beams needed for CADPLAN treatment planning system, which used to optimize and compare the skin gap to be used and to quantify the dose uniformity in a junction of the field separation for both modified and non-modified beams. Results are presented for various field configurations without the penumbra modifier; lateral setup error of 2-3 mm may introduce dose variations of 20% or more in the junction region. Similar setup error cause less than 5% dose variations when the penumbra modifier is used to match the field

  3. Weak lensing probes of modified gravity

    International Nuclear Information System (INIS)

    Schmidt, Fabian

    2008-01-01

    We study the effect of modifications to general relativity on large-scale weak lensing observables. In particular, we consider three modified gravity scenarios: f(R) gravity, the Dvali-Gabadadze-Porrati model, and tensor-vector-scalar theory. Weak lensing is sensitive to the growth of structure and the relation between matter and gravitational potentials, both of which will in general be affected by modified gravity. Restricting ourselves to linear scales, we compare the predictions for galaxy-shear and shear-shear correlations of each modified gravity cosmology to those of an effective dark energy cosmology with the same expansion history. In this way, the effects of modified gravity on the growth of perturbations are separated from the expansion history. We also propose a test which isolates the matter-potential relation from the growth factor and matter power spectrum. For all three modified gravity models, the predictions for galaxy and shear correlations will be discernible from those of dark energy with very high significance in future weak lensing surveys. Furthermore, each model predicts a measurably distinct scale dependence and redshift evolution of galaxy and shear correlations, which can be traced back to the physical foundations of each model. We show that the signal-to-noise for detecting signatures of modified gravity is much higher for weak lensing observables as compared to the integrated Sachs-Wolfe effect, measured via the galaxy-cosmic microwave background cross-correlation.

  4. The relationship between skin symptoms and the scleroderma modification of the health assessment questionnaire, the modified Rodnan skin score, and skin pathology in patients with systemic sclerosis.

    Science.gov (United States)

    Ziemek, Jessica; Man, Ada; Hinchcliff, Monique; Varga, John; Simms, Robert W; Lafyatis, Robert

    2016-05-01

    To determine how well skin symptoms considered specific to SSc are captured by patient reported outcomes currently used for assessing patients with SSc, the SHAQ, or skin disease, the Skindex-29; and how well these symptoms correlate with the extent of skin disease on physical exam and skin pathology. SSc patients completed the scleroderma modification of the Health Assessment Questionnaire (SHAQ), Skindex-29 and a Skin Symptom Assessment questionnaire developed for this study. Correlations were assessed between the Skin Symptom Assessment and SHAQ, Skindex-29, modified Rodnan skin score, and skin pathological features including myofibroblast staining completed on the same date. Tight, hard and rigid/stiff skin symptoms correlated moderately highly with the modified Rodnan skin score (r = 0.445, P = 0.0008; r = 0.486, P = 0.0002; and r = 0.488, P = 0.0002, respectively). Tight skin symptoms correlated moderately with myofibroblast infiltration (r = 0.544, P = 0.0023) and hyalinized collagen (r = 0.442, P = 0.0164), while both hard and rigid/stiff skin correlated moderately with inflammation (r = 0.401, P = 0.0310 and r = 0.513, P = 0.0045), myofibroblast infiltration(r = 0.480, P = 0.0084 and r = 0.527, P = 0.0033) and hyalinized collagen (r = 0.453, P = 0.0137 and r = 0.478, P = 0.0087), while the SHAQ was not found to correlate with any of these pathological changes. In contrast, painful skin symptoms correlated moderately with the SHAQ (r = 0.413, P = 0.0073), and with the three domains of Skindex-29: Symptoms, Emotions and Functioning. Skindex-29 indicates that dcSSc patient skin symptoms are nearly as severe as those of patients with psoriasis or atopic dermatitis. Patient reported skin symptoms correlate with clinical and pathological measures in the skin. A validated patient reported skin symptom instrument might considerably improve evaluation of SSc skin disease. © The Author 2016. Published by Oxford University Press on behalf of the British Society for

  5. Genotoxicity of unmodified and organo-modified montmorillonite

    DEFF Research Database (Denmark)

    Sharma, Anoop Kumar; Schmidt, Bjørn; Frandsen, Henrik Lauritz

    2010-01-01

    absent in the filtered samples, which was independently confirmed by dynamic light-scattering measurements. Detection and identification of free quaternary ammonium modifier in the filtered sample was carried out by HPLC-Q-TOF/MS and revealed a total concentration of a mixture of quaternary ammonium...... assay, none of the clays produced ROS in a cell-free test system (the DCFH-DA assay). Inductively coupled plasma mass-spectrometry (ICP-MS) was used to detect clay particles in the filtered samples using aluminium as a tracer element characteristic to clay. The results indicated that clay particles were...... analogues of 1.57 mu g/ml. These findings suggest that the genotoxicity of organo-modified montmorillonite was caused by the organo-modifier. The detected organo-modifier mixture was synthesized and comet-assay results showed that the genotoxic potency of this synthesized organo-modifier was in the same...

  6. Modifying Knowledge, Emotions, and Attitudes Regarding Genetically Modified Foods

    Science.gov (United States)

    Heddy, Benjamin C.; Danielson, Robert W.; Sinatra, Gale M.; Graham, Jesse

    2017-01-01

    The purpose of this study was to explore whether conceptual change predicted emotional and attitudinal change while learning about genetically modified foods (GMFs). Participants were 322 college students; half read a refutation text designed to shift conceptual knowledge, emotions, and attitudes, while the other half served as a control group.…

  7. A Patient with Multiple Keratinocytic Cancers (MKC: Uncommon Presentation in a Bulgarian Patient

    Directory of Open Access Journals (Sweden)

    Georgi Tchernev

    2018-01-01

    Full Text Available Keratinocyte skin cancers, including basal cell carcinoma (BCC and squamous cell carcinoma (SCC, are the most common cancer occurring in people with fair skin, worldwide. Despite all known triggers, several suggested contributors are still investigated. We will focus our attention on the personal history of previous cancers and radiation exposure as occupational risk factors, as in the presented case. We report a patient, with multiple BCCs, and subsequent occurrence of a SCC on photo-exposed area of the face, as we want to emphasize the importance of strict following up of these patients, regarding the risk for developing new tumors in short periods of time, no matter if the triggering exposure factor is known from the history, or not.  Although keratinocytes tumours are associated with the low mortality rate, we focus the attention on the fact, that the history of non-melanoma skin cancer is associated with increased mortality.

  8. A Patient with Multiple Keratinocytic Cancers (MKC): Uncommon Presentation in a Bulgarian Patient.

    Science.gov (United States)

    Tchernev, Georgi; Philipov, Stanislav; Chokoeva, Anastasiya Atanasova; Wollina, Uwe; Lotti, Torello; Lozev, Ilia; Yungareva, Irina; Maximov, Georgi Konstantinov

    2018-01-25

    Keratinocyte skin cancers, including basal cell carcinoma (BCC) and squamous cell carcinoma (SCC), are the most common cancer occurring in people with fair skin, worldwide. Despite all known triggers, several suggested contributors are still investigated. We will focus our attention on the personal history of previous cancers and radiation exposure as occupational risk factors, as in the presented case. We report a patient, with multiple BCCs, and subsequent occurrence of a SCC on photo-exposed area of the face, as we want to emphasize the importance of strict following up of these patients, regarding the risk for developing new tumors in short periods of time, no matter if the triggering exposure factor is known from the history, or not. Although keratinocytes tumours are associated with the low mortality rate, we focus the attention on the fact, that the history of non-melanoma skin cancer is associated with increased mortality.

  9. MODIFIED TECHNIQUE OF TOTAL LARYNGECTOMY

    Directory of Open Access Journals (Sweden)

    Predrag Spirić

    2010-12-01

    Full Text Available Surgical technique of total laryngectomy is well presented in many surgical textbooks. Essentially, it has remained the same since Gluck an Soerensen in 1922 described all its details. Generally, it stresses the U shape skin incision with releasing laryngeal structures and removing larynx from up to down. Further, pharyngeal reconstruction is performed with different kinds of sutures in two or more layers and is finished with skin suture and suction drainage. One of worst complications following this surgery is pharyngocutaneous fistula (PF. Modifications proposed in this this article suggests vertical skin incision with larynx removal from below upwards. In pharyngeal reconstruction we used the running locked suture in submucosal plan with „tobacco sac“ at the end on the tongue base instead of traditional T shaped suture. Suction drains were not used.The aim of study was to present the modified surgical technique of total laryingectomy and its impact on hospital stay duration and pharyngocutanous fistula formation. In this randomized study we analyzed 49 patients operated with modified surgical technique compared to 49 patient operated with traditional surgical technique of total laryngectomy. The modified technique of total laryngectomy was presented. Using modified technique we managed to decrease the PF percentage from previous 20,41% to acceptable 8,16% (p=0,0334. Also, the average hospital stay was shortened from 14,96 to 10,63 days (t =-2.9850; p=0.0358.The modified technique of total laryngectomy is safe, short and efficient surgical intervention which decreases the number of pharyngocutaneos fistulas and shortens the hospital stay.

  10. Properties of Direct Coal Liquefaction Residue Modified Asphalt Mixture

    Directory of Open Access Journals (Sweden)

    Jie Ji

    2017-01-01

    Full Text Available The objectives of this paper are to use Direct Coal Liquefaction Residue (DLCR to modify the asphalt binders and mixtures and to evaluate the performance of modified asphalt mixtures. The dynamic modulus and phase angle of DCLR and DCLR-composite modified asphalt mixture were analyzed, and the viscoelastic properties of these modified asphalt mixtures were compared to the base asphalt binder SK-90 and Styrene-Butadiene-Styrene (SBS modified asphalt mixtures. The master curves of the asphalt mixtures were shown, and dynamic and viscoelastic behaviors of asphalt mixtures were described using the Christensen-Anderson-Marasteanu (CAM model. The test results show that the dynamic moduli of DCLR and DCLR-composite asphalt mixtures are higher than those of the SK-90 and SBS modified asphalt mixtures. Based on the viscoelastic parameters of CAM models of the asphalt mixtures, the high- and low-temperature performance of DLCR and DCLR-composite modified asphalt mixtures are obviously better than the SK-90 and SBS modified asphalt mixtures. In addition, the DCLR and DCLR-composite modified asphalt mixtures are more insensitive to the frequency compared to SK-90 and SBS modified asphalt mixtures.

  11. Public attitudes towards genetically-modified food

    NARCIS (Netherlands)

    Miles, S.; Ueland, O.; Frewer, L.J.

    2005-01-01

    Abstract: Purpose - This study aimed to investigate the impact of information about traceability and new detection methods for identifying genetically-modified organisms in food, on consumer attitudes towards genetically-modified food and consumer trust in regulators in Italy, Norway and England. It

  12. Thermal oxidative degradation of wood modified with aminophenylborates

    Directory of Open Access Journals (Sweden)

    Klyachenkova Olga

    2016-01-01

    Full Text Available Comparative thermal analysis in the presence of oxygen was carried out for samples of native pine wood and wood samples modified with aminophenylborates. Significant decrease in the amount of heat released during thermal decomposition of the modified samples was established, which is due to the increase of carbonaceous residues on the surface. Reduction of heat release during decomposition of the modified samples may be explained by the lower yield of combustible volatile products as well as by thin film of boron oxide, formed on the surface of the modified wood, that partially reflects heat flow. Produced upon the modifier decomposition water vapor and inert nitrogen oxides dilute gaseous mixture near the wood surface and isolate it from oxygen. This enhances fire-resistance of wood modified with mono- and diethanolamine(N→Bphenylborates. Hydroxyl group at the sixth carbon atom of the glucopyranose ring of cellulose participates in reactions of cellulose modification, which prevents formation of flammable levoglucosan and, consequently, improves the fire-resistance of the modified wood.

  13. Allosteric regulation of epigenetic modifying enzymes.

    Science.gov (United States)

    Zucconi, Beth E; Cole, Philip A

    2017-08-01

    Epigenetic enzymes including histone modifying enzymes are key regulators of gene expression in normal and disease processes. Many drug development strategies to target histone modifying enzymes have focused on ligands that bind to enzyme active sites, but allosteric pockets offer potentially attractive opportunities for therapeutic development. Recent biochemical studies have revealed roles for small molecule and peptide ligands binding outside of the active sites in modulating the catalytic activities of histone modifying enzymes. Here we highlight several examples of allosteric regulation of epigenetic enzymes and discuss the biological significance of these findings. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Characterization of lime mortar additivated with crystallization modifiers

    NARCIS (Netherlands)

    Granneman, S.J.C.; Lubelli, B.; van Hees, R.P.J.

    2018-01-01

    Additivating mortars with crystallization modifiers is a novel approach to mitigate salt crystallization damage in historic masonry. Once verified the effectiveness of crystallization modifiers in bulk solution, the next step consists in verifying whether: (i) modifiers are still effective when

  15. Contribution of ARLTS1 Cys148Arg (T442C variant with prostate cancer risk and ARLTS1 function in prostate cancer cells.

    Directory of Open Access Journals (Sweden)

    Sanna Siltanen

    Full Text Available ARLTS1 is a recently characterized tumor suppressor gene at 13q14.3, a region frequently deleted in both sporadic and hereditary prostate cancer (PCa. ARLTS1 variants, especially Cys148Arg (T442C, increase susceptibility to different cancers, including PCa. In this study the role of Cys148Arg substitution was investigated as a risk factor for PCa using both genetic and functional analysis. Cys148Arg genotypes and expression of the ARLTS1 were explored in a large set of familial and unselected PCa cases, clinical tumor samples, xenografts, prostate cancer cell lines and benign prostatic hyperplasia (BPH samples. The frequency of the variant genotype CC was significantly higher in familial (OR = 1.67, 95% CI = 1.08-2.56, P = 0.019 and unselected patients (OR = 1.52, 95% CI = 1.18-1.97, P = 0.001 and the overall risk was increased (OR = 1.54, 95% CI = 1.20-1.98, P = 0.0007. Additional analysis with clinicopathological data revealed an association with an aggressive disease (OR = 1.28, 95% CI = 1.05-∞, P = 0.02. The CC genotype of the Cys148Arg variant was also contributing to the lowered ARLTS1 expression status in lymphoblastoid cells from familial patients. In addition significantly lowered ARLTS1 expression was observed in clinical tumor samples compared to BPH samples (P = 0.01. The ARLTS1 co-expression signature based on previously published microarray data was generated from 1587 cancer samples confirming the low expression of ARLTS1 in PCa and showed that ARLTS1 expression was strongly associated with immune processes. This study provides strong confirmation of the important role of ARLTS1 Cys148Arg variant as a contributor in PCa predisposition and a potential marker for aggressive disease outcome.

  16. Post-irradiation hardness of resin-modified glass ionomer cements and a polyacid-modified composite resin

    International Nuclear Information System (INIS)

    Yap, A.U.J.

    1997-01-01

    This study examined the post-irradiation hardness of resin-modified glass ionomer cements and a polyacid-modified composite resin using a digital microhardness tester. Change in hardness of these materials over a period of 6 months was compared to that of conventional glass ionomer cements and a composite resin. With the exception of the composite resin, all materials showed a significant increase in hardness over 24 h after their initial set. Dual-cure resin-modified glass ionomer cements showed decreased hardness with increased storage time in saline at 37 o C. Results suggest that the addition of resins to glass ionomer cements does not improve initial hardness and does not negate the acid-base reaction of conventional cements. Resin addition may, however, lead to increased water sorption and decreased hardness. (author)

  17. Biotechnology: Two Decades of Experimentation with Genetically Modified Foods

    Directory of Open Access Journals (Sweden)

    Marjan Ajami

    2016-10-01

    Full Text Available Background and Objective: Over the recent years, genetically modified food in varieties of corn, soybeans, canola and cotton have been introduced to the global market. This study reviews the health and nutritional value of genetically modified foods in the past two decades.Results and Conclusions: Contrary to the present biotechnological claims, transgenic products did not prove to be so flawless, and actually failed to maintain social satisfaction. Genetically modified foods could not gain an increase in the yield potential. Planting natural products and genetically modified products in parallel lines will absolutely result in genetic infection from the side of genetically modified foods. One of the major anxieties of the anti- genetically modified foods activism is the claim that genetically modified crops would alter the consumable parts of the plant quality and safety. Genetically modified foods have shown to have inadequate efficiency and potential adverse effects in both fields of health and biodiversity. This review has presented studies of genetically modified foods performances in the past two decades, and concludes that the wide application and the over generalization of genetically modified foods are not fundamentally recommended.Conflict of interest: Authors declare that there is no conflict of interest.

  18. Glucose Oxidation on Gold-modified Copper Electrode

    Energy Technology Data Exchange (ETDEWEB)

    Lim, Jieun; Pyo, Sung Gyu; Son, Hyungbin; Kim, Sookil [Chung-Ang Univ., Seoul (Korea, Republic of); Ahn, Sang Hyun; Son, Hyungbin [Korea Institute of Science and Technology, Seoul (Korea, Republic of)

    2013-09-15

    The activities of Au-modified Cu electrodes toward glucose oxidation are evaluated according to their fabrication conditions and physico-chemical properties. The Au-modified Cu electrodes are fabricated by the galvanic displacement of Au on a Cu substrate and the characteristics of the Au particles are controlled by adjusting the displacement time. From the glucose oxidation tests, it is found that the Au modified Cu has superior activity to the pure Au or Cu film, which is evidenced by the negative shift in the oxidation potential and enhanced current density during the electrochemical oxidation. Though the activity of the Au nanoparticles is a contributing factor, the enhanced activity of the Au-modified Cu electrode is due to the increased oxidation number of Cu through the electron transfer from Cu to more electronegative Au. The depletion of electron in Cu facilitates the oxidation of glucose. The stability of the Au-modified Cu electrode was also studied by chronoamperometry.

  19. Genetically Modified Products – Contradictions and Challenges

    OpenAIRE

    Rodica Pamfilie; Lavinia-Alexandra Cristescu

    2011-01-01

    This paper aims to identify the perception that consumers have about GM products, also taking into consideration the evolution of consumption and production of products based on genetically modified organisms. Therefore, the paper presents both aspects to clarify the concept of genetically modified organism (GMO issues such as typology, national or international regulations regarding this area) and global market development of genetically modified organisms, evolution which is presented by st...

  20. Cadmium Adsorption on HDTMA Modified Montmorillionite

    Directory of Open Access Journals (Sweden)

    Mohd. Elmuntasir I. Ahmed

    2009-06-01

    Full Text Available In this paper the possibility of cadmium removal from aqueous solutions by adsorption onto modified montmorillonite clay is investigated. Batch adsorption experiments performed revealed an enhanced removal of cadmium using HDTMA modified montmorillonite to 100% of its exchange capacity. Modified montmorillonite adsorption capacity increases at higher pHs suggesting adsorption occurs as a result of surface precipitation and HDTMA complex formation due to the fact that the original negatively charged montmorillonite is now covered by a cationic layer of HDTMA. Adsorption isotherms generated followed a Langmuir isotherm equation possibly indicating a monolayer coverage. Adsorption capacities of up to 49 mg/g and removals greater than 90% were achieved. Anionic selectivity of the HDTMA modified monmorillonite is particularly advantageous in water treatment applications where high concentrations of less adsorbable species are present, and the lack of organoclay affinity for these species may allow the available capacity to be utilized selectively by the targeted species.

  1. Genetically Modified Organisms

    Directory of Open Access Journals (Sweden)

    Claro Llaguno

    2001-06-01

    Full Text Available Recent reports have brought to public attention concerns about Bt corn and genetically modified organisms (GMO in general. The timing, it seems, is most appropriate considering two related developments early this year: the final approval of the Cartagena Protocol on Biosafety in Montreal on January 29, 2001, and the OECD Edinburgh Conference on GM food safety last February 28- March 1, 2001. The protocol makes clear that GMOs include all living modified organisms (LMO defined as "any living organism that possesses a novel combination of genetic material obtained through the use of modern biotechnology". This includes seeds, live fish, and other organisms intentionally obtained for release to the environment. It would seem that the common understanding about GMOs as referring to farm-to-table products is perforce expanded to embrace genetically modified farm animals and aquatic resources. Being a trade agreement, the Montreal accord primarily deals with the safety issues related to the transboundary movement of LMOs around the globe. The OECD conference on the other hand, called for an international body "to address all sides of the GM debate" in response to the public outcry, particularly in Western Europe, regarding the risks the new products pose to human health and the environment. Some points of contention, which remain unresolved, include issues such as whether countries should be allowed to develop their own GM food based on their needs, and whether a global moratorium on GMOs and mandatory labeling should be enforced worldwide.

  2. Modifiable risk factors of hypertension and socio demographic ...

    African Journals Online (AJOL)

    Background: Factors associated with the development of hypertension can be categorized into modifiable and non‑modifiable risk factors. The modifiable risk factors include obesity, physical inactivity, high salt diet, smoking alcohol consumption and others. Aim: This study was aimed to determine the prevalence of ...

  3. Functional properties of unmodified and modified Jack bean ...

    African Journals Online (AJOL)

    The native Jack bean (Canavalia eniformis) starch was chemically modified through oxidation and acetylation. Proximate composition analysis revealed higher moisture, protein, fat and ash contents 'native unmodified than modified starches and higher yield in modified starches. Swelling capacity and solubility of all the ...

  4. Modified Faraday cup

    Science.gov (United States)

    Elmer, John W.; Teruya, Alan T.; O'Brien, Dennis W.

    1996-01-01

    A tomographic technique for measuring the current density distribution in electron beams using electron beam profile data acquired from a modified Faraday cup to create an image of the current density in high and low power beams. The modified Faraday cup includes a narrow slit and is rotated by a stepper motor and can be moved in the x, y and z directions. The beam is swept across the slit perpendicular thereto and controlled by deflection coils, and the slit rotated such that waveforms are taken every few degrees form 0.degree. to 360.degree. and the waveforms are recorded by a digitizing storage oscilloscope. Two-din-tensional and three-dimensional images of the current density distribution in the beam can be reconstructed by computer tomography from this information, providing quantitative information about the beam focus and alignment.

  5. Oligo(naphthylene–ethynylene) Molecular Rods

    DEFF Research Database (Denmark)

    Cramer, Jacob Roland; Ning, Yanxiao; Shen, Cai

    2013-01-01

    of palladium-catalyzed Sonogashira reactions between naphthyl halides and acetylenes. The triazene functionality was used as a protected iodine precursor to allow linear extension of the molecular rods during the synthe-ses. The carboxylic acid groups in the target molecules were protected as esters during......Molecular rods designed for surface chirality studies have been synthesized in high yields. The molecules are composed of oligo(naphthylene–ethynylene) skeletons and functionalized at their two termini with carboxylic acids and hydrophobic groups. The molecular skeletons were constructed by means...

  6. Development of certified matrix-based reference material of genetically modified rice event TT51-1 for real-time PCR quantification.

    Science.gov (United States)

    Jiang, Yu; Yang, Hui; Quan, Sheng; Liu, Yinan; Shen, Ping; Yang, Litao

    2015-09-01

    In 2009, the genetically modified (GM) rice event TT51-1 with an engineered insect resistance trait became the first GM rice event to be granted certification for safe production in China, and its derivative lines Bt 63 and Huahui No.1 are expected to be commercialized soon. The development of certified reference material (CRM) for TT51-1 is necessary to monitor and inspect the TT51-1 event and its derivates. In this work, we developed four matrix-based TT51-1 rice CRMs (TT51-1a, TT51-1b, TT51-1c, and TT51-1d) with different TT51-1 mass fraction ratios by blending seed powders of homozygous TT51-1 and its recipient cultivar Minghui 63. The between-bottle homogeneity and the within-bottle homogeneity were tested, and good results were obtained. The potential degradation during transportation and shelf life were evaluated, and demonstrated an expiration period of at least 36 months. The characterization values of the four TT51-1 CRMs based on the mass fraction ratio were 1000.000 ± 51.430 g/kg, 49.940 ± 4.620 g/kg, 9.990 ± 1.110 g/kg, and 4.990 ± 0.620 g/kg, respectively. The characterization values based on the copy number ratio were certified by digital PCR analysis as 97.442 ± 5.253 %, 4.851 ± 0.486 %, 1.042 ± 0.135 %, and 0.556 ± 0.073 %, respectively. These results suggested that the TT51-1 matrix-based CRMs developed are of high quality and can be used as potential calibrators for TT51-1 GM rice inspection and monitoring.

  7. Comparison of the Amount of Fluoride Release from Nanofilled Resin Modified Glass Ionomer Conventional and Resin Modified Glass Ionomer Cements

    Directory of Open Access Journals (Sweden)

    Sumitha Upadhyay

    2013-01-01

    Full Text Available Objective: To investigate and compare the amount of fluoride release of conventional, resin modified and nanofilled resin modified glass ionomer cements.Materials and Methods: Tablets of glass-ionomer cements were immersed in deionized water and incubated at 37◦C. After 1, 2, 7, 15 and 30 days, fluoride ion was measured under normal atmospheric conditions by fluoride ion selective electrode. Buffer (TISAB II was used to decomplex the fluoride ion and to provide a constant background ionic strength and to maintain the pH of water between 5.0 and 5.5 as the fluoride electrode is sensitive to changes in pH. Statistical evaluation was carried out by one way ANOVA (Analysis of Variance using SPSS 11.0. The significance level was set at p< 0.05.Results: The release of fluoride was highest on day 1 and there was a sudden fall on day 2 in all three groups. Initially fluoride release from conven-tional glass-ionomer cement was highest compared to the other two glass-ionomer cements, but the amount drastically reduced over the period. Although the amount of fluoride release was less than both the resin modified and nanofilled resin modified glass-ionomer cement, the release was sustained consistently for 30 daysConclusion: The cumulative fluoride release of nanofilled resin modified glass ionomer cement was very less compared to the conventional and resin modified glass ionomer cements and Nanofilled resin modified glass ionomer cement released less but steady fluoride as compared to other resin modified glass ionomer cements.

  8. Eigenvalue Decomposition-Based Modified Newton Algorithm

    Directory of Open Access Journals (Sweden)

    Wen-jun Wang

    2013-01-01

    Full Text Available When the Hessian matrix is not positive, the Newton direction may not be the descending direction. A new method named eigenvalue decomposition-based modified Newton algorithm is presented, which first takes the eigenvalue decomposition of the Hessian matrix, then replaces the negative eigenvalues with their absolute values, and finally reconstructs the Hessian matrix and modifies the searching direction. The new searching direction is always the descending direction. The convergence of the algorithm is proven and the conclusion on convergence rate is presented qualitatively. Finally, a numerical experiment is given for comparing the convergence domains of the modified algorithm and the classical algorithm.

  9. The Modified Enskog Equation for Mixtures

    NARCIS (Netherlands)

    Beijeren, H. van; Ernst, M.H.

    1973-01-01

    In a previous paper it was shown that a modified form of the Enskog equation, applied to mixtures of hard spheres, should be considered as the correct extension of the usual Enskog equation to the case of mixtures. The main argument was that the modified Enskog equation leads to linear transport

  10. Constraints on modified gravity models from white dwarfs

    Energy Technology Data Exchange (ETDEWEB)

    Banerjee, Srimanta; Singh, Tejinder P. [Department of Astronomy and Astrophysics, Tata Institute of Fundamental Research, Mumbai 400005, Maharashtra (India); Shankar, Swapnil, E-mail: srimanta.banerjee@tifr.res.in, E-mail: swapnil.shankar@cbs.ac.in, E-mail: tpsingh@tifr.res.in [Department of Physics, Centre for Excellence in Basic Sciences, Mumbai 400098, Maharashtra (India)

    2017-10-01

    Modified gravity theories can introduce modifications to the Poisson equation in the Newtonian limit. As a result, we expect to see interesting features of these modifications inside stellar objects. White dwarf stars are one of the most well studied stars in stellar astrophysics. We explore the effect of modified gravity theories inside white dwarfs. We derive the modified stellar structure equations and solve them to study the mass-radius relationships for various modified gravity theories. We also constrain the parameter space of these theories from observations.

  11. Carbon Dioxide Adsorption Behavior of Modified HKUST-1

    Science.gov (United States)

    Ma, Lan; Tang, Huamin; Zhou, Chaohua; Zhang, Hongpeng; Yan, Chunxiao; Hu, Xiaochun; Yang, Yang; Yang, Weiwei; Li, Yuming; He, Dehua

    2014-12-01

    A kind of typical metal-organic frameworks (MOFs) material, HKUST-1 was prepared by hydrothermal method and characterized by XRD and SEM. The results of characterizations manifested that HKUST-1 showed a regular octahedral crystal structure. The as-prepared HKUST-1 was modified by several kinds of organic base materials and the CO2 adsorption behaviors of modified HKUST-1 materials were evaluated. The CO2 adsorption capacities of different base modified HKUST-1 varied with the base intensity of modified organic base materials.

  12. Modified teleparallel gravity: Inflation without an inflaton

    International Nuclear Information System (INIS)

    Ferraro, Rafael; Fiorini, Franco

    2007-01-01

    The Born-Infeld strategy to smooth theories having divergent solutions is applied to the teleparallel equivalent of general relativity. Differing from other theories of modified gravity, modified teleparallelism leads to second order equations, since the teleparallel Lagrangian only contains first derivatives of the vierbein. We show that the Born-Infeld-modified teleparallelism solves the particle horizon problem in a spatially flat Friedmann-Robertson-Walker (FRW) universe by providing an initial exponential expansion without resorting to an inflaton field

  13. Magnetically modified biocells in constant magnetic field

    Energy Technology Data Exchange (ETDEWEB)

    Abramov, E.G.; Panina, L.K. [Saint Petersburg State University, St. Petersburg (Russian Federation); Kolikov, V.A., E-mail: kolikov1@yandex.ru [Institute for Electrophysics and Electric Power of the RAS, St. Petersburg (Russian Federation); Bogomolova, E.V. [Botanical Institute of the RAS after V.L.Komarov, St. Petersburg (Russian Federation); Snetov, V.N. [Institute for Electrophysics and Electric Power of the RAS, St. Petersburg (Russian Federation); Cherepkova, I.A. [Saint Petersburg State Institute of Technology, St. Petersburg (Russian Federation); Kiselev, A.A. [Institute for Electrophysics and Electric Power of the RAS, St. Petersburg (Russian Federation)

    2017-02-01

    Paper addresses the inverse problem in determining the area, where the external constant magnetic field captures the biological cells modified by the magnetic nanoparticles. Zero velocity isolines, in area where the modified cells are captured by the magnetic field were determined by numerical method for two locations of the magnet. The problem was solved taking into account the gravitational field, magnetic induction, density of medium, concentration and size of cells, and size and magnetization of nanoparticles attached to the cell. Increase in the number of the nanoparticles attached to the cell and decrease in the cell’ size, enlarges the area, where the modified cells are captured and concentrated by the magnet. Solution is confirmed by the visible pattern formation of the modified cells Saccharomyces cerevisiae. - Highlights: • The inverse problem was solved for finding zero velocity isolines of magnetically modified biological cells. • Solution of the inverse problem depends on the size of cells and the number of nanoparticles attached to the single cell. • The experimental data are in agreement with theoretical solution.

  14. Lorentz invariance violation in modified gravity

    International Nuclear Information System (INIS)

    Brax, Philippe

    2012-01-01

    We consider an environmentally dependent violation of Lorentz invariance in scalar-tensor models of modified gravity where General Relativity is retrieved locally thanks to a screening mechanism. We find that fermions have a modified dispersion relation and would go faster than light in an anisotropic and space-dependent way along the scalar field lines of force. Phenomenologically, these models are tightly restricted by the amount of Cerenkov radiation emitted by the superluminal particles, a constraint which is only satisfied by chameleons. Measuring the speed of neutrinos emitted radially from the surface of the earth and observed on the other side of the earth would probe the scalar field profile of modified gravity models in dense environments. We argue that the test of the equivalence principle provided by the Lunar ranging experiment implies that a deviation from the speed of light, for natural values of the coupling scale between the scalar field and fermions, would be below detectable levels, unless gravity is modified by camouflaged chameleons where the field normalisation is environmentally dependent.

  15. Lorentz invariance violation in modified gravity

    Energy Technology Data Exchange (ETDEWEB)

    Brax, Philippe, E-mail: philippe.brax@cea.fr [Institut de Physique Theorique, CEA, IPhT, CNRS, URA 2306, F-91191Gif/Yvette Cedex (France)

    2012-06-06

    We consider an environmentally dependent violation of Lorentz invariance in scalar-tensor models of modified gravity where General Relativity is retrieved locally thanks to a screening mechanism. We find that fermions have a modified dispersion relation and would go faster than light in an anisotropic and space-dependent way along the scalar field lines of force. Phenomenologically, these models are tightly restricted by the amount of Cerenkov radiation emitted by the superluminal particles, a constraint which is only satisfied by chameleons. Measuring the speed of neutrinos emitted radially from the surface of the earth and observed on the other side of the earth would probe the scalar field profile of modified gravity models in dense environments. We argue that the test of the equivalence principle provided by the Lunar ranging experiment implies that a deviation from the speed of light, for natural values of the coupling scale between the scalar field and fermions, would be below detectable levels, unless gravity is modified by camouflaged chameleons where the field normalisation is environmentally dependent.

  16. CONCRETE BASED ON MODIFIED DISPERSE CEMENT SYSTEM

    Directory of Open Access Journals (Sweden)

    D. V. Rudenko

    2016-08-01

    Full Text Available Purpose. The article considers definition of the bond types occurring in a modified cement concrete matrix, and the evaluation of the quality of these links in a non-uniform material to determine the geometrical and physical relationships between the structure and the cement matrix modifiers. Methodology. To achieve this purpose the studies covered the microstructure of dispersed modified concrete cement matrix, the structure formation mechanism of the modified cement concrete system of natural hardening; as well as identification of the methods of sound concrete strength assessment. Findings. The author proposed a model of the spatial structure of the concrete cement matrix, modified by particulate reinforcement crystal hydrates. The initial object of study is a set of volume elements (cells of the cement matrix and the system of the spatial distribution of reinforcing crystallohydrates in these volume elements. It is found that the most dangerous defects such as cracks in the concrete volume during hardening are formed as a result of internal stresses, mainly in the zone of cement matrix-filler contact or in the area bordering with the largest pores of the concrete. Originality. The result of the study is the defined mechanism of the process of formation of the initial strength and stiffness of the modified cement matrix due to the rapid growth of crystallohydrates in the space among the dispersed reinforcing modifier particles. Since the lack of space prevents from the free growth of crystals, the latter cross-penetrate, forming a dense structure, which contributes to the growth of strength. Practical value. Dispersed modifying cement matrix provides a durable concrete for special purposes with the design performance characteristics. The developed technology of dispersed cement system modification, the defined features of its structure formation mechanism and the use of congruence principle for the complex of technological impacts of physical

  17. Modified basin-type solar still

    International Nuclear Information System (INIS)

    El-Mously, M.K.; El-Ashry, M.Y.; El-Iraqi, M.H.

    1981-07-01

    A modified basin-type solar still (BTSS) has been developed. The new idea introduced is to re-use the latent heat due to condensation for increasing the temperature of saline water flowing into the device. A new term had been introduced in the balance of equation of conventional BTSS leading to the increase of the efficiency. According to the suggested model, a modified BTSS had been constructed and tested. It is found that the increase in the efficiency is about 14%. (author)

  18. Isotopically modified compounds

    International Nuclear Information System (INIS)

    Kuruc, J.

    2009-01-01

    In this chapter the nomenclature of isotopically modified compounds in Slovak language is described. This chapter consists of following parts: (1) Isotopically substituted compounds; (2) Specifically isotopically labelled compounds; (3) Selectively isotopically labelled compounds; (4) Non-selectively isotopically labelled compounds; (5) Isotopically deficient compounds.

  19. Modifying Cookbook Labs.

    Science.gov (United States)

    Clark, Robert, L.; Clough, Michael P.; Berg, Craig A.

    2000-01-01

    Modifies an extended lab activity from a cookbook approach for determining the percent mass of water in copper sulfate pentahydrate crystals to one which incorporates students' prior knowledge, engenders active mental struggling with prior knowledge and new experiences, and encourages metacognition. (Contains 12 references.) (ASK)

  20. Breast Cancer Risk From Modifiable and Non-Modifiable Risk Factors among Women in Southeast Asia: A Meta-Analysis

    Science.gov (United States)

    Nindrea, Ricvan Dana; Aryandono, Teguh; Lazuardi, Lutfan

    2017-12-28

    Objective: The aim of this study was to determine breast cancer risk from modifiable and non-modifiable factors among women in Southeast Asia. Methods: This meta-analysis was performed on research articles on breast cancer risk factors in PubMed, ProQuest and EBSCO databases published between 1997 and October 2017. Pooled odds ratios (OR) are calculated using fixed and random-effect models. Data were processed using Review Manager 5.3 (RevMan 5.3). Results: From a total of 1,211 articles, 15 studies (1 cohort and 14 case control studies) met the criteria for systematic review. Meta-analysis results showed that of the known modifiable risk factors for breast cancer, parity (nulipara) had the highest odd ratio (OR = 1.85 [95% CI 1.47-2.32]) followed by body mass index (overweight) (OR = 1.61 [95% CI 1.43-1.80]) and use of oral contraceptives (OR = 1.27 [95% CI 1.07-1.51]). Of non-modifiable risk factors, family history of breast cancer had the highest odd ratio (OR = 2.53 [95% CI 1.25-5.09]), followed by age (≥ 40 years) (OR = 1.53 [95% CI 1.34-1.76]) and menopausal status (OR = 1.44 [95% CI 1.26-1.65]). Conclusion: This analysis confirmed associations between both modifiable risk factors (parity, body mass index and use of oral contraceptives) and non-modifiable risk factors (family history of breast cancer, age and menopausal status) with breast cancer. Creative Commons Attribution License

  1. Chemical composition of silica-based biocidal modifier

    Directory of Open Access Journals (Sweden)

    Grishina Anna Nikolaevna

    2016-11-01

    Full Text Available Increase of the amount of fungi spores and micotixines causes the increase in the number of different diseases. Because of this, ensuring the biological safety in buildings is becoming more and more important today. The preferred way to guarantee the biological safety of a building is to employ modern building materials that prevent the settlement of the fungi colonies on the inner surfaces of walls. Such building materials can be produced using novel biocidal modifiers that allow controlling the number of microorganisms on the surface and in the bulk of a composite construction. The precipitation product of zinc hydrosilicates and sodium sulfate is one of the mentioned modifiers. Till now, the exact chemical composition of such precipitation product is controversial; it is obvious, though, that the efficacy of the biocidal modifier is mostly determined by the type of the copper compounds. In the present work an integrated approach is used for the investigation of the chemical composition of the biocidal modifier. Such an approach consists in the examination of the modifier’s composition by means of different, yet complementary, research methods: X-ray diffraction, infrared spectroscopy and DTA. It is shown that the chemical composition of the modifier mainly depends on the amount of precipitant. X-ray diffraction reveals that the major part of the modifier is represented by amorphous phase. Along with the increase of the precipitant’s amount the crystalline phase Zn4SO4(OH6•xH2O formation takes place. Such a crystalline phase is not appropriate as a component of the biocidal modifier. Another two methods - DTA and IR spectroscopy - reveal that the amorphous phase consists essentially of zinc hydrosilicates.

  2. Genetically modified soybean plants and their ecosystem

    Directory of Open Access Journals (Sweden)

    Milošević Mirjana B.

    2004-01-01

    Full Text Available Transgenic plants are developed by introgressing new genes using methods of molecular genetics and genetic engineering. The presence of these genes in plant genome is identified on the basis of specific oligonucleotides primers, and the use of PCR (Polymerase Chain Reaction and DNA fragments multiplication. Genetically modified plants such as soybean constitute a newly created bioenergetic potential whose gene expression can cause disturbance of the biological balance ecosystem, soil structure and soil microbiological activity. Genetically modified plants may acquire monogenic or polygenic traits causing genetic and physiological changes in these plants, which may elicit a certain reaction of the environment including changes of microbiological composition of soil rhizosphere. The aim of introgressing genes for certain traits into a cultivated plant is to enhance its yield and intensify food production. There are more and more genetically modified plant species such as soybean, corn, potato, rice and others and there is a pressure to use them as human food and animal feed. Genetically modified soybean plants with introgressed gene for resistance to total herbicides, such as Round-up, are more productive than non-modified herbicide-sensitive soybeans.

  3. The McDonald Modified Weibull Distribution: Properties and Applications

    OpenAIRE

    Merovci, Faton; Elbatal, Ibrahim

    2013-01-01

    A six parameter distribution so-called the McDonald modified Weibull distribution is defined and studied. The new distribution contains, as special submodels, several important distributions discussed in the literature, such as the beta modified Weibull, Kumaraswamy modified Weibull, McDonald Weibull and modified Weibull distribution,among others. The new distribution can be used effectively in the analysis of survival data since it accommodates monotone, unimodal and bathtub-shaped hazard fu...

  4. Modified one-way coupled map lattices as communication cryptosystems

    International Nuclear Information System (INIS)

    Zhao Mingchao; Li Kezan; Fu Xinchu

    2009-01-01

    In this paper, we modify the original communication cryptosystem based on OCML (one-way coupled map lattices), and present a modified OCML communication cryptosystem. The modified OCML communication cryptosystem is shown to have some additional advantages compared to the original one, e.g., it has a larger parameter space, and is more capable of anti-error analysis. And, we apply this modified OCML communication cryptosystem for multiplex OCML communication.

  5. Plants having modified response to ethylene

    Science.gov (United States)

    Meyerowitz, E.M.; Chang, C.; Bleecker, A.B.

    1997-11-18

    The invention includes transformed plants having at least one cell transformed with a modified ETR nucleic acid. Such plants have a phenotype characterized by a decrease in the response of at least one transformed plant cell to ethylene as compared to a plant not containing the transformed plant cell. Tissue and/or temporal specificity for expression of the modified ETR nucleic acid is controlled by selecting appropriate expression regulation sequences to target the location and/or time of expression of the transformed nucleic acid. The plants are made by transforming at least one plant cell with an appropriate modified ETR nucleic acid, regenerating plants from one or more of the transformed plant cells and selecting at least one plant having the desired phenotype. 31 figs.

  6. Modified sol-gel coatings for biotechnological applications

    Energy Technology Data Exchange (ETDEWEB)

    Beganskiene, A [Department of General and Inorganic Chemistry, Vilnius University, Vilnius LT-03225 (Lithuania); Raudonis, R [Department of General and Inorganic Chemistry, Vilnius University, Vilnius LT-03225 (Lithuania); Jokhadar, S Zemljic [Faculty of Medicine, Institute of Biophysics, Lipiceva 2, Ljubljana SI-1000 (Slovenia); Batista, U [Faculty of Medicine, Institute of Biophysics, Lipiceva 2, Ljubljana SI-1000 (Slovenia); Kareiva, A [Department of General and Inorganic Chemistry, Vilnius University, Vilnius LT-03225 (Lithuania)

    2007-12-15

    The modified sol-gel derived silica coatings were prepared and characterized. The amino and methyl groups were introduced onto the colloidal silica. The silica coatings with different wettability properties: coloidal silica (water contact angle 17 deg.), polysiloxane (61 deg.), methyl-modified (158 deg. and 46 deg.) coatings samples were tested for CaCo-2 cells proliferation. Methyl-modified coating (46 deg.) proved to be the best substrate for cell proliferation. CaCo-2 cell proliferation two days post seeding was significantly faster on almost laminine, fibronectin and collagen-1 coated samples compared to corresponding controls.

  7. Emission color tuning in AlQ3 complexes with extended conjugated chromophores.

    Science.gov (United States)

    Pohl, Radek; Anzenbacher, Pavel

    2003-08-07

    [reaction: see text] A new method for the synthesis of 5-arylethynyl-8-hydroxyquinoline ligands using Sonogashira-Hagihara coupling was developed. The electronic nature of arylethynyl substituents affects the emission color and quantum yield of the resulting Al(III) complex. Photophysical properties of the metallocomplexes correspond to the electron-withdrawing/-donating character of the arylethynyl substituents. Optical properties of such Al(III) complexes correlate with the Hammett constant values of the respective substituents. This strategy offers a powerful tool for the preparation of electroluminophores with predictable photophysical properties.

  8. Synthesis of Novel C-2- or C-15-Labeled BODIPY—Estrone Conjugates

    Directory of Open Access Journals (Sweden)

    Ildikó Bacsa

    2018-04-01

    Full Text Available Novel BODIPY–estrone conjugates were synthesized via Cu(I-catalyzed azide–alkyne cycloaddition (CuAAC. Estrone-alkynes or an estrone-azide as starting compounds were synthesized via Michael addition or Sonogashira reaction as key steps. Fluorescent dyes based on BODIPY-core were provided by azide or alkyne functional groups. Fluorescent labeling of estrone was efficiently achieved at the C-2 or C-15 position. The newly-elaborated coupling procedures might have a broad applicability in the synthesis of fluorescent-labeled estrone conjugates suitable for biological assays.

  9. Oil and gas processing products to obtain polymers modified bitumen

    Directory of Open Access Journals (Sweden)

    Serhiy Pyshyev

    2017-07-01

    Full Text Available To obtain modified bitumen with excellent adhesive properties, coumarone-indene resin (CIR was used. However, bitumens modified by CIR have somewhat worse plastic properties. For the improvement of the plastic properties of road bitumen modified by coumarone-indene resin, the paper proposes to use plasticizers. Characterized by a high content of rings (aromatic-naphthenic oils, a range of compounds was used as plasticizers. Of all different plasticizers tested, the tar produced from West-Ukrainian oils has been found to be the most effective one. The optimal ratio between modified bitumen components was determined enabling to obtain the commercial product of polymers modified bitumen of BMP 60/90-52 brand. The complex thermogravimetry and differential-thermal analysis has been used to analyze the initial and modified bitumen. Bitumens modified by CIR have shown by far the highest thermal stability under operation conditions. Keywords: Bitumen, Modifier, Coumarone-indene resin, Plasticizer

  10. General Relativity solutions in modified gravity

    Science.gov (United States)

    Motohashi, Hayato; Minamitsuji, Masato

    2018-06-01

    Recent gravitational wave observations of binary black hole mergers and a binary neutron star merger by LIGO and Virgo Collaborations associated with its optical counterpart constrain deviation from General Relativity (GR) both on strong-field regime and cosmological scales with high accuracy, and further strong constraints are expected by near-future observations. Thus, it is important to identify theories of modified gravity that intrinsically possess the same solutions as in GR among a huge number of theories. We clarify the three conditions for theories of modified gravity to allow GR solutions, i.e., solutions with the metric satisfying the Einstein equations in GR and the constant profile of the scalar fields. Our analysis is quite general, as it applies a wide class of single-/multi-field scalar-tensor theories of modified gravity in the presence of matter component, and any spacetime geometry including cosmological background as well as spacetime around black hole and neutron star, for the latter of which these conditions provide a necessary condition for no-hair theorem. The three conditions will be useful for further constraints on modified gravity theories as they classify general theories of modified gravity into three classes, each of which possesses i) unique GR solutions (i.e., no-hair cases), ii) only hairy solutions (except the cases that GR solutions are realized by cancellation between singular coupling functions in the Euler-Lagrange equations), and iii) both GR and hairy solutions, for the last of which one of the two solutions may be selected dynamically.

  11. Assessment of Nutrient Contents of Modified Finger Millet (Eleusine coracana Starch

    Directory of Open Access Journals (Sweden)

    Tukura Bitrus Wokhe

    2017-02-01

    Full Text Available Modification processes can change the physicochemical and structural properties of native starch, thereby increasing its industrial applications. Finger millet starch (FMS was modified with casava starch (CS, guar gum (GG and xanthan gum (XG modifiers at the ratios of 95:5%, 90:10%, 80:20% and 75: 25%, for each of the modifier. The proximate and mineral compositions of the modified starch were determined using standard methods. Atomic absorption spectrometry method was used to quantify the mineral contents of the modified starch. Proximate contents of the modified FMS starch varied according to the type of the modifier and FMS/modifier ratios. Concentrations of carbohydrate in CS (66.97±0.03%, GG (64.42±0.05% and XG (64.64 ± 0.01% FMS modified starches were highest at 10%, 25% and 5% of the modifier contents repectively. The highest levels of fat in GG (8.91±0.02%, XG (7.89±0.01 and ash (3.55±0.02% in CS modified starches were recorded when the quantity of the modifiers were increased to 25%. Fatty acid levels in the modified starches varied in the order of XG (7.74±0.03% at 20% > GG (7.13±0.02% at 25% > CS (5.14±0.20% at 10%. At 25% modifier contents, levels of mineral element were highest in the modified CS and GG starches. Modifications decreased Mg, Mn, Fe, Zn, and Cu contents, while the concentrations Na, K, Ca and P increased. The modified starches can be used for production of some foods for specific health purposes.

  12. Modified Nance palatal button

    Directory of Open Access Journals (Sweden)

    Nitin Arora

    2015-01-01

    Full Text Available This paper describes modified Nance palatal button by which problems encountered in the palatal region around the acrylic button during space closure and molar distalization can be minimized.

  13. Micro-Bulges Investigation on Laser Modified Tool Steel Surface

    Directory of Open Access Journals (Sweden)

    Fauzun Fazliana

    2017-01-01

    Full Text Available This paper presents micro-bulges investigation on laser modified tool steel. The aim of this study is to understand the effect of laser irradiance and interaction time on surface morphology configuration. An Nd:YAG laser system with TEM00 pulse processing mode was used to modify the samples. Metallographic study shows samples were analyzed for focal position effect on melted pool size, angle of peaks geometry and laser modified layer depth. Surface morphology were analyzed for surface roughness. Laser modified layer shows depth ranged between 42.22 and 420.12 μm. Angle of peak bulge was found to be increase with increasing peak power. The maximum roughness, Ra, achieved in modified H13 was 21.10 μm. These findings are significant to enhance surface properties of laser modified steel and cast iron for dies and high wear resistance applications.

  14. Genetically Modified Foods and Consumer Perspective.

    Science.gov (United States)

    Boccia, Flavio; Sarnacchiaro, Pasquale

    2015-01-01

    Genetically modified food is able to oppose the world's hunger and preserve the environment, even if the patents in this matter are symptomatic of several doubts. And also, transgenic consumption causes problems and skepticism among consumers in several European countries, but above all in Italy, where there is a strong opposition over recent years. So, the present study conducted a research to study the consumption of genetically modified food products by Italian young generation. This research presented the following purposes: firstly, to analyze genetically modified products' consumption among a particular category of consumers; secondly, to implement a quantitative model to understand behaviour about this particular kind of consumption and identify the factors that determine their purchase. The proposed model shows that transgenic consumption is especially linked to knowledge and impact on environment and mankind's health.

  15. Controlling harmful algae blooms using aluminum-modified clay.

    Science.gov (United States)

    Liu, Yang; Cao, Xihua; Yu, Zhiming; Song, Xiuxian; Qiu, Lixia

    2016-02-15

    The performances of aluminum chloride modified clay (AC-MC), aluminum sulfate modified clay (AS-MC) and polyaluminum chloride modified clay (PAC-MC) in the removal of Aureococcus anophagefferens were compared, and the potential mechanisms were analyzed according to the dispersion medium, suspension pH and clay surface charges. The results showed that AC-MC and AS-MC had better efficiencies in removing A.anophagefferens than PAC-MC. The removal mechanisms of the three modified clays varied. At optimal coagulation conditions, the hydrolysates of AC and AS were mainly monomers, and they transformed into Al(OH)3(am) upon their addition to algae culture, with the primary mechanism being sweep flocculation. The PAC mainly hydrolyzed to the polyaluminum compounds, which remained stable when added to the algae culture, and the flocculation mainly occurred through polyaluminum compounds. The suspension pH significantly influenced the aluminum hydrolysate and affected the flocculation between the modified clay and algae cells. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. Modified Mason number for charged paramagnetic colloidal suspensions

    Science.gov (United States)

    Du, Di; Hilou, Elaa; Biswal, Sibani Lisa

    2016-06-01

    The dynamics of magnetorheological fluids have typically been described by the Mason number, a governing parameter defined as the ratio between viscous and magnetic forces in the fluid. For most experimental suspensions of magnetic particles, surface forces, such as steric and electrostatic interactions, can significantly influence the dynamics. Here we propose a theory of a modified Mason number that accounts for surface forces and show that this modified Mason number is a function of interparticle distance. We demonstrate that this modified Mason number is accurate in describing the dynamics of a rotating pair of paramagnetic colloids of identical or mismatched sizes in either high or low salt solutions. The modified Mason number is confirmed to be pseudoconstant for particle pairs and particle chains undergoing a stable-metastable transition during rotation. The interparticle distance term can be calculated using theory or can be measured experimentally. This modified Mason number is more applicable to magnetorheological systems where surface forces are not negligible.

  17. Osteoblast cell response to surface-modified carbon nanotubes

    International Nuclear Information System (INIS)

    Zhang Faming; Weidmann, Arne; Nebe, J. Barbara; Burkel, Eberhard

    2012-01-01

    In order to investigate the interaction of cells with modified multi-walled carbon nanotubes (MWCNTs) for their potential biomedical applications, the MWCNTs were chemically modified with carboxylic acid groups (–COOH), polyvinyl alcohol (PVA) polymer and biomimetic apatite on their surfaces. Additionally, human osteoblast MG-63 cells were cultured in the presence of the surface-modified MWCNTs. The metabolic activities of osteoblastic cells, cell proliferation properties, as well as cell morphology were studied. The surface modification of MWCNTs with biomimetic apatite exhibited a significant increase in the cell viability of osteoblasts, up to 67.23%. In the proliferation phases, there were many more cells in the biomimetic apatite-modified MWCNT samples than in the MWCNTs–COOH. There were no obvious changes in cell morphology in osteoblastic MG-63 cells cultured in the presence of these chemically-modified MWCNTs. The surface modification of MWCNTs with apatite achieves an effective enhancement of their biocompatibility.

  18. MS Disease-Modifying Medications

    Science.gov (United States)

    ... disease-modifying therapies Approval: 2014 US; 2014 CAN Pregnancy Category C (see footnote, page 11) Rash, headache, fever, nasal congestion, nausea, urinary tract infection, fatigue, insomnia, upper respiratory tract infection, herpes viral ...

  19. Study of Antiultraviolet Asphalt Modifiers and Their Antiageing Effects

    Directory of Open Access Journals (Sweden)

    Jinxuan Hu

    2017-01-01

    Full Text Available Ultraviolet (UV radiation causes serious ageing problems on pavement surface. In recent years, different UV blocking materials have been used as modifiers to prevent asphalt ageing during the service life of the pavement. In this study, three different materials have been used as modifiers in base asphalt to test their UV blocking effects: layered double hydroxides (LDHs, organomontmorillonite (OMMT, and carbon black (CB. UV ageing was applied to simulate the ageing process and softening point, penetration, ductility, DSR (Dynamic Shear Rheometer test, and Fourier Transform Infrared Spectroscopy (FTIR test were conducted to evaluate the anti-UV ageing effects of the three UV blocking modifiers. Physical property tests show that base asphalt was influenced more seriously by UV radiation compared to the modified asphalt. DSR test results indicate that the complex modulus of asphalt before UV ageing is increased because of modifiers, while the complex modulus of base asphalt after UV ageing is higher than that of the modified asphalt, which shows that the UV blocking modifiers promote the antiageing effects of asphalt. FTIR test reveals that the increment of carbonyl groups and sulfoxide groups of modified asphalt is less than that in base asphalt. Tests indicate the best UV blocking effect results for samples with LDHs and the worst UV blocking effect results for samples with CB.

  20. Modified microdissection electrocautery needle

    OpenAIRE

    Singh, Virendra; Kumar, Pramod

    2014-01-01

    Electrocautery is routinely used in surgical procedures. The commercially available microdissection electrocautery needles are costly. To overcome this disadvantage, we have modified monopolar electrocautery tip to function as well as commercially available systems.

  1. 40 CFR 721.3710 - Polyether modified fatty acids (generic).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polyether modified fatty acids... Specific Chemical Substances § 721.3710 Polyether modified fatty acids (generic). (a) Chemical substance... Polyether modified fatty acids (PMN P-99-0435) is subject to reporting under this section for the...

  2. 40 CFR 721.9513 - Modified magnesium silicate polymer (generic).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Modified magnesium silicate polymer... Specific Chemical Substances § 721.9513 Modified magnesium silicate polymer (generic). (a) Chemical... as modified magnesium silicate polymer (PMN P-98-604) is subject to reporting under this section for...

  3. Disulfiram as a radiation modifier

    International Nuclear Information System (INIS)

    Taylor, R.D.; Maners, A.W.; Salari, H.; Baker, M.; Walker, E.M. Jr.

    1986-01-01

    The radiation modifying effect and toxicity of tetraethylthiuram disulfide (disulfiram) have been studied. Disulfiram (DSM) inhibits aldehyde dehydrogenase, dopamine-beta-oxygenase, microsomal mixed-function oxidases and cytochrome P-450 enzymes. It is widely used for aversion therapy in alcoholism. Disulfiram also inhibits tumor formation by several known carcinogens. A biphasic toxicity pattern of DSM is reported in the L-929 mouse fibroblast culture system. Disulfiram is 100 percent toxic at 2 X 10(-7) M (0.05 micrograms per ml), 23 percent toxic at 3 X 10(-7) M (0.1 microgram per ml), and 100 percent toxic again at 3.4 X 10(-6) M (1.0 microgram per ml). The pattern is similar to the biphasic toxicity pattern of DMS's major metabolite, sodium diethyldithiocarbamate (DTC). Reports of both radiation protection and radiation enhancement by DTC exist. Previously, a radioprotective effect by 2 X 10(-6) M DTC (dose modifying factor = 1.26) has been demonstrated in the L-929 cell system. To date, no radiation modifying properties of DSM have been reported. Our investigation of DSM as a radiation modifier at 3 X 10(-7) M (0.1 microgram per ml) did not show significant improvement in survival of irradiated cells treated with DSM relative to the irradiated control group, as determined by absence of a difference in the Do of the two groups. Considering DSM's close structural relationship to DTC, it is possible that DSM may exhibit a radioprotective effect when applied in a different concentration than what was used in our research

  4. Getting super-excited with modified dispersion relations

    Energy Technology Data Exchange (ETDEWEB)

    Ashoorioon, Amjad; Casadio, Roberto [INFN—Sezione di Bologna, viale B. Pichat 6/2, I-40127 Bologna (Italy); Geshnizjani, Ghazal; Kim, Hyung J., E-mail: amjad.ashoorioon@bo.infn.it, E-mail: roberto.casadio@bo.infn.it, E-mail: ggeshniz@uwaterloo.ca, E-mail: h268kim@uwaterloo.ca [Department of Applied Mathematics, University of Waterloo Waterloo, Ontario, N2L 3G1 (Canada)

    2017-09-01

    We demonstrate that in some regions of parameter space, modified dispersion relations can lead to highly populated excited states, which we dub as 'super-excited' states. In order to prepare such super-excited states, we invoke dispersion relations that have negative slope in an interim sub-horizon phase at high momenta. This behaviour of quantum fluctuations can lead to large corrections relative to the Bunch-Davies power spectrum, which mimics highly excited initial conditions. We identify the Bogolyubov coefficients that can yield these power spectra. In the course of this computation, we also point out the shortcomings of the gluing method for evaluating the power spectrum and the Bogolyubov coefficients. As we discuss, there are other regions of parameter space, where the power spectrum does not get modified. Therefore, modified dispersion relations can also lead to so-called 'calm excited states'. We conclude by commenting on the possibility of obtaining these modified dispersion relations within the Effective Field Theory of Inflation.

  5. Active containment systems incorporating modified pillared clays

    International Nuclear Information System (INIS)

    Lundie, P.; McLeod, N.

    1997-01-01

    The application of treatment technologies in active containment systems provides a more advanced and effective method for the remediation of contaminated sites. These treatment technologies can be applied in permeable reactive walls and/or funnel and gate systems. The application of modified pillared clays in active containment systems provides a mechanism for producing permeable reactive walls with versatile properties. These pillared clays are suitably modified to incorporate reactive intercalatants capable of reacting with both a broad range of organic pollutants of varying molecular size, polarity and reactivity. Heavy metals can be removed from contaminated water by conventional ion-exchange and other reactive processes within the clay structure. Complex contamination problems can be addressed by the application of more than one modified clay on a site specific basis. This paper briefly describes the active containment system and the structure/chemistry of the modified pillared clay technology, illustrating potential applications of the in-situ treatment process for contaminated site remediation

  6. Modified asphalt for pavements; Hosoyo kaishitsu asufuaruto ni tsuite

    Energy Technology Data Exchange (ETDEWEB)

    Tsukagoshi, T. [Nippon Oil Co. Ltd., Yokohama (Japan)

    1997-10-01

    Modified asphalt has been used widely in such applications as countermeasure against rutting, countermeasure against wear caused by tire chains in snowy and cold areas, or bridge deck pavement. Features of various kinds of modified asphalt, standards, and standard properties are introduced. Modified asphalt containing natural asphalt is used for steel plate deck pavement. Semi-blown asphalt is used when emphasis must be given to the countermeasure for flowing resistance of asphalt pavement. Features and standards of asphalt containing rubber, thermoplastic elastomer, and thermoplastic resin are described. Asphalt containing heat-setting resin shows excellent characteristics, which other types of modified asphalt do not possess, in the laboratory resistance test for fatigue, flowing, and wear. Change in the history of modified asphalt in Japan from the initial stage to the present are explained and shown in a table together with time and phenomena, and the change in the production of modified asphalt is shown. 15 refs., 5 figs., 5 tabs.

  7. Non-singular and cyclic universe from the modified GUP

    International Nuclear Information System (INIS)

    Salah, Maha; Hammad, Fayçal; Faizal, Mir; Ali, Ahmed Farag

    2017-01-01

    In this paper, we investigate the effects of a new version of the generalized uncertainty principle (modified GUP) on the dynamics of the Universe. As the modified GUP will modify the relation between the entropy and area of the apparent horizon, it will also deform the Friedmann equations within Jacobson's approach. We explicitly find these deformed Friedmann equations governing the modified GUP-corrected dynamics of such a Universe. It is shown that the modified GUP-deformed Jacobson's approach implies an upper bound for the density of such a Universe. The Big Bang singularity can therefore also be avoided using the modified GUP-corrections to horizons' thermodynamics. In fact, we are able to analyze the pre Big Bang state of the Universe. Furthermore, the equations imply that the expansion of the Universe will come to a halt and then will immediately be followed by a contracting phase. When the equations are extrapolated beyond the maximum rate of contraction, a cyclic Universe scenario emerges.

  8. Non-singular and cyclic universe from the modified GUP

    Science.gov (United States)

    Salah, Maha; Hammad, Fayçal; Faizal, Mir; Farag Ali, Ahmed

    2017-02-01

    In this paper, we investigate the effects of a new version of the generalized uncertainty principle (modified GUP) on the dynamics of the Universe. As the modified GUP will modify the relation between the entropy and area of the apparent horizon, it will also deform the Friedmann equations within Jacobson's approach. We explicitly find these deformed Friedmann equations governing the modified GUP-corrected dynamics of such a Universe. It is shown that the modified GUP-deformed Jacobson's approach implies an upper bound for the density of such a Universe. The Big Bang singularity can therefore also be avoided using the modified GUP-corrections to horizons' thermodynamics. In fact, we are able to analyze the pre Big Bang state of the Universe. Furthermore, the equations imply that the expansion of the Universe will come to a halt and then will immediately be followed by a contracting phase. When the equations are extrapolated beyond the maximum rate of contraction, a cyclic Universe scenario emerges.

  9. Non-singular and cyclic universe from the modified GUP

    Energy Technology Data Exchange (ETDEWEB)

    Salah, Maha [Department of Mathematics, Faculty of Science, Cairo University, Giza, 12613, Egypt. (Egypt); Hammad, Fayçal [Physics Department and STAR Research Cluster, Bishop' s University, 2600 College Street, Sherbrooke (QC), J1M 1Z7 (Canada); Faizal, Mir [Department of Physics and Astronomy, University of Lethbridge, Lethbridge, Alberta, T1K 3M4 (Canada); Ali, Ahmed Farag, E-mail: abdelmoneim.maha@gmail.com, E-mail: fhammad@ubishops.ca, E-mail: mirfaizalmir@gmail.com, E-mail: ahmed.ali@fsc.bu.edu.eg [Department of Physics, Faculty of Science, Benha University, Benha, 13518 (Egypt)

    2017-02-01

    In this paper, we investigate the effects of a new version of the generalized uncertainty principle (modified GUP) on the dynamics of the Universe. As the modified GUP will modify the relation between the entropy and area of the apparent horizon, it will also deform the Friedmann equations within Jacobson's approach. We explicitly find these deformed Friedmann equations governing the modified GUP-corrected dynamics of such a Universe. It is shown that the modified GUP-deformed Jacobson's approach implies an upper bound for the density of such a Universe. The Big Bang singularity can therefore also be avoided using the modified GUP-corrections to horizons' thermodynamics. In fact, we are able to analyze the pre Big Bang state of the Universe. Furthermore, the equations imply that the expansion of the Universe will come to a halt and then will immediately be followed by a contracting phase. When the equations are extrapolated beyond the maximum rate of contraction, a cyclic Universe scenario emerges.

  10. A Modified Image Comparison Algorithm Using Histogram Features

    OpenAIRE

    Al-Oraiqat, Anas M.; Kostyukova, Natalya S.

    2018-01-01

    This article discuss the problem of color image content comparison. Particularly, methods of image content comparison are analyzed, restrictions of color histogram are described and a modified method of images content comparison is proposed. This method uses the color histograms and considers color locations. Testing and analyzing of based and modified algorithms are performed. The modified method shows 97% average precision for a collection containing about 700 images without loss of the adv...

  11. Surface-modified bacterial nanofibrillar PHB scaffolds for bladder tissue repair.

    Science.gov (United States)

    Karahaliloğlu, Zeynep; Demirbilek, Murat; Şam, Mesut; Sağlam, Necdet; Mızrak, Alpay Koray; Denkbaş, Emir Baki

    2016-01-01

    The aim of the study is in vitro investigation of the feasibility of surface-modified bacterial nanofibrous poly [(R)-3-hydroxybutyrate] (PHB) graft for bladder reconstruction. In this study, the surface of electrospun bacterial PHB was modified with PEG- or EDA via radio frequency glow discharge method. After plasma modification, contact angle of EDA-modified PHB scaffolds decreased from 110 ± 1.50 to 23 ± 0.5 degree. Interestingly, less calcium oxalate stone deposition was observed on modified PHB scaffolds compared to that of non-modified group. Results of this study show that surface-modified scaffolds not only inhibited calcium oxalate growth but also enhanced the uroepithelial cell viability and proliferation.

  12. 7 CFR 981.442 - Quality control.

    Science.gov (United States)

    2010-01-01

    ..., pieces of kernels, meal accumulated in manufacturing, or other material, to crushers, feed manufacturers... contamination in accordance with the provisions of this section. (1) Treatment process. Treatment processes... Salmonella bacteria in almonds, pursuant to a letter of determination issued by the Food and Drug...

  13. 40 CFR 442.1 - General applicability.

    Science.gov (United States)

    2010-07-01

    ... under a wide variety of Standard Industrial Classification (SIC) codes. Several of the most common SIC... industrial, commercial, or Publicly Owned Treatment Works (POTW) operations, provided that the cleaning is... drums, intermediate bulk containers, or closed-top hoppers. (3) Wastewater from a facility that...

  14. Publications | Page 442 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Results 4411 - 4420 of 7331 ... Visit the IDRC Digital Library now. ... Analysis of media reportage of GMOs : a briefing paper (restricted access) ... is news from, about, or of interest to National Research and Education Networks (NRENs) in Africa.

  15. 40 CFR 442.2 - General definitions.

    Science.gov (United States)

    2010-07-01

    .... Petroleum cargos mean products of the fractionation or straight distillation of crude oil, redistillation of...; benzene; coal tar; crude oil; cutting oil; ethyl benzene; diesel fuel; fuel additives; fuel oils; gasoline... beverages, animal by-products, animal fats, animal oils, caramel, caramel coloring, chocolate, corn syrup...

  16. Mechanical Properties of Isotactic Polypropylene Modified with Thermoplastic Potato Starch

    Science.gov (United States)

    Knitter, M.; Dobrzyńska-Mizera, M.

    2015-05-01

    In this paper selected mechanical properties of isotactic polypropylene (iPP) modified with potato starch have been presented. Thermoplastic starch (TPS) used as a modifier in the study was produced from potato starch modified with glycerol. Isotactic polypropylene/thermoplastic potato starch composites (iPP/TPS) that contained 10, 30, 50 wt.% of modified starch were examined using dynamic mechanical-thermal analysis, static tensile, Brinell hardness, and Charpy impact test. The studies indicated a distinct influence of a filler content on the mechanical properties of composites in comparison with non-modified polypropylene.

  17. Sensing based on the motion of enzyme-modified nanorods

    DEFF Research Database (Denmark)

    Bunea, Ada-Ioana; Pavel, Ileana-Alexandra; David, Sorin

    2015-01-01

    of nanorods modified with the appropriate enzyme. Nanorods, with a Pt and a polypyrrole (PPy) segment, were fabricated. The PPy segment of such nanorods was then modified with glucose oxidase (GOx), glutamate oxidase (GluOx), or xanthine oxidase (XOD). Calibration curves, linking the diffusion coefficient...... of the oxidase-modified nanorods to the concentration of the oxidase substrate, were subsequently built. The oxidase-modified nanorods and their calibration curves were finally used to determine substrate concentrations both in simple aqueous solutions and in complex samples such as horse serum and cell culture...

  18. Photochemistry of modified proteins benzophenone-containing bovine serum albumin

    International Nuclear Information System (INIS)

    Mariano, P.S.; Glover, G.I.; Wilkinson, T.J.

    1976-01-01

    The results of exploratory and mechanistic studies of the photochemistry of poly-p-benzoyl-acetimido-bovine serum albumin, a modified protein containing photoreactive and photosensitizing groups, are reported. Specifically described are recent findings concerning (1) the synthesis and characterization of a modified bovine serum albumin that contains benzophenone-like moieties, (2) the photochemistry of this modified protein which appeared to involve photoreductive coupling of the benzophenone chromophores to the protein backbone, and (3) triplet energy transfer from modified bovine serum albumin to small molecule acceptors resulting in quenching of the photoreaction. (author)

  19. Effect of modified surgical method on subcutaneous hydrops of patients with breast cancer after modified radical mastectomy

    OpenAIRE

    Yan Li; Hua-Feng Pan; Gui-Lan Sun

    2016-01-01

    Objective: Through prospective randomized clinical study,to observe the preventive effect of improved surgical method to subcutaneous hydrops after modified radical mastec tomy. Method: A total of 80 cases of patients who have done modified radical mastectomy were selected, and randomly divided them into study group (40 cases) and control group (40 cases), then adopted different surgical methods as followed respectively, to observe the daily drainage volume at the first 3 d after ...

  20. Doubly periodic solutions of the modified Kawahara equation

    International Nuclear Information System (INIS)

    Zhang Dan

    2005-01-01

    Some doubly periodic (Jacobi elliptic function) solutions of the modified Kawahara equation are presented in closed form. Our approach is to introduce a new auxiliary ordinary differential equation and use its Jacobi elliptic function solutions to construct doubly periodic solutions of the modified Kawahara equation. When the module m → 1, these solutions degenerate to the exact solitary wave solutions of the equation. Then we reveal the relation of some exact solutions for the modified Kawahara equation obtained by other authors

  1. Huntingtin interacting proteins are genetic modifiers of neurodegeneration.

    Directory of Open Access Journals (Sweden)

    Linda S Kaltenbach

    2007-05-01

    Full Text Available Huntington's disease (HD is a fatal neurodegenerative condition caused by expansion of the polyglutamine tract in the huntingtin (Htt protein. Neuronal toxicity in HD is thought to be, at least in part, a consequence of protein interactions involving mutant Htt. We therefore hypothesized that genetic modifiers of HD neurodegeneration should be enriched among Htt protein interactors. To test this idea, we identified a comprehensive set of Htt interactors using two complementary approaches: high-throughput yeast two-hybrid screening and affinity pull down followed by mass spectrometry. This effort led to the identification of 234 high-confidence Htt-associated proteins, 104 of which were found with the yeast method and 130 with the pull downs. We then tested an arbitrary set of 60 genes encoding interacting proteins for their ability to behave as genetic modifiers of neurodegeneration in a Drosophila model of HD. This high-content validation assay showed that 27 of 60 orthologs tested were high-confidence genetic modifiers, as modification was observed with more than one allele. The 45% hit rate for genetic modifiers seen among the interactors is an order of magnitude higher than the 1%-4% typically observed in unbiased genetic screens. Genetic modifiers were similarly represented among proteins discovered using yeast two-hybrid and pull-down/mass spectrometry methods, supporting the notion that these complementary technologies are equally useful in identifying biologically relevant proteins. Interacting proteins confirmed as modifiers of the neurodegeneration phenotype represent a diverse array of biological functions, including synaptic transmission, cytoskeletal organization, signal transduction, and transcription. Among the modifiers were 17 loss-of-function suppressors of neurodegeneration, which can be considered potential targets for therapeutic intervention. Finally, we show that seven interacting proteins from among 11 tested were able to

  2. Modified planar functions and their components

    DEFF Research Database (Denmark)

    Anbar Meidl, Nurdagül; Meidl, Wilfried Meidl

    2017-01-01

    functions in odd characteristic as a vectorial bent function. We finally point out that though these components behave somewhat different than the multivariate bent4 functions, they are bent or semibent functions shifted by a certain quadratic term, a property which they share with their multivariate......Zhou ([20]) introduced modified planar functions in order to describe (2n; 2n; 2n; 1) relative difference sets R as a graph of a function on the finite field F2n, and pointed out that projections of R are difference sets that can be described by negabent or bent4 functions, which are Boolean...... functions given in multivariate form. One of the objectives of this paper is to contribute to the understanding of these component functions of modified planar functions. Moreover, we obtain a description of modified planar functions by their components which is similar to that of the classical planar...

  3. 46 CFR 53.01-5 - Scope (modifies HG-100).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Scope (modifies HG-100). 53.01-5 Section 53.01-5... General Requirements § 53.01-5 Scope (modifies HG-100). (a) The regulations in this part apply to steam... governing various types of pressure vessels and boilers. (b) Modifies HG-100. The requirements of Part HG of...

  4. Series expansion of the modified Einstein Procedure

    Science.gov (United States)

    Seema Chandrakant Shah-Fairbank

    2009-01-01

    This study examines calculating total sediment discharge based on the Modified Einstein Procedure (MEP). A new procedure based on the Series Expansion of the Modified Einstein Procedure (SEMEP) has been developed. This procedure contains four main modifications to MEP. First, SEMEP solves the Einstein integrals quickly and accurately based on a series expansion. Next,...

  5. Modified bitumen for embedding of radioactive wastes

    International Nuclear Information System (INIS)

    Bozkurt, C.

    1984-11-01

    This work describes new possibilities of using polymer modified bitumen as matrix material for embedding of low- and medium level radioactive wastes. Epoxy resins, polyurethane resins and styrene-butadiene-copolymers with 20-40 weight per cent are used as modifying agents. Penetration and softening point (ring and ball) of modified samples have been measured. Further the resistance to toluene and leaching rate in n-heptane have been determined. Within these polymer bitumen combinations investigated, the epoxy resins having a high epoxid equivalent weight with dicarbooxylic acid anhydrid hardeners and tertiary amin accelerators give the most dense network, highest thermodimensional stability and lowest leaching rate in organic solvents. 71 refs., 9 figs., 6 tabs

  6. Genetically Modified Products in Lithuania: Situational Analysis and Consumers’ Attitudes

    OpenAIRE

    Dainora Grundey; Indre Rimkiene

    2012-01-01

    The paper analyses the genetically modified organism products (GMP) in relation to genetically modified organisms (GMO) from two perspectives: 1) from the theoretical standpoint, discussing the GMO and GMP trade conditions and 2) from the practical perspective, namely analysing the availability of GMP in the Lithuanian market. With the growing of genetically modified products (GMP) levels, it becomes important to examine the situation of genetically modified products. According to various stu...

  7. Automorphism group of the modified bubble-sort graph

    OpenAIRE

    Ganesan, Ashwin

    2014-01-01

    The modified bubble-sort graph of dimension $n$ is the Cayley graph of $S_n$ generated by $n$ cyclically adjacent transpositions. In the present paper, it is shown that the automorphism group of the modified bubble sort graph of dimension $n$ is $S_n \\times D_{2n}$, for all $n \\ge 5$. Thus, a complete structural description of the automorphism group of the modified bubble-sort graph is obtained. A similar direct product decomposition is seen to hold for arbitrary normal Cayley graphs generate...

  8. Modified Chebyshev Collocation Method for Solving Differential Equations

    Directory of Open Access Journals (Sweden)

    M Ziaul Arif

    2015-05-01

    Full Text Available This paper presents derivation of alternative numerical scheme for solving differential equations, which is modified Chebyshev (Vieta-Lucas Polynomial collocation differentiation matrices. The Scheme of modified Chebyshev (Vieta-Lucas Polynomial collocation method is applied to both Ordinary Differential Equations (ODEs and Partial Differential Equations (PDEs cases. Finally, the performance of the proposed method is compared with finite difference method and the exact solution of the example. It is shown that modified Chebyshev collocation method more effective and accurate than FDM for some example given.

  9. Sensitivity analysis of a modified energy model

    International Nuclear Information System (INIS)

    Suganthi, L.; Jagadeesan, T.R.

    1997-01-01

    Sensitivity analysis is carried out to validate model formulation. A modified model has been developed to predict the future energy requirement of coal, oil and electricity, considering price, income, technological and environmental factors. The impact and sensitivity of the independent variables on the dependent variable are analysed. The error distribution pattern in the modified model as compared to a conventional time series model indicated the absence of clusters. The residual plot of the modified model showed no distinct pattern of variation. The percentage variation of error in the conventional time series model for coal and oil ranges from -20% to +20%, while for electricity it ranges from -80% to +20%. However, in the case of the modified model the percentage variation in error is greatly reduced - for coal it ranges from -0.25% to +0.15%, for oil -0.6% to +0.6% and for electricity it ranges from -10% to +10%. The upper and lower limit consumption levels at 95% confidence is determined. The consumption at varying percentage changes in price and population are analysed. The gap between the modified model predictions at varying percentage changes in price and population over the years from 1990 to 2001 is found to be increasing. This is because of the increasing rate of energy consumption over the years and also the confidence level decreases as the projection is made far into the future. (author)

  10. Modified interstitial water squeezer for trace metal analysis

    Digital Repository Service at National Institute of Oceanography (India)

    Nath, B.N.; Rajaraman, V.S.; Mudholkar, A.V.

    Hydraulic squeezer of Manheim, used in the extraction of pore water of sediments, has been modified by providing teflon inner lining and increasing the volume of squeezer. The modified version facilitates collection of pore water sample, for trace...

  11. Surface treated fly ash filled modified epoxy composites

    Directory of Open Access Journals (Sweden)

    Uma Dharmalingam

    2015-01-01

    Full Text Available Abstract Fly ash, an inorganic alumino silicate has been used as filler in epoxy matrix, but it reduces the mechanical properties due to its poor dispersion and interfacial bonding with the epoxy matrix. To improve its interfacial bonding with epoxy matrix, surface treatment of fly ash was done using surfactant sodium lauryl sulfate and silane coupling agent glycidoxy propyl trimethoxy silane. An attempt is also made to reduce the particle size of fly ash using high pressure pulverizer. To improve fly ash dispersion in epoxy matrix, the epoxy was modified by mixing with amine containing liquid silicone rubber (ACS. The effect of surface treated fly ash with varying filler loadings from 10 to 40% weight on the mechanical, morphological and thermal properties of modified epoxy composites was investigated. The surface treated fly ash was characterized by particle size analyzer and FTIR spectra. Morphological studies of surface treated fly ash filled modified epoxy composites indicate good dispersion of fillers in the modified epoxy matrix and improves its mechanical properties. Impact strength of the surface treated fly ash filled modified epoxy composites show more improvement than unmodified composites.

  12. Generated effect modifiers (GEM's) in randomized clinical trials.

    Science.gov (United States)

    Petkova, Eva; Tarpey, Thaddeus; Su, Zhe; Ogden, R Todd

    2017-01-01

    In a randomized clinical trial (RCT), it is often of interest not only to estimate the effect of various treatments on the outcome, but also to determine whether any patient characteristic has a different relationship with the outcome, depending on treatment. In regression models for the outcome, if there is a non-zero interaction between treatment and a predictor, that predictor is called an "effect modifier". Identification of such effect modifiers is crucial as we move towards precision medicine, that is, optimizing individual treatment assignment based on patient measurements assessed when presenting for treatment. In most settings, there will be several baseline predictor variables that could potentially modify the treatment effects. This article proposes optimal methods of constructing a composite variable (defined as a linear combination of pre-treatment patient characteristics) in order to generate an effect modifier in an RCT setting. Several criteria are considered for generating effect modifiers and their performance is studied via simulations. An example from a RCT is provided for illustration. © The Author 2016. Published by Oxford University Press. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  13. Societal aspects of genetically modified foods

    DEFF Research Database (Denmark)

    Frewer, L.J.; Lassen, J.; Kettlitz, B.

    2004-01-01

    This paper aims to examine some of the reasons behind public controversy associated with the introduction of genetically modified foods in Europe the 1990s. The historical background to the controversy is provided to give context. The issue of public acceptance of genetically modified foods......, and indeed the emerging biosciences more generally, is considered in the context of risk perceptions and attitudes, public trust in regulatory institutions, scientists and industry, and the need to develop communication strategies that explicitly include public concerns rather than exclude them. Increased...

  14. Modifiable Combining Functions

    OpenAIRE

    Cohen, Paul; Shafer, Glenn; Shenoy, Prakash P.

    2013-01-01

    Modifiable combining functions are a synthesis of two common approaches to combining evidence. They offer many of the advantages of these approaches and avoid some disadvantages. Because they facilitate the acquisition, representation, explanation, and modification of knowledge about combinations of evidence, they are proposed as a tool for knowledge engineers who build systems that reason under uncertainty, not as a normative theory of evidence.

  15. Tip-modified Propellers

    DEFF Research Database (Denmark)

    Andersen, Poul

    1999-01-01

    The paper deals with tip-modified propellers and the methods which, over a period of two decades, have been applied to develop such propellers. The development is driven by the urge to increase the efficiency of propellers and can be seen as analogous to fitting end plates and winglets to aircraft...... propeller, have efficiency increases of a reasonable magnitude in both open-water and behind-ship conditions....

  16. Defluorination of drinking water using surfactant modified zeolites ...

    African Journals Online (AJOL)

    This study focused on the removal of fluoridefrom groundwater by employing surfactant modified zeolites (SMZ) synthesized using locallyavailable kaolin material as precursor. The zeolite synthesis involved calcination of kaolin, alkaline fusion and hydrothermal treatment. The final product was modified with 5g/L ...

  17. Beam aperture modifier design with acoustic metasurfaces

    Science.gov (United States)

    Tang, Weipeng; Ren, Chunyu

    2017-10-01

    In this paper, we present a design concept of acoustic beam aperture modifier using two metasurface-based planar lenses. By appropriately designing the phase gradient profile along the metasurface, we obtain a class of acoustic convex lenses and concave lenses, which can focus the incoming plane waves and collimate the converging waves, respectively. On the basis of the high converging and diverging capability of these lenses, two kinds of lens combination scheme, including the convex-concave type and convex-convex type, are proposed to tune up the incoming beam aperture as needed. To be specific, the aperture of the acoustic beam can be shrunk or expanded through adjusting the phase gradient of the pair of lenses and the spacing between them. These lenses and the corresponding aperture modifiers are constructed by the stacking ultrathin labyrinthine structures, which are obtained by the geometry optimization procedure and exhibit high transmission coefficient and a full range of phase shift. The simulation results demonstrate the effectiveness of our proposed beam aperture modifiers. Due to the flexibility in aperture controlling and the simplicity in fabrication, the proposed modifiers have promising potential in applications, such as acoustic imaging, nondestructive evaluation, and communication.

  18. EDTA modified glassy carbon electrode: Preparation and characterization

    International Nuclear Information System (INIS)

    Ustuendag, Zafer; Solak, Ali Osman

    2009-01-01

    EDTA-phenoxyamide modified glassy carbon electrode (EDTA-GC) was prepared at a glassy carbon electrode by surface synthesis. In the first step, nitrophenyl was grafted to the glassy carbon (GC) surface via the electrochemical reduction of its tetraflouroborate diazonium salt. In the second step, nitrophenyl-modified electrode (NP-GC) was subjected to the cathodic potential scan to reduce the nitro to amine group. p-Aminophenyl modified glassy carbon electrode (AP-GC) was dipped into a EDTA solution containing 1-ethyl-3(3-(dimethlyamino)propyl)-carbodiimide (EDC) as an activating agent. Thus formed ((2-anilino-2-oxoethyl){2-[bis(carboxymethyl)amino]-ethyl}amino)acetic acid modified GC electrode was denoted as EDTA-GC and characterized by cyclic voltammetry (CV), electrochemical impedance spectroscopy (EIS), ellipsometry and X-ray photoelectron spectroscopy (XPS). Complexation of the EDTA-GC surface with Pb 2+ ions was investigated if this electrode could be used as a metal sensor.

  19. Self-healing of polymer modified concrete

    Directory of Open Access Journals (Sweden)

    Abd_Elmoaty M. Abd_Elmoaty

    2011-06-01

    Full Text Available Self healing phenomenon of concrete has been observed in traditional, fibrous, self compacting concrete. This phenomenon occurred mainly due to the presence of unhydrated cement particles in the presence of water. Mechanism of polymer in concrete depends on creating a layer and net of polymer around cement particles which enhances the properties of polymer modified concrete. This mechanism may affect the self healing of this type of concrete. This work aims to study the presence of the self healing phenomenon in polymer modified concrete and the related parameters. An experimental investigation on self healing of polymer modified concrete was undertaken. In this research work, effect of polymer type, polymer dose, cement content, cement type, w/cm ratio and age of damage were studied. The healing process extended up to 60 days. Ultrasonic pulse velocity measurements were used to evaluate the healing process. Results indicated that, the self healing phenomenon existed in polymer modified concrete as in traditional concrete. The increase of polymer dose increases the healing degree at the same healing time. This increase depends on polymer type. Also, the decrease of w/cm ratio reduces the self healing degree while the use of Type V Portland cement improves the self healing process compared with Type I Portland cement. Cement content has an insignificant effect on healing process for both concrete with and without polymer. In addition, the increase of damage age decreases the efficiency of self healing process.

  20. Modified silica sol coatings for surface enhancement of leather.

    Science.gov (United States)

    Mahltig, Boris; Vossebein, Lutz; Ehrmann, Andrea; Cheval, Nicolas; Fahmi, Amir

    2012-06-01

    The presented study reports on differently modified silica sols for coating applications on leather. Silica sols are prepared by acidic hydrolysis of tetraethoxysilane and modified by silane compounds with fluorinated and non-fluorinated alkylgroups. In contrast to many earlier investigations regarding sol-gel applications on leather, no acrylic resin is used together with the silica sols when applying on leather. The modified silica particles are supposed to aggregate after application, forming thus a modified silica coating on the leather substrate. Scanning electron microscopy investigation shows that the applied silica coatings do not fill up or close the pores of the leather substrate. However, even if the pores of the leather are not sealed by this sol-gel coating, an improvement of the water repellent and oil repellent properties of the leather substrates are observed. These improved properties of leather by application of modified silica sols can provide the opportunity to develop sol-gel products for leather materials present in daily life.

  1. Sonocatalytic Degradation of Antibiotics Tetracycline by Mn-Modified Diatomite

    OpenAIRE

    Guo, Yiping; Mi, Xiao; Li, Guoting; Chen, Xi

    2017-01-01

    Mn-modified diatomite was prepared by wet impregnation and subsequent calcinations processes. It was used as catalyst for sonocatalytic degradation of antibiotics tetracycline. Characterizations by scanning electron microscopy and X-ray diffraction pattern showed that the morphology and crystal structure of the modified diatomite were similar to these of raw diatomite. Despite containing very limited amount of Mn oxides, the Mn-modified diatomite showed much higher sonocatalytic activity than...

  2. 40 CFR 721.10089 - Modified salicylic acid, zirconium complex (generic).

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Modified salicylic acid, zirconium... Specific Chemical Substances § 721.10089 Modified salicylic acid, zirconium complex (generic). (a) Chemical... as modified salicylic acid, zirconium complex (PMN P-00-552) is subject to reporting under this...

  3. Modified Kepler's law, escape speed, and two-body problem in modified Newtonian dynamics-like theories

    International Nuclear Information System (INIS)

    Zhao Hongsheng; Li Baojiu; Bienayme, Olivier

    2010-01-01

    We derive a simple analytical expression for the two-body force in a subclass of modified Newtonian dynamics (MOND) theories and make testable predictions in the modification to the two-body orbital period, shape, precession rate, escape speed, etc. We demonstrate the applications of the modified Kepler's law in the timing of satellite orbits around the Milky Way, and checking the feasibility of MOND in the orbit of the large Magellanic cloud, the M31 galaxy, and the merging bullet clusters. MOND appears to be consistent with satellite orbits although with a tight margin. Our results on two-bodies are also generalized to restricted three-body, many-body problems, rings, and shells.

  4. Epoxy modified bitumen : Chemical hardening and its interpretation

    NARCIS (Netherlands)

    Apostolidis, P.; Pipintakos, G.; van de Ven, M.F.C.; Liu, X.; Erkens, Sandra; Scarpas, Athanasios

    2018-01-01

    Epoxy modified bitumen (EMB) is a promising technology for long lasting paving materials ensuring higher resistance to rutting, oxygen- and moisture-induced damage. In this paper, an analysis of the chemical reactions that take place during the chemical hardening process (curing) of epoxy modified

  5. Analysis of the Modified Smith Predictor

    Directory of Open Access Journals (Sweden)

    Jorge A. Herrera-Cuartas

    2013-11-01

    Full Text Available In this paper an analysis about the modified Smith predictor, is presented. The modified Smith predictor is a scheme used to control stable, unstable and integrative systems. The closed loop equation is developed and analyzed. Additionally, various test are made to verify the behavior of the control scheme. Specify, three test are made. First, it is verify the behavior of the scheme to deal with an uncertainty in the delay model. Second, it is verify the behavior in the face of uncertainties in the parameter of the rational model. 

  6. Modifying effect of low dose irradiation

    International Nuclear Information System (INIS)

    Kalendo, G.S.

    1989-01-01

    It is shown that irradiation of Hela cells with stimulating doses of 0,1 Gy changes the cells' response to the subsequent radiation effect of greater value: instead of DNA synthesis inhibition stimulation takes place. Modifying effect of preliminary irradiation with 0,1 Gy manifests it self only in case if there is a certain time interval not less than 3 minutes and not more than 10 minutes (3-5 minutes is optimal interval). Data on modifying effect with 0,1 Gy at subcellular and cellular-population levels are presented. 21 refs.; 6 figs

  7. Modifier genes: Moving from pathogenesis to therapy.

    Science.gov (United States)

    McCabe, Edward R B

    2017-09-01

    This commentary will focus on how we can use our knowledge about the complexity of human disease and its pathogenesis to identify novel approaches to therapy. We know that even for single gene Mendelian disorders, patients with identical mutations often have different presentations and outcomes. This lack of genotype-phenotype correlation led us and others to examine the roles of modifier genes in the context of biological networks. These investigations have utilized vertebrate and invertebrate model organisms. Since one of the goals of research on modifier genes and networks is to identify novel therapeutic targets, the challenges to patient access and compliance because of the high costs of medications for rare genetic diseases must be recognized. A recent article explored protective modifiers, including plastin 3 (PLS3) and coronin 1C (CORO1C), in spinal muscular atrophy (SMA). SMA is an autosomal recessive deficit of survival motor neuron protein (SMN) caused by mutations in SMN1. However, the severity of SMA is determined primarily by the number of SMN2 copies, and this results in significant phenotypic variability. PLS3 was upregulated in siblings who were asymptomatic compared with those who had SMA2 or SMA3, but identical homozygous SMN1 deletions and equal numbers of SMN2 copies. CORO1C was identified by interrogation of the PLS3 interactome. Overexpression of these proteins rescued endocytosis in SMA models. In addition, antisense RNA for upregulation of SMN2 protein expression is being developed as another way of modifying the SMA phenotype. These investigations suggest the practical application of protective modifiers to rescue SMA phenotypes. Other examples of the potential therapeutic value of novel protective modifiers will be discussed, including in Duchenne muscular dystrophy and glycerol kinase deficiency. This work shows that while we live in an exciting era of genomic sequencing, a functional understanding of biology, the impact of its

  8. Fluorinated ceramide trafficking inhibitors as Alzheimer's disease radiomarkers

    International Nuclear Information System (INIS)

    Ferko, B.; Berkes, D.; Crivelli, S. M.

    2017-01-01

    Herein, we describe the synthesis of the most potent analogues of HPA-12 radiolabeled with fluorine-18 from the universal precursor m-Br-HPA-12. The enantioselective access to this precursor is based on a practical and reliable crystallization induced asymmetric transformation (CIAT) of 3- Bromo-benzoylacrylic acid and suitable chiral auxiliary. Incorporation of alkynol chains was accomplished by Sonogashira coupling, followed by triple bond reduction and protection of primary hydroxyl group delivering the intermediates for the radiofluorinated analogues of HPA-12. Radiofluorination of analogues of HPA-12 and PET imaging was carried out by our partners at University of Maastricht. (authors)

  9. Synthesis and Preliminary Characterization of a PPE-Type Polymer Containing Substituted Fullerenes and Transition Metal Ligation Sites

    Directory of Open Access Journals (Sweden)

    Corinne A. Basinger

    2015-01-01

    Full Text Available A substituted fullerene was incorporated into a PPE-conjugated polymer repeat unit. This subunit was then polymerized via Sonogashira coupling with other repeat units to create polymeric systems approaching 50 repeat units (based on GPC characterization. Bipyridine ligands were incorporated into some of these repeat units to provide sites for transition metal coordination. Photophysical characterization of the absorption and emission properties of these systems shows excited states located on both the fullerene and aromatic backbone of the polymers that exist in a thermally controlled equilibrium. Future work will explore other substituted polyaromatic systems using similar methodologies.

  10. Matter Loops Corrected Modified Gravity in Palatini Formulation

    International Nuclear Information System (INIS)

    Meng Xinhe; Wang Peng

    2008-01-01

    Recently, corrections to the standard Einstein-Hilbert action were proposed to explain the current cosmic acceleration in stead of introducing dark energy. In the Palatini formulation of those modified gravity models, there is an important observation due to Arkani-Hamed: matter loops will give rise to a correction to the modified gravity action proportional to the Ricci scalar of the metric. In the presence of such a term, we show that the current forms of modified gravity models in Palatini formulation, specifically, the 1/R gravity and ln R gravity, will have phantoms. Then we study the possible instabilities due to the presence of phantom fields. We show that the strong instability in the metric formulation of 1/R gravity indicated by Dolgov and Kawasaki will not appear and the decay timescales for the phantom fields may be long enough for the theories to make sense as effective field theory. On the other hand, if we change the sign of the modification terms to eliminate the phantoms, some other inconsistencies will arise for the various versions of the modified gravity models. Finally, we comment on the universal property of the Palatini formulation of the matter loops corrected modified gravity models and its implications

  11. EAMJ Modifiable 10.indd

    African Journals Online (AJOL)

    2010-02-02

    Feb 2, 2010 ... MODIFIABLE FACTORS ASSOCIATED WITH ACTIVE PULMONARY TUBERCULOSIS IN A KENYAN PRISON. A. S. Amwayi, MBChB, MSc., ... University of Agriculture and Technology, P.O. Box 62000- 0200, Nairobi, Kenya and E. M. Muchiri, MSc, PhD., Division ..... Diabetes and low BMI. 223452.81.

  12. Modified potentials in many-body perturbation theory

    International Nuclear Information System (INIS)

    Silver, D.M.; Bartlett, R.J.

    1976-01-01

    Many-body perturbation-theory calculations of the pair-correlation energy within the regime of various finite expansions in two-center Slater-type basis sets are performed using a wide variety of modified potentials for the determination of unoccupied orbitals. To achieve meaningful convergence, it appears that the perturbation series must be carried through third order, using shifted denominators to include contributions from various higher-order diagrams. Moreover, certain denominator shifts are found necessary to ensure that a negative-definite resolvent accompanies the perturbation scheme when an arbitrary modified potential is employed. Through third order with denominator shifts, well-behaved modified potentials are found to give results that are equivalent, within 1 kcal/mole, to those obtained for pair-correlation energies with the standard self-consistent-field-V/sup N/ potential

  13. Advanced glycation end product (AGE) modified proteins in tears of diabetic patients.

    Science.gov (United States)

    Zhao, Zhenjun; Liu, Jingfang; Shi, Bingyin; He, Shuixiang; Yao, Xiaoli; Willcox, Mark D P

    2010-08-11

    High glucose level in diabetic patients may lead to advanced glycation end product (AGE) modified proteins. This study investigated AGE modified proteins in tears and compared their levels in diabetic patients (DM) with non-diabetic controls (CTL). Basal tears were collected from DM with (DR) or without (DNR) retinopathy and CTL. Total AGE modified proteins were detected quantitatively by a dot immunobinding assay. The AGE modified proteins were separated in 1D- and 2D-SDS gels and detected by western-blotting. The individual AGE modified proteins were also compared between groups using densitometry. Compared with the CTL group, tear concentrations of AGE modified proteins were significantly elevated in DR and DNR groups. The concentration of AGE modified proteins in diabetic tears were positively correlated with AGE modified hemoglobin (HbA1c) and postprandial blood glucose level (PBG). Western blotting of AGE modified proteins from 1D-SDS gels showed several bands, the major one at around 60 kDa. The intensities of AGE modified protein bands were higher in DM tears than in CTL tears. Western blotting from 2D-SDS gels showed a strongly stained horizontal strip, which corresponded to the major band in 1D-SDS gels. Most of the other AGE modified protein species were within molecular weight of 30-60 kDa, PI 5.2-7.0. Densitometry analysis demonstrated several AGE modified proteins were elevated in DR or DNR tears. Total and some individual AGE modified proteins were elevated in DM tears. AGE modified proteins in tears may be used as biomarkers to diagnose diabetes and/or diabetic retinopathy.

  14. Factors Influencing Urban Consumers' Acceptance of Genetically Modified Foods

    OpenAIRE

    Jae-Hwan Han; R. Wes Harrison

    2007-01-01

    Linkages between consumer beliefs and attitudes regarding the risks and benefits of genetically modified foods and consumer purchase intentions for these foods are examined. Factors that hinder consumer purchases of genetically modified foods are also tested. Results show that purchase intentions for consumers willing to buy genetically modified crops and meats are primarily affected by their belief that these foods are safe. On the other hand, intentions of consumers who decide not to buy ge...

  15. Acceleration of the universe dark energy or modified

    International Nuclear Information System (INIS)

    Cardenas, Rolando; Leyva, Yoelsy

    2007-01-01

    We present a composite model of dark energy, motivated in string and quantum field theory considerations. Then we speak on gravity theories in which the gravity Lagrangian is modified, resulting in a modification of General Relativity. We outline a methodology allowing a mapping between these two theories, i. e., both dark energy models and modified gravity can give the same cosmological dynamics. We apply aforementioned methodology to obtain the mapping composite dark energy-modified gravity for a particular case. Cosmic expansion history takes into account very large scales, the homogeneous Universe, and can not discriminate between above two theories. However, cosmic growth history takes into consideration intermediate cluster and galactic scales, the inhomogeneous Universe, and there might be the clue to discriminate whether the current acceleration of the Universe is because it is filled with a new fluid having repulsive gravity (dark energy) or it is just that gravity gets weaker and long scales (modified gravity). (Author)

  16. Genetic modifiers of Duchenne and facioscapulohumeral muscular dystrophies.

    Science.gov (United States)

    Hightower, Rylie M; Alexander, Matthew S

    2018-01-01

    Muscular dystrophy is defined as the progressive wasting of skeletal muscles that is caused by inherited or spontaneous genetic mutations. Next-generation sequencing has greatly improved the accuracy and speed of diagnosis for different types of muscular dystrophy. Advancements in depth of coverage, convenience, and overall reduced cost have led to the identification of genetic modifiers that are responsible for phenotypic variability in affected patients. These genetic modifiers have been postulated to explain key differences in disease phenotypes, including age of loss of ambulation, steroid responsiveness, and the presence or absence of cardiac defects in patients with the same form of muscular dystrophy. This review highlights recent findings on genetic modifiers of Duchenne and facioscapulohumeral muscular dystrophies based on animal and clinical studies. These genetic modifiers hold great promise to be developed into novel therapeutic targets for the treatment of muscular dystrophies. Muscle Nerve 57: 6-15, 2018. © 2017 Wiley Periodicals, Inc.

  17. EDTA modified glassy carbon electrode: Preparation and characterization

    Energy Technology Data Exchange (ETDEWEB)

    Ustuendag, Zafer [Dumlupinar University, Faculty of Arts and Sciences, Department of Chemistry, Kuetahya (Turkey); Solak, Ali Osman [Ankara University, Faculty of Science, Department of Chemistry, Degol Street, Tandogan, 06100 Ankara (Turkey)], E-mail: osolak@science.ankara.edu.tr

    2009-11-01

    EDTA-phenoxyamide modified glassy carbon electrode (EDTA-GC) was prepared at a glassy carbon electrode by surface synthesis. In the first step, nitrophenyl was grafted to the glassy carbon (GC) surface via the electrochemical reduction of its tetraflouroborate diazonium salt. In the second step, nitrophenyl-modified electrode (NP-GC) was subjected to the cathodic potential scan to reduce the nitro to amine group. p-Aminophenyl modified glassy carbon electrode (AP-GC) was dipped into a EDTA solution containing 1-ethyl-3(3-(dimethlyamino)propyl)-carbodiimide (EDC) as an activating agent. Thus formed ((2-anilino-2-oxoethyl){l_brace}2-[bis(carboxymethyl)amino]-ethyl{r_brace}amino)acetic acid modified GC electrode was denoted as EDTA-GC and characterized by cyclic voltammetry (CV), electrochemical impedance spectroscopy (EIS), ellipsometry and X-ray photoelectron spectroscopy (XPS). Complexation of the EDTA-GC surface with Pb{sup 2+} ions was investigated if this electrode could be used as a metal sensor.

  18. Modifiers of notch transcriptional activity identified by genome-wide RNAi

    Directory of Open Access Journals (Sweden)

    Firnhaber Christopher B

    2010-10-01

    Full Text Available Abstract Background The Notch signaling pathway regulates a diverse array of developmental processes, and aberrant Notch signaling can lead to diseases, including cancer. To obtain a more comprehensive understanding of the genetic network that integrates into Notch signaling, we performed a genome-wide RNAi screen in Drosophila cell culture to identify genes that modify Notch-dependent transcription. Results Employing complementary data analyses, we found 399 putative modifiers: 189 promoting and 210 antagonizing Notch activated transcription. These modifiers included several known Notch interactors, validating the robustness of the assay. Many novel modifiers were also identified, covering a range of cellular localizations from the extracellular matrix to the nucleus, as well as a large number of proteins with unknown function. Chromatin-modifying proteins represent a major class of genes identified, including histone deacetylase and demethylase complex components and other chromatin modifying, remodeling and replacement factors. A protein-protein interaction map of the Notch-dependent transcription modifiers revealed that a large number of the identified proteins interact physically with these core chromatin components. Conclusions The genome-wide RNAi screen identified many genes that can modulate Notch transcriptional output. A protein interaction map of the identified genes highlighted a network of chromatin-modifying enzymes and remodelers that regulate Notch transcription. Our results open new avenues to explore the mechanisms of Notch signal regulation and the integration of this pathway into diverse cellular processes.

  19. Mechanical properties of chemically modified portuguese pinewood

    OpenAIRE

    Lopes, Duarte B; Mai, Carsten; Militz, Holger

    2014-01-01

    To turn wood into a construction material with enhanced properties, many methods of chemical modification have been developed in the last few decades. In this work, mechanical properties of pine wood were chemically modified, compared and evaluated. Maritime pine wood (Pinus pinaster) was modified with four chemical processes: 1,3-dimethylol-4,5- dihydroxyethyleneurea, N-methylol melamine formaldehyde, tetra-alkoxysilane and wax. The following mechanical properties were assessed experiment...

  20. Biodegradation and moisture uptake modified starch-filled Linear ...

    African Journals Online (AJOL)

    Sixteen different modified-cassava starch-LLDPE blends containing starch in the range of 10-40% by weight were prepared. Calcium chloride, D-glucose, chloroform and alumina were differently used as modifying agents. The Moisture uptake and biodegradation of each of the composites were investigated. Both of these ...

  1. A Systematic Approach to Modified BCJR MAP Algorithms for Convolutional Codes

    Directory of Open Access Journals (Sweden)

    Patenaude François

    2006-01-01

    Full Text Available Since Berrou, Glavieux and Thitimajshima published their landmark paper in 1993, different modified BCJR MAP algorithms have appeared in the literature. The existence of a relatively large number of similar but different modified BCJR MAP algorithms, derived using the Markov chain properties of convolutional codes, naturally leads to the following questions. What is the relationship among the different modified BCJR MAP algorithms? What are their relative performance, computational complexities, and memory requirements? In this paper, we answer these questions. We derive systematically four major modified BCJR MAP algorithms from the BCJR MAP algorithm using simple mathematical transformations. The connections between the original and the four modified BCJR MAP algorithms are established. A detailed analysis of the different modified BCJR MAP algorithms shows that they have identical computational complexities and memory requirements. Computer simulations demonstrate that the four modified BCJR MAP algorithms all have identical performance to the BCJR MAP algorithm.

  2. Nuclear matter properties for modified Zimanyi-Moszkowski models

    International Nuclear Information System (INIS)

    Delfino, A.; Coelho, C.T.; Malheiro, M.

    1994-01-01

    Effective Lagrangians involving nucleons coupled to scalar and vector fields are investigated within the framework of relativistic mean-field theory. The study presents the traditional Walecka model and different kinds of scalar derivative coupling suggested by Zimanyi and Moszkowski (ZM). It is shown that the equations of state for all these modified ZM models are soft. The real part of the optical potential for these models is obtained. When compared with the unusual ZM model, the modified models present the peculiarity of giving simultaneously a smaller nucleon effective mass and a smaller incompressibility. This can be explained through the mesonic nonlinear scalar-vector coupling contained in these modified models. (author)

  3. [Assessment of allergenicity of genetically modified food crops].

    Science.gov (United States)

    Schauzu, M; Pöting, A; Rubin, D; Lampen, A

    2012-03-01

    The placing on the European Union's market of genetically modified crops requires authorization by the European Commission which is based on the proof that the derived foods are as safe as their conventional counterparts. The assessment of potential allergenicity is part of the necessary investigations recommended in the updated Guidance Document of the Scientific Panel on Genetically Modified Organisms (GMO) of the European Food Safety Authority (EFSA), which is based on internationally agreed recommendations. All genetically modified crops which so far have been authorized in the European Union were evaluated by the EFSA GMO Panel which considered it unlikely that their overall allergenicity has been altered.

  4. How to distinguish dark energy and modified gravity?

    International Nuclear Information System (INIS)

    Wei Hao; Zhang Shuangnan

    2008-01-01

    The current accelerated expansion of our universe could be due to an unknown energy component (dark energy) or a modification of general relativity (modified gravity). In the literature it has been proposed that combining the probes of the cosmic expansion history and growth history can distinguish between dark energy and modified gravity. In this work, without invoking nontrivial dark energy clustering, we show that the possible interaction between dark energy and dark matter could make the interacting dark model and the modified gravity model indistinguishable. An explicit example is also given. Therefore, it is required to seek some complementary probes beyond the ones of cosmic expansion history and growth history.

  5. Thin accretion disk signatures in dynamical Chern-Simons-modified gravity

    International Nuclear Information System (INIS)

    Harko, Tiberiu; Kovacs, Zoltan; Lobo, Francisco S N

    2010-01-01

    A promising extension of general relativity is Chern-Simons (CS)-modified gravity, in which the Einstein-Hilbert action is modified by adding a parity-violating CS term, which couples to gravity via a scalar field. In this work, we consider the interesting, yet relatively unexplored, dynamical formulation of CS-modified gravity, where the CS coupling field is treated as a dynamical field, endowed with its own stress-energy tensor and evolution equation. We consider the possibility of observationally testing dynamical CS-modified gravity by using the accretion disk properties around slowly rotating black holes. The energy flux, temperature distribution, the emission spectrum as well as the energy conversion efficiency are obtained, and compared to the standard general relativistic Kerr solution. It is shown that the Kerr black hole provides a more efficient engine for the transformation of the energy of the accreting mass into radiation than their slowly rotating counterparts in CS-modified gravity. Specific signatures appear in the electromagnetic spectrum, thus leading to the possibility of directly testing CS-modified gravity by using astrophysical observations of the emission spectra from accretion disks.

  6. Performance research on modified KCS (Kalina cycle system) 11 without throttle valve

    International Nuclear Information System (INIS)

    He, Jiacheng; Liu, Chao; Xu, Xiaoxiao; Li, Yourong; Wu, Shuangying; Xu, Jinliang

    2014-01-01

    Two modified systems based on a KCS (Kalina cycle system) 11 with a two-phase expander to substitute a throttle valve are proposed. The two-phase expander is located between the regenerator and the absorber in the B-modified cycle and between the separator and the regenerator in the C-modified cycle. A thermodynamic performance analysis of both the original KCS 11 and the modified systems is carried out. The optimization of two key parameters (the concentration of working fluid and the temperature of cooling water) is also conducted. It is shown that the two modified cycles have different performance under the investigated conditions. Results also indicate that the C-modified cycle can obtain better thermodynamic effect than the B-modified cycle. The temperature of cooling water plays an important role in improving the system performance. When the cooling water temperature drops from 303 K to 278 K, the C-modified cycle thermal efficiency can be improved by 27%. - Highlights: • Throttling valve is replaced by a two-phase expander to recover the expansion work. • Thermodynamic performance of two modified cycle systems is very different. • The maximum increase of work output by C-modified cycle compared with KCS (Kalina cycle system) 11 is 9.4%. • The ranges of ammonia content of B-modified cycle are rather larger

  7. Partial substitution of asphalt pavement with modified sulfur

    Directory of Open Access Journals (Sweden)

    E.R. Souaya

    2015-12-01

    Full Text Available The use of sulfur in pavement laying was developed in 1980 but it was restricted in the late 19th century due to its environmental problems and its high reactivity toward oxidation processes which give sulfuric acid products that are capable of destroying the asphalt mixture. The study involved the conversion of elemental sulfur to a more stable modified one using a combination of byproducts of olefin hydrocarbons that were obtained from petroleum fractional distillates and cyclic hydrocarbon bituminous residue at 145 °C. The changes in the structural characteristics and morphology of prepared modified sulfur were studied using XRD and SEM respectively. Also DSC curves help us to elucidate the changes in sulfur phases from α-orthorhombic to β-mono clinic structure. The technique of nanoindentation helps us to compare the mechanical properties of modified and pure sulfur including modulus of elasticity and hardness. The hot mixture asphalt designs were prepared according to the Marshall Method in which the asphalt binder content was partially substituted with 20%, 30%, 40%, and 50% modified sulfur. The mechanical properties were measured including Marshall Stability, flow, air voids, and Marshall Stiffness. From the overall study, the results indicated that asphalt could partially be substituted with modified sulfur with no significant deleterious effect on performance and durability of hot mixed asphalt.

  8. Value Modifier Public Use File

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Center for Medicare (CM) has created a standard analytical file intended to promote transparency. For each Value Modifier performance year, CM will publish a...

  9. Automatic bounding estimation in modified NLMS algorithm

    International Nuclear Information System (INIS)

    Shahtalebi, K.; Doost-Hoseini, A.M.

    2002-01-01

    Modified Normalized Least Mean Square algorithm, which is a sign form of Nlm based on set-membership (S M) theory in the class of optimal bounding ellipsoid (OBE) algorithms, requires a priori knowledge of error bounds that is unknown in most applications. In a special but popular case of measurement noise, a simple algorithm has been proposed. With some simulation examples the performance of algorithm is compared with Modified Normalized Least Mean Square

  10. Global Convergence of a Modified LS Method

    Directory of Open Access Journals (Sweden)

    Liu JinKui

    2012-01-01

    Full Text Available The LS method is one of the effective conjugate gradient methods in solving the unconstrained optimization problems. The paper presents a modified LS method on the basis of the famous LS method and proves the strong global convergence for the uniformly convex functions and the global convergence for general functions under the strong Wolfe line search. The numerical experiments show that the modified LS method is very effective in practice.

  11. Modified echo peak correction for radial acquisition regime (RADAR).

    Science.gov (United States)

    Takizawa, Masahiro; Ito, Taeko; Itagaki, Hiroyuki; Takahashi, Tetsuhiko; Shimizu, Kanichirou; Harada, Junta

    2009-01-01

    Because radial sampling imposes many limitations on magnetic resonance (MR) imaging hardware, such as on the accuracy of the gradient magnetic field or the homogeneity of B(0), some correction of the echo signal is usually needed before image reconstruction. In our previous study, we developed an echo-peak-shift correction (EPSC) algorithm not easily affected by hardware performance. However, some artifacts remained in lung imaging, where tissue is almost absent, or in cardiac imaging, which is affected by blood flow. In this study, we modified the EPSC algorithm to improve the image quality of the radial aquisition regime (RADAR) and expand its application sequences. We assumed the artifacts were mainly caused by errors in the phase map for EPSC and used a phantom on a 1.5-tesla (T) MR scanner to investigate whether to modify the EPSC algorithm. To evaluate the effectiveness of EPSC, we compared results from T(1)- and T(2)-weighted images of a volunteer's lung region using the current and modified EPSC. We then applied the modified EPSC to RADAR spin echo (SE) and RADAR balanced steady-state acquisition with rewound gradient echo (BASG) sequence. The modified EPSC reduced phase discontinuity in the reference data used for EPSC and improved visualization of blood vessels in the lungs. Motion and blood flow caused no visible artifacts in the resulting images in either RADAR SE or RADAR BASG sequence. Use of the modified EPSC eliminated artifacts caused by signal loss in the reference data for EPSC. In addition, the modified EPSC was applied to RADAR SE and RADAR BASG sequences.

  12. Modified echo peak correction for radial acquisition regime (RADAR)

    International Nuclear Information System (INIS)

    Takizawa, Masahiro; Ito, Taeko; Itagaki, Hiroyuki; Takahashi, Tetsuhiko; Shimizu, Kanichirou; Harada, Junta

    2009-01-01

    Because radial sampling imposes many limitations on magnetic resonance (MR) imaging hardware, such as on the accuracy of the gradient magnetic field or the homogeneity of B 0 , some correction of the echo signal is usually needed before image reconstruction. In our previous study, we developed an echo-peak-shift correction (EPSC) algorithm not easily affected by hardware performance. However, some artifacts remained in lung imaging, where tissue is almost absent, or in cardiac imaging, which is affected by blood flow. In this study, we modified the EPSC algorithm to improve the image quality of the radial acquisition regime (RADAR) and expand its application sequences. We assumed the artifacts were mainly caused by errors in the phase map for EPSC and used a phantom on a 1.5-tesla (T) MR scanner to investigate whether to modify the EPSC algorithm. To evaluate the effectiveness of EPSC, we compared results from T 1 -and T 2 -weighted images of a volunteer's lung region using the current and modified EPSC. We then applied the modified EPSC to RADAR spin echo (SE) and RADAR balanced steady-state acquisition with rewound gradient echo (BASG) sequence. The modified EPSC reduced phase discontinuity in the reference data used for EPSC and improved visualization of blood vessels in the lungs. Motion and blood flow caused no visible artifacts in the resulting images in either RADAR SE or RADAR BASG sequence. Use of the modified EPSC eliminated artifacts caused by signal loss in the reference data for EPSC. In addition, the modified EPSC was applied to RADAR SE and RADAR BASG sequences. (author)

  13. An Attempt for an Emergent Scenario with Modified Chaplygin Gas

    International Nuclear Information System (INIS)

    Mukerji, Sudeshna; Chakraborty, Subenoy; Dutta, Sourav

    2016-01-01

    The present work is an attempt for emergent universe scenario with modified Chaplygin gas. The universe is chosen as spatially flat FRW space-time with modified Chaplygin gas as the only cosmic substratum. It is found that emergent scenario is possible for some specific (unrealistic) choice of the parameters in the equation of state for modified Chaplygin gas.

  14. Screening for genetically modified organisms sequences in food ...

    African Journals Online (AJOL)

    We used the Allin 2.0 GMO screening system from Biosmart, Switzerland to screen for the presence of genetically modified food sequences in maize meal samples, fresh fruit and vegetables from some retailers around Gaborone, Botswana. The Allin 2.0 is a multiplex PCR system for the detection of genetically modified ...

  15. Modified random phase approximation for multipole excitations at finite temperature

    International Nuclear Information System (INIS)

    Nguyen Dinh Dang

    1991-01-01

    The modified finite temperature random phase approximation (modified FT-RPA) has been constructed with taking the influence of thermostat on the structure of quansiparticles into account. The modified FT-RPA linear response for electric quadrupole (λ π = 2 + ) and octupole (λ π = 3 - ) excitations in 5 8Ni has been calculated as a function of the nuclear temperature. As compared to the conventional FT-RPA the modified FT-RPA has given a stronger spreading for the strength distribution of quandrupole excitations at finite temperature T ≤ 3MeV. (author). 22 refs; 4 figs; 2 tabs

  16. [Genetically modified food--great unknown].

    Science.gov (United States)

    Cichosz, G; Wiackowski, S K

    2012-08-01

    Genetically modified food (GMF) creates evident threat to consumers' health. In spite of assurances of biotechnologists, DNA of transgenic plants is instable, so, synthesis of foreign, allergenic proteins is possible. Due to high trypsin inhibitor content the GMF is digested much more slowly what, alike Bt toxin presence, increases probability of alimentary canal diseases. Next threats are bound to the presence of fitoestrogens and residues of Roundup pesticide, that can diminish reproductiveness; and even lead to cancerogenic transformation through disturbance of human hormonal metabolism. In spite of food producers and distributors assurances that food made of GMF raw materials is marked, de facto consumers have no choice. Moreover, along the food law products containing less than 0.9% of GMF protein are not included into genetically modified food.

  17. Complexation thermodynamics of modified cyclodextrins

    DEFF Research Database (Denmark)

    Schönbeck, Jens Christian Sidney; Westh, Peter; Holm, Rene

    2014-01-01

    Inclusion complexes between two bile salts and a range of differently methylated β-cyclodextrins were studied in an attempt to rationalize the complexation thermodynamics of modified cyclodextrins. Calorimetric titrations at a range of temperatures provided precise values of the enthalpies (ΔH......°), entropies (ΔS°), and heat capacities (ΔCp) of complexation, while molecular dynamics simulations assisted the interpretation of the obtained thermodynamic parameters. As previously observed for several types of modified cyclodextrins, the substituents at the rims of the cyclodextrin induced large changes......° and then a strong decrease when the degree of substitution exceeded some threshold. Exactly the same trend was observed for ΔCp. The dehydration of nonpolar surface, as quantified by the simulations, can to a large extent explain the variation in the thermodynamic parameters. The methyl substituents form additional...

  18. Peptide-modified PELCL electrospun membranes for regulation of vascular endothelial cells

    Energy Technology Data Exchange (ETDEWEB)

    Zhou, Fang [School of Materials Science and Engineering, Tianjin Key Laboratory of Composite and Functional Materials, Tianjin University, Tianjin 300072 (China); Jia, Xiaoling [Key Laboratory for Biomechanics and Mechanobiology of Ministry of Education, School of Biological Science and Medical Engineering, Beihang University, Beijing 100083 (China); Yang, Yang [School of Materials Science and Engineering, Tianjin Key Laboratory of Composite and Functional Materials, Tianjin University, Tianjin 300072 (China); Yang, Qingmao; Gao, Chao [Key Laboratory for Biomechanics and Mechanobiology of Ministry of Education, School of Biological Science and Medical Engineering, Beihang University, Beijing 100083 (China); Zhao, Yunhui [School of Materials Science and Engineering, Tianjin Key Laboratory of Composite and Functional Materials, Tianjin University, Tianjin 300072 (China); Fan, Yubo, E-mail: yubofan@buaa.edu.cn [Key Laboratory for Biomechanics and Mechanobiology of Ministry of Education, School of Biological Science and Medical Engineering, Beihang University, Beijing 100083 (China); National Research Center for Rehabilitation Technical Aids, Beijing 100176 (China); Yuan, Xiaoyan, E-mail: yuanxy@tju.edu.cn [School of Materials Science and Engineering, Tianjin Key Laboratory of Composite and Functional Materials, Tianjin University, Tianjin 300072 (China)

    2016-11-01

    The efficiency of biomaterials used in small vascular repair depends greatly on their ability to interact with vascular endothelial cells (VECs). Rapid endothelialization of the vascular grafts is a promising way to prevent thrombosis and intimal hyperplasia. In this work, modification of electrospun membranes of poly(ethylene glycol)-b-poly(L-lactide-co-ε-caprolactone) (PELCL) by three different peptides for regulation of VECs were studied in order to obtain ideal bioactive biomaterials as small diameter vascular grafts. QK (a mimetic peptide to vascular endothelial growth factor), Arg-Glu-Asp-Val (REDV, a specific adhesive peptide to VECs) and Val-Ala-Pro-Gly (VAPG, a specific adhesive peptide to vascular smooth muscle cells) were investigated. Surface properties of the modified membranes and the response of VECs were verified. It was found that protein adsorption and platelet adhesion were effectively suppressed with the introduction of QK, REDV or VAPG peptides on the PELCL electrospun membranes. Both QK- and REDV-modified electrospun membranes could accelerate the proliferation of VECs in the first 9 days, and the QK-modified electrospun membrane promoted cell proliferation more significantly than the REDV-modified one. The REDV-modified PELCL membrane was the most favorable for VECs adhesion than QK- and VAPG-modified membranes. It was suggested that QK- or REDV-modified PELCL electrospun membranes may have great potential applications in cardiovascular biomaterials for rapid endothelialization in situ. - Highlights: • A series of peptide-modified PELCL electrospun membranes were prepared. • Hemocompatibility of the membranes was greatly improved by the modification. • QK-modified PELCL membrane promoted VECs proliferation more significantly. • REDV-modified PELCL membrane was the most favorable for VEC adhesion.

  19. Peptide-modified PELCL electrospun membranes for regulation of vascular endothelial cells

    International Nuclear Information System (INIS)

    Zhou, Fang; Jia, Xiaoling; Yang, Yang; Yang, Qingmao; Gao, Chao; Zhao, Yunhui; Fan, Yubo; Yuan, Xiaoyan

    2016-01-01

    The efficiency of biomaterials used in small vascular repair depends greatly on their ability to interact with vascular endothelial cells (VECs). Rapid endothelialization of the vascular grafts is a promising way to prevent thrombosis and intimal hyperplasia. In this work, modification of electrospun membranes of poly(ethylene glycol)-b-poly(L-lactide-co-ε-caprolactone) (PELCL) by three different peptides for regulation of VECs were studied in order to obtain ideal bioactive biomaterials as small diameter vascular grafts. QK (a mimetic peptide to vascular endothelial growth factor), Arg-Glu-Asp-Val (REDV, a specific adhesive peptide to VECs) and Val-Ala-Pro-Gly (VAPG, a specific adhesive peptide to vascular smooth muscle cells) were investigated. Surface properties of the modified membranes and the response of VECs were verified. It was found that protein adsorption and platelet adhesion were effectively suppressed with the introduction of QK, REDV or VAPG peptides on the PELCL electrospun membranes. Both QK- and REDV-modified electrospun membranes could accelerate the proliferation of VECs in the first 9 days, and the QK-modified electrospun membrane promoted cell proliferation more significantly than the REDV-modified one. The REDV-modified PELCL membrane was the most favorable for VECs adhesion than QK- and VAPG-modified membranes. It was suggested that QK- or REDV-modified PELCL electrospun membranes may have great potential applications in cardiovascular biomaterials for rapid endothelialization in situ. - Highlights: • A series of peptide-modified PELCL electrospun membranes were prepared. • Hemocompatibility of the membranes was greatly improved by the modification. • QK-modified PELCL membrane promoted VECs proliferation more significantly. • REDV-modified PELCL membrane was the most favorable for VEC adhesion.

  20. Microbial electrolysis cells with polyaniline/multi-walled carbon nanotube-modified biocathodes

    International Nuclear Information System (INIS)

    Chen, Yingwen; Xu, Yuan; Chen, Liuliu; Li, Peiwen; Zhu, Shemin; Shen, Shubao

    2015-01-01

    In this paper, we modified biocathodes with PANI (Polyaniline)/MWCNT (Multi-Walled Carbon Nanotube) composites to improve hydrogen production in single-chamber, membrane-free biocathode MECs. The results showed that the hydrogen production rates increased with an increase in applied voltage. At an applied voltage of 0.9 V, the modified biocathode MECs achieved a hydrogen production rate of 0.67m 3 m −3 d −1 , current density of 205 Am −3 , COD of 86.8%, coulombic efficiency of 72%, cathodic hydrogen recovery of 42%, and energy efficiency of 81% with respect to the electrical power input. LSV (Linear Sweep Voltammetry) scans, SEM (Scanning Electron Microscopy) images and DGGE (Denaturing Gradient Gel Electrophoresis) demonstrated that hydrogen production is catalyzed by the special biofilm attached on a modified biocathode, and the microorganism species and quantity present were significantly different between the modified biocathode and the non-modified biocathode. In general, the performance of MECs with modified biocathodes was improved in the presence of a higher current density and hydrogen generation rate. - Highlights: • Different PANI/MWCNT composites were prepared and used to modify biocathode in MECs. • The performance of MECs was improved by the modification. • 75% wt PANI/MWCNT modified biocathode showed the better capacity on hydrogen generation. • LVS, SEM, DGGE were determined to figure out the effect of modification on MECs. • PANI/MWCNT modified biocathode in MECs was first studied to push MECs technology forward

  1. Solid-Phase Synthesis of Modified Peptides as Putative Inhibitors of Histone Modifying Enzymes

    DEFF Research Database (Denmark)

    Cohrt, Anders Emil O'Hanlon

    to be compatible with all 20 naturally occurring amino acids, and were furthermore feasible on several commonly used polymeric supports. By using dilute SnCl4 for N -Boc deprotection, and NaOH for the release of material from the solid support, N -modified peptides were cleanly obtained in excellent yields...

  2. Consumer Preference for Genetically Modified Halal Yogurt Drinks

    Directory of Open Access Journals (Sweden)

    Siti Hasnah Hassan

    2017-06-01

    Full Text Available Consumers worldwide have reacted negatively to food products made from genetically modified (GM ingredients. This study strives to understand the importance placed by consumers on the features of a product when purchasing halal yogurt drinks with GM or non GM ingredient along with the level of antioxidants, price, flavor and Halal certification from JAKIM. In addition, their attitudes towards genetically modified foods, in general, and their purchase intention towards genetically modified yo- gurt drinks, in particular, were also determined. Experimental design using a convenience sampling was used; 120 eligible responses were received from the study using three types of yogurt drinks. The research findings showed that nutrition was deemed as being the most important product feature that influenced the decision in purchasing yogurt drinks, followed by freshness, price, flavor, variety, and origin. Furthermore, it was found that respondents presented a neutral attitude and purchase intention towards genetically modified yogurt drinks. The recommendations to market practitioners, research limitations, as well as suggestions for future studies are also discussed.

  3. Additives for cement compositions based on modified peat

    Energy Technology Data Exchange (ETDEWEB)

    Kopanitsa, Natalya, E-mail: kopanitsa@mail.ru; Sarkisov, Yurij, E-mail: sarkisov@tsuab.ru; Gorshkova, Aleksandra, E-mail: kasatkina.alexandra@gmail.com; Demyanenko, Olga, E-mail: angel-n@sibmail.com [Tomsk State University of Architecture and Building, 2, Solyanaya sq., Tomsk, 634003 (Russian Federation)

    2016-01-15

    High quality competitive dry building mixes require modifying additives for various purposes to be included in their composition. There is insufficient amount of quality additives having stable properties for controlling the properties of cement compositions produced in Russia. Using of foreign modifying additives leads to significant increasing of the final cost of the product. The cost of imported modifiers in the composition of the dry building mixes can be up to 90% of the material cost, depending on the composition complexity. Thus, the problem of import substitution becomes relevant, especially in recent years, due to difficult economic situation. The article discusses the possibility of using local raw materials as a basis for obtaining dry building mixtures components. The properties of organo-mineral additives for cement compositions based on thermally modified peat raw materials are studied. Studies of the structure and composition of the additives are carried out by physicochemical research methods: electron microscopy and X-ray analysis. Results of experimental research showed that the peat additives contribute to improving of cement-sand mortar strength and hydrophysical properties.

  4. Deactivation of nickel hydroxide-gold modified electrodes

    OpenAIRE

    Caram, Bruno; Tucceri, Ricardo

    2013-01-01

    The aim of the present work was to study how the charge-transport process of a nickel hydroxide film electrochemically synthesized on a gold substrate is modified when the electrode is stored for a long time. It was found that nickel hydroxide films are deactivated under storage, that is, films became less conductive than films immediately prepared (nondeactivated). This study was carried out in the context of the rotating disc electrode voltammetry when the modified electrode contacts an ele...

  5. Modified polysaccharides as alternative binders for foundry industry

    Directory of Open Access Journals (Sweden)

    K. Kaczmarska

    2016-10-01

    Full Text Available Polysaccharides constitute a wide group of important polymers with many commercial applications, for example food packaging, fibres, coatings, adhesives etc. This review is devoted to the presentation of polysaccharide application in foundry industry. In this paper the selected properties of foundry moulding sand and core sand containing modified polysaccharides as binders are presented according to foreign literature data. Also, author’s own research about effect of using moulding sand binder consisting of modified polysaccharide (modified starch or its composition with non-toxic synthetic polymers are discussed. Based on technologies taken under consideration in this paper, it could be concluded that polysaccharides are suitable as an alternative for use as binder in foundry moulding applications.

  6. Search for minimal paths in modified networks

    International Nuclear Information System (INIS)

    Yeh, W.-C.

    2002-01-01

    The problem of searching for all minimal paths (MPs) in a network obtained by modifying the original network, e.g. for network expansion or reinforcement, is discussed and solved in this study. The existing best-known method to solve this problem was a straightforward approach. It needed extensive comparison and verification, and failed to solve some special but important cases. Therefore, a more efficient, intuitive and generalized method to search for all MPs without an extensive research procedure is proposed. In this presentation, first we develop an intuitive algorithm based upon the reformation of all MPs in the original network to search for all MPs in a modified network. Next, the computational complexity of the proposed algorithm is analyzed and compared with the existing methods. Finally, examples illustrate how all MPs are generated in a modified network based upon the reformation of all of the MPs in the corresponding original network

  7. Modified iron oxide nanomaterials: Functionalization and application

    International Nuclear Information System (INIS)

    Bagheri, Samira; Julkapli, Nurhidayatullaili Muhd

    2016-01-01

    Iron oxide magnetic nanoparticles have aroused the interest of researchers of materials' chemistry due to its exceptional properties such as decent magnetic, electric, catalytic, biocompatibility, and low toxicity. However, these magnetic nanoparticles are predisposed towards aggregation and forming larger particles, due to its strong anisotropic dipolar interactions, particularly in the aqueous phase, consequently depriving them of dispersibility and particular properties, ultimately degrading their performance. Hence, this review focuses on modified magnetic nanoparticles that are stable, easily synthesized, possess a high surface area and could be facile-separated via magnetic forces, and are of low toxicity and costs for applications such as catalyst/catalyst support, food security, biomedical, and pollutant remediation. - Highlights: • Nanomagnetite is interesting due to its exceptional properties. • Nanomagnetite is predisposed towards aggregation and forming larger particles. • Modified nanomagnetite are stable, easily synthesized, possess high surface area. • Modified nanomagnetite got applications as catalyst/catalyst support.

  8. [Genetically modified food and allergies - an update].

    Science.gov (United States)

    Niemann, Birgit; Pöting, Annette; Braeuning, Albert; Lampen, Alfonso

    2016-07-01

    Approval by the European Commission is mandatory for placing genetically modified plants as food or feed on the market in member states of the European Union (EU). The approval is preceded by a safety assessment based on the guidance of the European Food Safety Authority EFSA. The assessment of allergenicity of genetically modified plants and their newly expressed proteins is an integral part of this assessment process. Guidance documents for the assessment of allergenicity are currently under revision. For this purpose, an expert workshop was conducted in Brussels on June 17, 2015. There, methodological improvements for the assessment of coeliac disease-causing properties of proteins, as well as the use of complex models for in vitro digestion of proteins were discussed. Using such techniques a refinement of the current, proven system of allergenicity assessment of genetically modified plants can be achieved.

  9. Attitudes towards genetically modified and organic foods.

    Science.gov (United States)

    Saher, Marieke; Lindeman, Marjaana; Hursti, Ulla-Kaisa Koivisto

    2006-05-01

    Finnish students (N=3261) filled out a questionnaire on attitudes towards genetically modified and organic food, plus the rational-experiential inventory, the magical thinking about food and health scale, Schwartz's value survey and the behavioural inhibition scale. In addition, they reported their eating of meat. Structural equation modelling of these measures had greater explanatory power for attitudes towards genetically modified (GM) foods than for attitudes towards organic foods (OF). GM attitudes were best predicted by natural science education and magical food and health beliefs, which mediated the influence of thinking styles. Positive attitudes towards organic food, on the other hand, were more directly related to such individual differences as thinking styles and set of values. The results of the study indicate that OF attitudes are rooted in more fundamental personal attributes than GM attitudes, which are embedded in a more complex but also in a more modifiable network of characteristics.

  10. Modified iron oxide nanomaterials: Functionalization and application

    Energy Technology Data Exchange (ETDEWEB)

    Bagheri, Samira; Julkapli, Nurhidayatullaili Muhd

    2016-10-15

    Iron oxide magnetic nanoparticles have aroused the interest of researchers of materials' chemistry due to its exceptional properties such as decent magnetic, electric, catalytic, biocompatibility, and low toxicity. However, these magnetic nanoparticles are predisposed towards aggregation and forming larger particles, due to its strong anisotropic dipolar interactions, particularly in the aqueous phase, consequently depriving them of dispersibility and particular properties, ultimately degrading their performance. Hence, this review focuses on modified magnetic nanoparticles that are stable, easily synthesized, possess a high surface area and could be facile-separated via magnetic forces, and are of low toxicity and costs for applications such as catalyst/catalyst support, food security, biomedical, and pollutant remediation. - Highlights: • Nanomagnetite is interesting due to its exceptional properties. • Nanomagnetite is predisposed towards aggregation and forming larger particles. • Modified nanomagnetite are stable, easily synthesized, possess high surface area. • Modified nanomagnetite got applications as catalyst/catalyst support.

  11. Research of complex briquetted modifiers influence on cast iron properties

    Directory of Open Access Journals (Sweden)

    Наталя Валеріївна Сусло

    2016-07-01

    Full Text Available Such properties of cast iron as hardness and shock resistance are relevant and have been investigated. Some possible ways to improve these properties have been studied and solutions to the assigned tasks in accordance with modern trends have been found. The use of nano-dispersed modifiers is most promising in modification. The compositions of experimental complex briquetted modifiers have been developed. The technology of cast iron processing with complex briquetted modifiers has been developed. A series of experiments on the effect of a complex briquetted modifier introduced into cast iron on its properties were carried out. The rational content of components in the briquette that makes maximum use of the modifying effect and improves such service characteristics of cast iron as hardness, impact - and wear-resistance has been defined. Ways of a briquette destruction in metal have been explored. The effect of an organic binder amount on the destruction of a briquette and its dissolution in the melt has been investigated. Rational composition of the briquetted modifier that makes it possible to increase hardness and impact resistance of cast iron has been developed

  12. Self-Consistent Sources Extensions of Modified Differential-Difference KP Equation

    Science.gov (United States)

    Gegenhasi; Li, Ya-Qian; Zhang, Duo-Duo

    2018-04-01

    In this paper, we investigate a modified differential-difference KP equation which is shown to have a continuum limit into the mKP equation. It is also shown that the solution of the modified differential-difference KP equation is related to the solution of the differential-difference KP equation through a Miura transformation. We first present the Grammian solution to the modified differential-difference KP equation, and then produce a coupled modified differential-difference KP system by applying the source generation procedure. The explicit N-soliton solution of the resulting coupled modified differential-difference system is expressed in compact forms by using the Grammian determinant and Casorati determinant. We also construct and solve another form of the self-consistent sources extension of the modified differential-difference KP equation, which constitutes a Bäcklund transformation for the differential-difference KP equation with self-consistent sources. Supported by the National Natural Science Foundation of China under Grant Nos. 11601247 and 11605096, the Natural Science Foundation of Inner Mongolia Autonomous Region under Grant Nos. 2016MS0115 and 2015MS0116 and the Innovation Fund Programme of Inner Mongolia University No. 20161115

  13. Modified Einstein and Finsler Like Theories on Tangent Lorentz Bundles

    CERN Document Server

    Stavrinos, Panayiotis; Vacaru, Sergiu I.

    2014-01-01

    We study modifications of general relativity, GR, with nonlinear dispersion relations which can be geometrized on tangent Lorentz bundles. Such modified gravity theories, MGTs, can be modeled by gravitational Lagrange density functionals $f(\\mathbf{R},\\mathbf{T},F)$ with generalized/ modified scalar curvature $\\mathbf{R}$, trace of matter field tensors $\\mathbf{T}$ and modified Finsler like generating function $F$. In particular, there are defined extensions of GR with extra dimensional "velocity/ momentum" coordinates. For four dimensional models, we prove that it is possible to decouple and integrate in very general forms the gravitational fields for $f(\\mathbf{R},\\mathbf{T},F)$--modified gravity using nonholonomic 2+2 splitting and nonholonomic Finsler like variables $F$. We study the modified motion and Newtonian limits of massive test particles on nonlinear geodesics approximated with effective extra forces orthogonal to the four-velocity. We compute the constraints on the magnitude of extra-acceleration...

  14. Optical and UV-Aging Properties of LDH-Modified Bitumen

    Directory of Open Access Journals (Sweden)

    Xing Liu

    2015-07-01

    Full Text Available Layered double hydroxides (LDHs are an ultraviolet-light (UV resistant material. In this study, LDHs were used to modify bitumen. The optical and UV aging properties of LDHs modified bitumen were investigated. Firstly, the thin films of bitumen, with and without LDHs, were prepared. By using the UV-Vis spectrophotometer, absorbance, reflectance, and transmittance of bituminous thin film were evaluated. The morphology of LDHs-modified bitumen was observed by using fluorescence microscopy (FM. Finally, the aging resistance of LDH-modified bitumen was investigated by using the UV-aging oven. Results indicated that the LDHs, especially with 5 wt % in the bitumen, can effectively absorb and reflect the UV light and improve the UV-aging resistance of bitumen. This implied that the addition of LDHs into bitumen had the potential to prolong the service life of asphalt pavement.

  15. Modified penoplasty for concealed penis in children.

    Science.gov (United States)

    Yang, Tianyou; Zhang, Liyu; Su, Cheng; Li, Zhongmin; Wen, Yingquan

    2013-09-01

    To report a modified penoplasty technique for concealed penis in children. Between January 2006 and June 2012, 201 cases of concealed penis were surgically repaired with modified penoplasty. The modified penoplasty technique consisted of 3 major steps: (1) degloved the penile skin and excised the inner prepuce, (2) advanced penoscrotal skin to cover penile shaft, and (3) fixed the penis base and reconstructed the penoscrotal angle. Two hundred one cases of concealed penis were enrolled in this study over a period of 6 years. Mean age at the time of surgery was 5.3 years (range 1-13 years) and mean operative time was 40 minutes (range 30-65minutes). All patients were routinely followed up at 1, 3, and 6 months after surgery. Most patients developed postoperative edema and were resolved within 1 month, whereas 20 cases developed prolonged postoperative edema, especially at the site of frenulum, which took 3 months to be resolved. Ten cases had retraction after surgery. No erection difficulties were recorded. Patients/parents reported better hygiene and improved visualization and accessibility of penis after surgery and were satisfied with the cosmetic outcome. The result of this study shows that the modified penoplasty technique is a simple, safe, and effective procedure for concealed penis with satisfied cosmetic outcome. Copyright © 2013 Elsevier Inc. All rights reserved.

  16. Factors Modifying Burnout in Osteopathic Medical Students.

    Science.gov (United States)

    Lapinski, Jessica; Yost, Morgan; Sexton, Patricia; LaBaere, Richard J

    2016-02-01

    The purposes of the current study are to examine factors modifying burnout and identify which of these factors place osteopathic medical students at risk for developing burnout. The current study used a cross-sectional study design and an anonymous, web-based survey to assess burnout and depression in osteopathic medical students. The survey included Maslach Burnout Inventory, the Patient Health Questionnaire, the Stressors and their impact scale, students' sleeping and studying habits, and students' extracurricular involvement. In total, 1294 osteopathic medical students completed the survey. Burnout was present in 516 (39.9%) osteopathic medical students, and 1006 (77.0%) met criteria for depression. Females were 1.5 times more likely to be burned out in comparison to males. For the burnout subscales, males had lower emotional exhaustion, slightly higher depersonalization, and lower personal accomplishment. Lesbian/gay/bisexual/asexual students were 2.62 times more likely to be burned out compared with heterosexual students. Depression and academic, personal, and family stressors were all strongly linked to overall burnout. Finally, for modifiable factors, average hours of sleep, average hours spent studying, and club involvement appeared to be linked to burnout. The current study suggested that a variety of factors, including non-modifiable, situational, and modifiable, impact burnout in osteopathic medical students. Future research is necessary since burnout in physicians affects the quality of care provided to patients.

  17. Parametrized post-Friedmann framework for modified gravity

    International Nuclear Information System (INIS)

    Hu, Wayne; Sawicki, Ignacy

    2007-01-01

    We develop a parametrized post-Friedmann (PPF) framework which describes three regimes of modified gravity models that accelerate the expansion without dark energy. On large scales, the evolution of scalar metric and density perturbations must be compatible with the expansion history defined by distance measures. On intermediate scales in the linear regime, they form a scalar-tensor theory with a modified Poisson equation. On small scales in dark matter halos such as our own galaxy, modifications must be suppressed in order to satisfy stringent local tests of general relativity. We describe these regimes with three free functions and two parameters: the relationship between the two metric fluctuations, the large and intermediate scale relationships to density fluctuations, and the two scales of the transitions between the regimes. We also clarify the formal equivalence of modified gravity and generalized dark energy. The PPF description of linear fluctuation in f(R) modified action and the Dvali-Gabadadze-Porrati braneworld models show excellent agreement with explicit calculations. Lacking cosmological simulations of these models, our nonlinear halo-model description remains an ansatz but one that enables well-motivated consistency tests of general relativity. The required suppression of modifications within dark matter halos suggests that the linear and weakly nonlinear regimes are better suited for making a complementary test of general relativity than the deeply nonlinear regime

  18. DNA immobilization on polymer-modified Si surface by controlling pH

    International Nuclear Information System (INIS)

    Demirel, Goekcen Birlik; Caykara, Tuncer

    2009-01-01

    A novel approach based on polymer-modified Si surface as DNA sensor platforms is presented. The polymer-modified Si surface was prepared by using 3-(methacryloxypropyl)trimethoxysilane [γ-MPS] and poly(acrylamide) [PAAm]. Firstly, a layer of γ-MPS was formed on the hydroxylated silicon surface as a monolayer and then modified with different molecular weight of PAAm to form polymer-modified surface. The polymer-modified Si surface was used for dsDNA immobilization. All steps about formation of layer structure were characterized by ellipsometry, atomic force microscopy (AFM), attenuated total reflectance Fourier transformed infrared (ATR-FTIR), and contact angle (CA) measurements. We found that in this case the amount of dsDNA immobilized onto the surface was dictated by the electrostatic interaction between the substrate surface and the DNA. Our results thus demonstrated that DNA molecules could be immobilized differently onto the polymer-modified support surface via electrostatic interactions.

  19. [Consumer reaction to information on the labels of genetically modified food].

    Science.gov (United States)

    Sebastian-Ponce, Miren Itxaso; Sanz-Valero, Javier; Wanden-Berghe, Carmina

    2014-02-01

    To analyze consumer opinion on genetically modified foods and the information included on the label. A systematic review of the scientific literature on genetically modified food labeling was conducted consulting bibliographic databases (Medline - via PubMed -, EMBASE, ISI-Web of knowledge, Cochrane Library Plus, FSTA, LILACS, CINAHL and AGRICOLA) using the descriptors "organisms, genetically modified" and "food labeling". The search covered the first available date, up to June 2012, selecting relevant articles written in English, Portuguese or Spanish. Forty articles were selected after applying the inclusion and exclusion criteria. All of them should have conducted a population-based intervention focused on consumer awareness of genetically modified foods and their need or not, to include this on the label. The consumers expressed a preference for non-genetically modified products, and added that they were prepared to pay more for this but, ultimately, the product bought was that with the best price, in a market which welcomes new technologies. In 18 of the articles, the population was in favor of obligatory labelling, and in six, in favor of this being voluntary; seven studies showed the consumer knew little about genetically modified food, and in three, the population underestimated the quantity they consumed. Price was an influencing factor in all cases. Label should be homogeneous and clarify the degree of tolerance of genetically modified products in humans, in comparison with those non-genetically modified. Label should also present the content or not of genetically modified products and how these commodities are produced and should be accompanied by the certifying entity and contact information. Consumers express their preference for non-genetically modified products and they even notice that they are willing to pay more for it, but eventually they buy the item with the best price, in a market that welcomes new technologies.

  20. Phase transition in a modified square Josephson-junction array

    CERN Document Server

    Han, J

    1999-01-01

    We study the phase transition in a modified square proximity-coupled Josephson-junction array with small superconducting islands at the center of each plaquette. We find that the modified square array undergoes a Kosterlitz-Thouless-Berezinskii-like phase transition, but at a lower temperature than the simple square array with the same single-junction critical current. The IV characteristics, as well as the phase transition, resemble qualitatively those of a disordered simple square array. The effects of the presence of the center islands in the modified square array are discussed.

  1. Genetic Modifiers of Sickle Cell Disease

    Science.gov (United States)

    Steinberg, Martin H.; Sebastiani, Paola

    2015-01-01

    Sickle cell anemia is associated with unusual clinical heterogeneity for a Mendelian disorder. Fetal hemoglobin concentration and coincident ∝ thalassemia, both which directly affect the sickle erythrocyte, are the major modulators of the phenotype of disease. Understanding the genetics underlying the heritable subphenotypes of sickle cell anemia would be prognostically useful, could inform personalized therapeutics, and might help the discovery of new “druggable” pathophysiologic targets. Genotype-phenotype association studies have been used to identify novel genetic modifiers. In the future, whole genome sequencing with its promise of discovering hitherto unsuspected variants could add to our understanding of the genetic modifiers of this disease. PMID:22641398

  2. MATERNAL EFFECTS IN ADVANCED HYBRIDS OF GENETICALLY MODIFIED AND NON-GENETICALLY MODIFIED BRASSICA SPECIES

    Science.gov (United States)

    Identification of fitness traits potentially impacted by gene flow from genetically modified (GM) crops to compatible relatives is of interest in risk assessments for GM crops. Reciprocal crosses were made between GM canola, Brassica napus cv. RaideRR that expresses CP4 EPSPS fo...

  3. Proposal for Modified Damage Probability Distribution Functions

    DEFF Research Database (Denmark)

    Pedersen, Preben Terndrup; Hansen, Peter Friis

    1996-01-01

    Immidiately following the Estonia disaster, the Nordic countries establishe a project entitled "Safety of Passenger/RoRo Vessels" As part of this project the present proposal for modified damage stability probability distribution functions has been developed. and submitted to "Sub-committee on st......Immidiately following the Estonia disaster, the Nordic countries establishe a project entitled "Safety of Passenger/RoRo Vessels" As part of this project the present proposal for modified damage stability probability distribution functions has been developed. and submitted to "Sub...

  4. Mechanical properties of polymer-modified porous concrete

    Science.gov (United States)

    Ariffin, N. F.; Jaafar, M. F. Md.; Shukor Lim, N. H. Abdul; Bhutta, M. A. R.; Hussin, M. W.

    2018-04-01

    In this research work, polymer-modified porous concretes (permeable concretes) using polymer latex and redispersible polymer powder with water-cement ratio of 30 %, polymer-cement ratios of 0 to 10 % and cement content of 300 kg/m3 are prepared. The porous concrete was tested for compressive strength, flexural strength, water permeability and void ratio. The cubes size of specimen is 100 mm ×100 mm × 100 mm and 150 mm × 150 mm × 150 mm while the beam size is 100 mm × 100 mm × 500 mm was prepared for particular tests. The tests results show that the addition of polymer as a binder to porous concrete gives an improvement on the strength properties and coefficient of water permeability of polymer-modified porous concrete. It is concluded from the test results that increase in compressive and flexural strengths and decrease in the coefficient of water permeability of the polymer-modified porous concrete are clearly observed with increasing of polymer-cement ratio.

  5. Modified GrabCut for human face segmentation

    Directory of Open Access Journals (Sweden)

    Dina Khattab

    2014-12-01

    Full Text Available GrabCut is a segmentation technique for 2D still color images, which is mainly based on an iterative energy minimization. The energy function of the GrabCut optimization algorithm is based mainly on a probabilistic model for pixel color distribution. Therefore, GrabCut may introduce unacceptable results in the cases of low contrast between foreground and background colors. In this manner, this paper presents a modified GrabCut technique for the segmentation of human faces from images of full humans. The modified technique introduces a new face location model for the energy minimization function of the GrabCut, in addition to the existing color one. This location model considers the distance distribution of the pixels from the silhouette boundary of a fitted head, of a 3D morphable model, to the image. The experimental results of the modified GrabCut have demonstrated better segmentation robustness and accuracy compared to the original GrabCut for human face segmentation.

  6. Specific heat of nano-ferrites modified composites

    Directory of Open Access Journals (Sweden)

    Muntenita Cristian

    2017-01-01

    Full Text Available The specific heat of nano-ferrites modified composites was studied using differential scanning calorimeter (DSC method in the temperature range of 30 to 150°C. Initially, nano-ferrites were introduced in epoxy systems in order to improve the electromagnetic properties of formed materials. Together with the changes in electromagnetic properties some modifications occur regarding thermal and mechanical properties. The materials were formed by placing 5g or 10g of ferrite into 250g polymer matrix leading to a very low weight ratio of modifying agent. At so low ratios the effect of ferrite presence should be insignificant according to mixing rule. Anyway there is possible to appear some chelation reaction with effects on thermal properties of materials. Three types of epoxy resins had been used as matrix and barium ferrite and strontium ferrite as modifying agents. The thermal analysis was developed on two heatingcooling cycles and the specific heat was evaluated for each segment of the cycle analysis.

  7. 49 CFR 1150.23 - Modified certificate of public convenience and necessity.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 8 2010-10-01 2010-10-01 false Modified certificate of public convenience and..., ACQUIRE, OR OPERATE RAILROAD LINES Modified Certificate of Public Convenience and Necessity § 1150.23 Modified certificate of public convenience and necessity. (a) The operator must file a notice with the...

  8. Adsorption of Hydrophobically Modified Polyelectrolytes on Hydrophobic Substrates Adsorption de polyélectrolytes modifiés hydrophobiquement sur les substrats hydrophobes

    Directory of Open Access Journals (Sweden)

    Mays J. W.

    2006-12-01

    Full Text Available A series of diblock copolymers, poly (tert-butyl styrene-sodium poly (styrene sulfonate with different molecular weight and percentage of sulfonation have been used to study the effect of polymer structure on its adsorption behavior onto hydrophobically modified silicon wafers. The percentage of the hydrophobic block varies from 3. 6-8. 9%. Previous studies show that salt concentration is very important for the adsorption of such polyelectrolytes onto silica surfaces. Octadecyltriethoxysilane (OTE has been used to modify the silicon wafer which changes the water contact angle from 50° on unmodified silica to 100° to 120°. On this hydrophobic surface, we found that the adsorption of these slightly hydrophobically modified polyelectrolytes is close to the 4/23rd power of salt concentration predicted by a recent model. The grafting density is also consistent with a dependence on the length of the hydrophobic block to the -12/23rd power, and the length of the polyelectrolyte block to the -6/23rd power, predicted by this model. Une série de copolymères à diblocs poly (tert-butyle styrène-sodium (sulfonate de polystyrène de masses moléculaires et pourcentages de sulfonation différents ont été utilisés pour étudier les effets de la structure du polymère sur son pouvoir d'adsorption sur des surfaces de silicium modifiées hydrophobiquement. Le pourcentage du bloc hydrophobe varie de 3,6 à 8,9%. Les études antérieures montrent que la concentration saline est très importante pour l'adsorption de ces polyélectrolytes sur les surfaces de silice. Nous avons utilisé l'octadecyltriéthoxysilane (OTE pour modifier la surface de silicium qui change l'angle de contact de l'eau de 50° sur la silice non modifiée à une valeur comprise entre 100° et 120° sur la silice modifiée. Sur cette surface hydrophobe, nous constatons que l'adsorption de ces polyélectrolytes légèrement modifiés hydrophobiquement est proche de la loi puissance 4

  9. ASPECTS ON CONSUMERS ATTITUDE TOWARD GENETICALLY MODIFIED FOODS AMONG YOUTH

    Directory of Open Access Journals (Sweden)

    Alexandrina, SÎRBU

    2014-11-01

    Full Text Available Advances in food biotechnology and food science in the early 1990s have opened the gates of new markets for genetically modified foods. A broad dispute over the use of foods derived from genetically modified organisms and other uses of genetic engineering in food production in terms of key scientific researches, their impact on health and eco-systems, food safety and food security, labelling and regulations, traceability is still lasting. Beside the scientifically, technical, ethical and regulators arguments, the economical aspects of the genetically modified food market is influenced by the social acceptance of it. Consumers' perception and their attitudes are different and depending on many factors. A survey of youth as undergraduate students of Constantin Brancoveanu University from Romania revealed certain differences in attitudes regarding the genetically modified foods that may be partially explained by the consumers' information. Referring the consumer behaviour, this study showed rather a tacit attitude of acceptance of the genetically modified food goods than a vehement rejection.

  10. Removal of ammonium from aqueous solutions using alkali-modified biochars

    Directory of Open Access Journals (Sweden)

    Zhigang Liu

    2016-10-01

    Full Text Available Biochars converted from agricultural residuals can effectively remove ammonium from water. This work further improved the sorption ability of biochars to aqueous ammonium through alkali modification. Three modified biochars were prepared from agricultural residuals pre-treated with NaOH solution through low-temperature (300 °C slow pyrolysis. The modified biochars effectively removed ammonium ions from water under various conditions with relatively fast adsorption kinetics (reached equilibrium within 10 h and extremely high adsorption capacity (>200 mg/g. The Langmuir maximum capacity of the three modified biochars were between 313.9 and 518.9 mg/g, higher than many other ammonium adsorbents. Although the sorption of ammonium onto the modified biochar was affected by pH and temperature, it was high under all of the tested conditions. Findings from this work indicated that alkali-modified biochars can be used as an alternative adsorbent for the removal of ammonium from wastewater.

  11. Acceleration from Modified Gravity: Lessons from Worked Examples

    International Nuclear Information System (INIS)

    Hu, Wayne

    2009-01-01

    I examine how two specific examples of modified gravity explanations of cosmic acceleration help us understand some general problems confronting cosmological tests of gravity: how do we distinguish modified gravity from dark energy if they can be made formally equivalent? how do we parameterize deviations according to physical principles with sufficient generality, yet focus cosmological tests into areas that complement our existing knowledge of gravity? how do we treat the dynamics of modifications which necessarily involve non-linearities that preclude superposition of forces? The modified action f(R) and DGP braneworld models provide insight on these question as fully-worked examples whose expansion history, linear perturbation theory, and most recently, non-linear N-body and force-modification field dynamics of cosmological simulations are available for study.

  12. Morphological Effect of Non-targeted Biomolecule-Modified MNPs on Reticuloendothelial System.

    Science.gov (United States)

    Li, Xiao; Hu, Yan; Xiao, Jie; Cheng, Dengfeng; Xiu, Yan; Shi, Hongcheng

    2015-12-01

    Magnetic nanoparticles (MNPs) with special morphology were commonly used as biomaterials, while morphological effects of non-targeted biomolecule-modified MNPs on biological behaviors were still unclear. In this research, spherical and rod-like Fe3O4 in a comparable size were synthesized and then surface-modified by bovine serum albumin (BSA) as a model of non-targeted biomolecule-modified MNPs. Morphological effects were featured by TEM and quantification of in vitro phagocytic uptake, as well as the in vivo quantification of particles in reticuloendothelial system (RES)-related organs of normal Kunming mice. For these non-targeted BSA-modified MNPs, intracellular distributions were the same, but the rod-like MNPs were more likely to be uptake by macrophages; furthermore, the BSA-modified MNPs gathered in RES-related organs soon after intravenous injection, but the rod-like ones were expelled from the lung more quickly and expelled from the spleen more slowly. These preliminary results may be referable if MNPs or other similar biomolecule-modified nanoparticles were used.

  13. Effect of nanosilica particles on polypropylene polymer modified asphalt mixture performance

    Directory of Open Access Journals (Sweden)

    Nura Bala

    2018-06-01

    Full Text Available The current study was conducted to investigate the effect of nanosilica particles on the performance characteristics of polymer modified asphalt binders. In this study, control 80/100 binder were modified with polypropylene polymer and nanosilica particles at concentration of 0%–4%. Both nanosilica particles and polypropylene polymer were added by weight of total bitumen content. The asphalt performance tests flexural four point beam fatigue test, indirect tensile strength, indirect tensile stiffness modulus and draindown tests are conducted to evaluate the effect of nanosilica particles. The results of the study shows that nanosilica particles improves the fatigue properties of polypropylene polymer modified binder. This indicates that nanosilica particles have significant effect on improving the performance properties of polymer modified binders. Also, the result reveals that thermoplastic polymer polypropylene with nanosilica particles when used as bitumen modifiers improve the performance and durability of asphalt mixtures. Keywords: Polypropylene, Fatigue cracking, Stiffness modulus, Modified asphalt, Draindown

  14. Safety assessment of foods derived from genetically modified crops

    NARCIS (Netherlands)

    Kleter, G.A.; Kuiper, H.A.

    2003-01-01

    The pre-market safety assessment of foods derived from genetically modified crops is carried out according to the consensus approach of "substantial equivalence", in other words: the comparative safety assessment. Currently, the safety assessment of genetically modified foods is harmonized at the

  15. 40 CFR 721.10151 - Modified styrene, divinylbenzene polymer (generic).

    Science.gov (United States)

    2010-07-01

    ... polymer (generic). 721.10151 Section 721.10151 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY... Specific Chemical Substances § 721.10151 Modified styrene, divinylbenzene polymer (generic). (a) Chemical... as modified styrene, divinylbenzene polymer (PMN P-07-642) is subject to reporting under this section...

  16. Applications of Graphene-Modified Electrodes in Microbial Fuel Cells

    Directory of Open Access Journals (Sweden)

    Fei Yu

    2016-09-01

    Full Text Available Graphene-modified materials have captured increasing attention for energy applications due to their superior physical and chemical properties, which can significantly enhance the electricity generation performance of microbial fuel cells (MFC. In this review, several typical synthesis methods of graphene-modified electrodes, such as graphite oxide reduction methods, self-assembly methods, and chemical vapor deposition, are summarized. According to the different functions of the graphene-modified materials in the MFC anode and cathode chambers, a series of design concepts for MFC electrodes are assembled, e.g., enhancing the biocompatibility and improving the extracellular electron transfer efficiency for anode electrodes and increasing the active sites and strengthening the reduction pathway for cathode electrodes. In spite of the challenges of MFC electrodes, graphene-modified electrodes are promising for MFC development to address the reduction in efficiency brought about by organic waste by converting it into electrical energy.

  17. Introducing Modified Degree 4 Chordal Rings with Two Chord Lengths

    DEFF Research Database (Denmark)

    Pedersen, Jens Myrup

    2007-01-01

    In this paper an analysis of modified degree 4 Chordal Rings with two chord lengths named CHRm is presented and compared to similar topologies: Chordal Rings, N2R and modified N2R. Formulas for approximating diameters and average path lengths are provided and verified, and it is shown...... that the distances in CHRm are significantly smaller than in traditional Chordal Rings and N2R, and also smaller than modified N2R for topologies with up to 1500 nodes. Despite the proposed CHRm being of degree 4, and the modified N2R of degree 3, CHRm may be better suited for the optical level of fiber rings, due...

  18. Aptamer-conjugated dendrimer-modified quantum dots for glioblastoma cells imaging

    International Nuclear Information System (INIS)

    Li Zhiming; Huang Peng; He Rong; Bao Chenchen; Cui Daxiang; Zhang Xiaomin; Ren Qiushi

    2009-01-01

    Targeted quantum dots have shown potential as a platform for development of cancer imaging. Aptamers have recently been demonstrated as ideal candidates for molecular targeting applications. In present work, polyamidoamine dendrimers were used to modify surface of quantum dots and improve their solubility in water solution. Then, dendrimer-modified quantum dots were conjugated with DNA aptamer, GBI-10, can recognize the extracellular matrix protein tenascin-C on the surface of human glioblastoma cells. The dendrimer-modified quantum dots exhibit water-soluble, high quantum yield, and good biocompatibility. Aptamer-conjugated quantum dots can specifically target U251 human glioblastoma cells. High-performance aptamer-conjugated dendrimers modified quantum dot-based nanoprobes have great potential in application such as cancer imaging.

  19. Comment on the modified Beer-Lambert law for scattering media

    International Nuclear Information System (INIS)

    Sassaroli, Angelo; Fantini, Sergio

    2004-01-01

    We present a concise overview of the modified Beer-Lambert law, which has been extensively used in the literature of near-infrared spectroscopy (NIRS) of scattering media. In particular, we discuss one form of the modified Beer-Lambert law that is commonly found in the literature and that is not strictly correct. However, this incorrect form of the modified Beer-Lambert law still leads to the correct expression for the changes in the continuous wave optical signal associated with changes in the absorption coefficient of the investigated medium. Here we propose a notation for the modified Beer-Lambert law that keeps the typical form commonly found in the literature without introducing any incorrect assumptions. (note)

  20. Comment on the modified Beer-Lambert law for scattering media.

    Science.gov (United States)

    Sassaroli, Angelo; Fantini, Sergio

    2004-07-21

    We present a concise overview of the modified Beer-Lambert law, which has been extensively used in the literature of near-infrared spectroscopy (NIRS) of scattering media. In particular, we discuss one form of the modified Beer-Lambert law that is commonly found in the literature and that is not strictly correct. However, this incorrect form of the modified Beer-Lambert law still leads to the correct expression for the changes in the continuous wave optical signal associated with changes in the absorption coefficient of the investigated medium. Here we propose a notation for the modified Beer-Lambert law that keeps the typical form commonly found in the literature without introducing any incorrect assumptions.

  1. Descriptive and discourse-referential modifiers in a layered model of the noun phrase

    DEFF Research Database (Denmark)

    Rijkhoff, Jan

    2008-01-01

    This article argues that adnominal modifiers in a layered model of the noun phrase can be divided into two major subcategories: descriptive modifiers and discourse-referential modifiers. Whereas descriptive modifiers can be subdivided into classifying, qualifying, quantifying and localizing...... modifiers (section 2), discourse-referential modifiers in the noun phrase are concerned with the status of entities as referents in the world of discourse (section 3). I will pay particular attention to three issues: (i) formal reflections of the layered, semantic structure of the noun phrase (section 4...

  2. How modifiable factors influence parental decision-making about organ donation.

    Science.gov (United States)

    Luberda, Kamila; Cleaver, Karen

    2017-11-07

    A global shortage of organs from children and adults available for transplantation is compounded by the failure of next of kin to consent for organs to be donated after death. Non-modifiable and modifiable factors influence decision-making in this area. Modifiable factors are of interest when examining families' decision-making about the donation of organs from their deceased child. A scoping review was undertaken to determine how modifiable factors influence parental decision-making about organ donation. Thematic analysis identified two themes: interactions with healthcare professionals and pre-disposition to organ donation. Satisfaction with experiences of hospital care, the information provided and the way it was communicated, as well as interactions pertaining to emotional support were all found to be modifiable factors that influenced decision making. Likewise, a predisposition to organ donation and knowing the deceased's wishes were associated with the consent decision. Nurses working in critical care environments need to be able to support parents during this difficult time. This article aims to raise awareness of modifiable factors that influence parental decision-making, highlighting their relevance for children's nursing practice. ©2017 RCN Publishing Company Ltd. All rights reserved. Not to be copied, transmitted or recorded in any way, in whole or part, without prior permission of the publishers.

  3. Piezoelectric properties and thermal stabilities of cobalt-modified potassium bismuth titanate

    International Nuclear Information System (INIS)

    Guo, Zhen-Lei; Wang, Chun-Ming; Zhao, Tian-Long; Yu, Si-Long; Cao, Zhao-Peng

    2013-01-01

    The cobalt-modified potassium bismuth titanate (K 0.5 Bi 4.5 Ti 4 O 15 , KBT) piezoelectric ceramics have been prepared using conventional solid–state reaction. X-ray diffraction analysis revealed that the cobalt-modified KBT ceramics have a pure four-layer (m = 4) Aurivillius-type structure. The dielectric, ferroelectric, and piezoelectric properties of cobalt-modified KBT ceramics were investigated in detail. The piezoelectric activities of KBT ceramics were significantly improved by the cobalt modification. The reasons for piezoelectric activities enhancement with cobalt modification were given. The piezoelectric coefficient d 33 and Curie temperature T c for the 5 mol% cobalt-modified KBT ceramics (KBT-Co5) were found to be 28 pC/N and 575 °C, respectively. The DC resistivity, frequency constants (N p and N t ), and electromechanical properties at elevated temperature were investigated, indicating the cobalt-modified KBT piezoelectric ceramics possess stable piezoelectric properties up to 500 °C. The results show the cobalt-modified KBT ceramics are potential materials for high temperature piezoelectric applications. - Highlights: • We examine the piezoelectric properties of the cobalt-modified K 0.5 Bi 4.5 Ti 4 O 15 . • A high level of piezoelectric activities (d 33 = 28 pC/N) are obtained. • High Curie temperature (T c = 575 °C) is acquired for the optimal composition. • The Co-modified K 0.5 Bi 4.5 Ti 4 O 15 is promising as high temperature materials

  4. Antibacterial effect of silver nanofilm modified stainless steel surface

    Science.gov (United States)

    Fang, F.; Kennedy, J.; Dhillon, M.; Flint, S.

    2015-03-01

    Bacteria can attach to stainless steel surfaces, resulting in the colonization of the surface known as biofilms. The release of bacteria from biofilms can cause contamination of food such as dairy products in manufacturing plants. This study aimed to modify stainless steel surfaces with silver nanofilms and to examine the antibacterial effectiveness of the modified surface. Ion implantation was applied to produce silver nanofilms on stainless steel surfaces. 35 keV Ag ions were implanted with various fluences of 1 × 1015 to 1 × 1017 ions•cm-2 at room temperature. Representative atomic force microscopy characterizations of the modified stainless steel are presented. Rutherford backscattering spectrometry spectra revealed the implanted atoms were located in the near-surface region. Both unmodified and modified stainless steel coupons were then exposed to two types of bacteria, Pseudomonas fluorescens and Streptococcus thermophilus, to determine the effect of the surface modification on bacterial attachment and biofilm development. The silver modified coupon surface fluoresced red over most of the surface area implying that most bacteria on coupon surface were dead. This study indicates that the silver nanofilm fabricated by the ion implantation method is a promising way of reducing the attachment of bacteria and delay biofilm formation.

  5. Preparation and Performance of Asphalt Compound Modified with Waste Crumb Rubber and Waste Polyethylene

    Directory of Open Access Journals (Sweden)

    Yuqiao Yang

    2016-01-01

    Full Text Available Three kinds of modified asphalt were prepared by adding waste crumb rubber (WCR, waste polyethylene (WPE, and WCR/WPE to base asphalt, respectively. The influence of different doses on the performance of modified asphalt, such as 25°C penetration, softening point, 5°C ductility, and 135°C, 165°C viscosity, was studied, and the modification mechanism of modified asphalt was discussed through the fluorescence microscope. As the waterproofing materials, the waterproofness of WCR/WPE compound modified asphalt was tested. The results show that the WPE modified asphalt has excellent resistance to high temperature and WCR modified asphalt has good low temperature resistance. The resistance to deformation ability of WPE modified asphalt is better than that of the WCR modified asphalt. The 135°C viscosity of compound modified asphalt is better than that of WPE and WCR modified asphalt. In addition, the waterproofness of compound modified asphalt using waterproofing materials is better than that of common waterproofing materials.

  6. Modifying the test of understanding graphs in kinematics

    Science.gov (United States)

    Zavala, Genaro; Tejeda, Santa; Barniol, Pablo; Beichner, Robert J.

    2017-12-01

    In this article, we present several modifications to the Test of Understanding Graphs in Kinematics. The most significant changes are (i) the addition and removal of items to achieve parallelism in the objectives (dimensions) of the test, thus allowing comparisons of students' performance that were not possible with the original version, and (ii) changes to the distractors of some of the original items that represent the most frequent alternative conceptions. The final modified version (after an iterative process involving four administrations of test variations over two years) was administered to 471 students of an introductory university physics course at a large private university in Mexico. When analyzing the final modified version of the test it was found that the added items satisfied the statistical tests of difficulty, discriminatory power, and reliability; also, that the great majority of the modified distractors were effective in terms of their frequency selection and discriminatory power; and, that the final modified version of the test satisfied the reliability and discriminatory power criteria as well as the original test. Here, we also show the use of the new version of the test, presenting a new analysis of students' understanding not possible to do before with the original version of the test, specifically regarding the objectives and items that in the new version meet parallelisms. Finally, in the PhysPort project (physport.org), we present the final modified version of the test. It can be used by teachers and researchers to assess students' understanding of graphs in kinematics, as well as their learning about them.

  7. The influence of virus infections on antioxidant levels in the genetically modified plum variety "Honeysweet" (Prunus domestica L.

    Directory of Open Access Journals (Sweden)

    Jiri Sochor

    2015-08-01

    Full Text Available It is well-known that polyphenolic compounds are found abundantly in fruit, but various kinds of diseases  lower these levels. This work measures total polyphenolic content, antioxidant activity and the levels of specific important antioxidants in fruits of the genetically modified (GM plum variety HoneySweet, trees  which were previously inoculated with a range of different virus infections.  These were the Plum Pox virus (PPV, Prune Dwarf virus (PDV and Apple Chlorotic Leaf-Spot virus (ACLSV. Uninoculated trees were used as controls. Antioxidant activity was measured using four different photometric  methods – DPPH (2,2-diphenyl-1-picrylhydrazyl, DMPD (N-dimethyl-p-phenylenediamine, ABTS (2,2-azino-bis-3-ethylbenzothiazoline-6-sulfonic acid and FRAP (Ferric reducing antioxidant power. Total polyphenol content was measured using the Folin–Ciocalteau method. The profiles of 10 specific antioxidant constituents in the fruits of the GM plum variety HoneySweet were detected and analyzed, since these are of interest for their role in human diets and could play a role in the resistance of plants to viruses. Detection was made using HPLC with UV-VIS detection.  They were: gallic acid, p-coumaric acid, 4-aminobenzoic acid, chlorogenic acid, caffeic acid, ferulic acid, vanillin, rutin and quercetin. The compound with the highest concentration was chlorogenic acid (587 mg/100 g, and that with the lowest was p-coumaric acid (0.95 mg/100 g. Of the four methods of antioxidant activity used, in three the lowest levels of antioxidant activity were seen where the PPV virus was combined with ACLSV, and in three the highest levels were seen in the un-inoculated control without any infection. The highest values of total polyphenols were seen in the control (65.3 mg/100 g, followed by infection of PPV, then treatment PPV, PDV and ACLSV, then treatment PPV and PDV and finally the lowest levels were seen in treatment PPV and ACLSV (44.2 mg/100 g, which

  8. A Modified Homogeneous Balance Method and Its Applications

    International Nuclear Information System (INIS)

    Liu Chunping

    2011-01-01

    A modified homogeneous balance method is proposed by improving some key steps in the homogeneous balance method. Bilinear equations of some nonlinear evolution equations are derived by using the modified homogeneous balance method. Generalized Boussinesq equation, KP equation, and mKdV equation are chosen as examples to illustrate our method. This approach is also applicable to a large variety of nonlinear evolution equations. (general)

  9. Exact solutions for modified Korteweg-de Vries equation

    International Nuclear Information System (INIS)

    Sarma, Jnanjyoti

    2009-01-01

    Using the simple wave or traveling wave solution technique, many different types of solutions are derived for modified Korteweg-de Vries (KdV) equation. The solutions are obtained from the set of nonlinear algebraic equations, which can be derived from the modified Korteweg-de Vries (KdV) equation by using the hyperbolic transformation method. The method can be applicable for similar nonlinear wave equations.

  10. Phase diagram of a modified Lennard-Jones system

    International Nuclear Information System (INIS)

    Sakagami, Takahiro; Fuchizaki, Kazuhiro

    2010-01-01

    The well-known Lennard-Jones potential is modified in such a way that it smoothly vanishes at a certain distance. A system whose interparticle interaction is given by such a potential is referred to as a modified Lennard-Jones system, and is served as a standard system describing simple solids and fluids. A phase diagram is determined based on the free energies obtained through thermodynamic integration.

  11. Avoidable and unavoidable exergy destructions of a fluidized bed coal combustor and a heat recovery steam generator

    International Nuclear Information System (INIS)

    Callak, Meliha; Balkan, Firuz; Hepbasli, Arif

    2015-01-01

    Highlights: • Performing advanced exergy analysis of a fluidized-bed combustion for the first time. • Comparing conventional and modified exergy efficiencies of the subsystems. • Deducting inefficiencies of the system components for possible improvements. - Abstract: Advanced exergy analysis was performed using the actual operational data taken from a fluidized bed coal combustor (FBCC) and a heat recovery steam generator (HRSG) in a textile plant located at Torbalı, Izmir. First, the conventional exergy analysis of the units was carried out. The exergetic efficiencies of the units were found to be 44.2% and 46.2%, respectively. Advanced exergy analysis was then performed by splitting the exergy destructions of the units into avoidable and unavoidable parts. The avoidable exergy destruction rates of the FBCC and the HRSG were determined to be 2999 kW and 760 kW according to the measurements. Correspondingly, the exergy efficiencies were modified to 53.1% and 48.1%, respectively

  12. Solar system constraints on multifield theories of modified dynamics

    NARCIS (Netherlands)

    Sanders, R. H.

    2006-01-01

    Any viable theory of modified Newtonian dynamics (MOND) as modified gravity is likely to require fields in addition to the usual tensor field of General Relativity. For these theories, the MOND phenomenology emerges as an effective fifth force probably associated with a scalar field. Here, I

  13. Proposal for a Test Protocol for Genetically Modified Plants

    DEFF Research Database (Denmark)

    Strandberg, B.; Kjær, C.

    1999-01-01

    The report contains the proceedings from the conference Genetically Modified Organisms in Nordic Habitats - Sustainable Use or Loss of Diversity? in Helsinki, 1998......The report contains the proceedings from the conference Genetically Modified Organisms in Nordic Habitats - Sustainable Use or Loss of Diversity? in Helsinki, 1998...

  14. Study on effective modifiers for damaging salts in mortar

    NARCIS (Netherlands)

    Granneman, S.J.C.; Ruiz-Agudo, E.; Lubelli, B.A.; Hees, R.P.J. van; Rodgriguez-Navarro

    2014-01-01

    The use of crystallization modifiers for the prevention or mitigation of salt crystallization damage has recently received a lot of research interest in the field of building conservation. However, the use of crystallization modifiers mixed in a lime-based mortar, is still a very new field of

  15. Generalized gravity from modified DFT

    International Nuclear Information System (INIS)

    Sakatani, Yuho; Uehara, Shozo; Yoshida, Kentaroh

    2017-01-01

    Recently, generalized equations of type IIB supergravity have been derived from the requirement of classical kappa-symmetry of type IIB superstring theory in the Green-Schwarz formulation. These equations are covariant under generalized T-duality transformations and hence one may expect a formulation similar to double field theory (DFT). In this paper, we consider a modification of the DFT equations of motion by relaxing a condition for the generalized covariant derivative with an extra generalized vector. In this modified double field theory (mDFT), we show that the flatness condition of the modified generalized Ricci tensor leads to the NS-NS part of the generalized equations of type IIB supergravity. In particular, the extra vector fields appearing in the generalized equations correspond to the extra generalized vector in mDFT. We also discuss duality symmetries and a modification of the string charge in mDFT.

  16. Generalized gravity from modified DFT

    Energy Technology Data Exchange (ETDEWEB)

    Sakatani, Yuho [Department of Physics, Kyoto Prefectural University of Medicine,Kyoto 606-0823 (Japan); Fields, Gravity and Strings, CTPU,Institute for Basic Sciences, Daejeon 34047 (Korea, Republic of); Uehara, Shozo [Department of Physics, Kyoto Prefectural University of Medicine,Kyoto 606-0823 (Japan); Yoshida, Kentaroh [Department of Physics, Kyoto University,Kitashirakawa Oiwake-cho, Kyoto 606-8502 (Japan)

    2017-04-20

    Recently, generalized equations of type IIB supergravity have been derived from the requirement of classical kappa-symmetry of type IIB superstring theory in the Green-Schwarz formulation. These equations are covariant under generalized T-duality transformations and hence one may expect a formulation similar to double field theory (DFT). In this paper, we consider a modification of the DFT equations of motion by relaxing a condition for the generalized covariant derivative with an extra generalized vector. In this modified double field theory (mDFT), we show that the flatness condition of the modified generalized Ricci tensor leads to the NS-NS part of the generalized equations of type IIB supergravity. In particular, the extra vector fields appearing in the generalized equations correspond to the extra generalized vector in mDFT. We also discuss duality symmetries and a modification of the string charge in mDFT.

  17. The increase of compressive strength of natural polymer modified concrete with Moringa oleifera

    Science.gov (United States)

    Susilorini, Rr. M. I. Retno; Santosa, Budi; Rejeki, V. G. Sri; Riangsari, M. F. Devita; Hananta, Yan's. Dianaga

    2017-03-01

    Polymer modified concrete is one of some concrete technology innovations to meet the need of strong and durable concrete. Previous research found that Moringa oleifera can be applied as natural polymer modifiers into mortars. Natural polymer modified mortar using Moringa oleifera is proven to increase their compressive strength significantly. In this resesearch, Moringa oleifera seeds have been grinded and added into concrete mix for natural polymer modified concrete, based on the optimum composition of previous research. The research investigated the increase of compressive strength of polymer modified concrete with Moringa oleifera as natural polymer modifiers. There were 3 compositions of natural polymer modified concrete with Moringa oleifera referred to previous research optimum compositions. Several cylinder of 10 cm x 20 cm specimens were produced and tested for compressive strength at age 7, 14, and, 28 days. The research meets conclusions: (1) Natural polymer modified concrete with Moringa oleifera, with and without skin, has higher compressive strength compared to natural polymer modified mortar with Moringa oleifera and also control specimens; (2) Natural polymer modified concrete with Moringa oleifera without skin is achieved by specimens contains Moringa oleifera that is 0.2% of cement weight; and (3) The compressive strength increase of natural polymer modified concrete with Moringa oleifera without skin is about 168.11-221.29% compared to control specimens

  18. Modified broken rice starch as fat substitute in sausages

    Directory of Open Access Journals (Sweden)

    Valéria Maria Limberger

    2011-09-01

    Full Text Available The demand for low-fat beef products has led the food industry to use fat substitutes such as modified starch. About 14% of broken rice is generated during processing. Nevertheless, this by-product contains high levels of starch; being therefore, great raw material for fat substitution. This study evaluated the applicability of chemically and physically modified broken rice starch as fat substitute in sausages. Extruded and phosphorylated broken rice was used in low-fat sausage formulation. All low-fat sausages presented about 55% reduction in the fat content and around 28% reduction in the total caloric value. Fat replacement with phosphorylated and extruded broken rice starch increased the texture acceptability of low-fat sausages, when compared to low-fat sausages with no modified broken rice. Results suggest that modified broken rice can be used as fat substitute in sausage formulations, yielding lower caloric value products with acceptable sensory characteristics.

  19. MODIFIED ARMIJO RULE ON GRADIENT DESCENT AND CONJUGATE GRADIENT

    Directory of Open Access Journals (Sweden)

    ZURAIDAH FITRIAH

    2017-10-01

    Full Text Available Armijo rule is an inexact line search method to determine step size in some descent method to solve unconstrained local optimization. Modified Armijo was introduced to increase the numerical performance of several descent algorithms that applying this method. The basic difference of Armijo and its modified are in existence of a parameter and estimating the parameter that is updated in every iteration. This article is comparing numerical solution and time of computation of gradient descent and conjugate gradient hybrid Gilbert-Nocedal (CGHGN that applying modified Armijo rule. From program implementation in Matlab 6, it's known that gradient descent was applying modified Armijo more effectively than CGHGN from one side: iteration needed to reach some norm of the gradient  (input by the user. The amount of iteration was representing how long the step size of each algorithm in each iteration. In another side, time of computation has the same conclusion.

  20. Organic waste treatment with organically modified clays

    International Nuclear Information System (INIS)

    Evans, J.C.; Pancoski, S.E.; Alther, G.

    1989-01-01

    The use of organically modified clays in hazardous waste management applications offers a significant new and untapped potential. These clays may be used in the stabilization of organic wastes and organically contaminated soils, for waste water treatment, for oil spill control, for liner systems beneath fuel oil storage tanks, and as a component within liner systems of hazardous waste storage treatment and disposal facilities. Organically modified clays (organophilic clays) may be employed in each of these systems to adsorb organic waste constituents, enhancing the performance of the applications

  1. Development and evaluation of targeting ligands surface modified paclitaxel nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Sohn, Jeong Sun [Division of Undeclared Majors, Chosun University, Gwangju 501-759 (Korea, Republic of); Yoon, Doo-Soo; Sohn, Jun Youn [Department of Bioenvironmental & Chemical Engineering, Chosun College of Science & Technology, Gwangju 501-744 (Korea, Republic of); Park, Jeong-Sook, E-mail: eicosa@cnu.ac.kr [College of Pharmacy and Institute of Drug Research and Development, Chungnam National University, 99 Daehak-ro, Yuseong-gu, Daejeon 34134 (Korea, Republic of); Choi, Jin-Seok, E-mail: c34281@gmail.com [College of Pharmacy and Institute of Drug Research and Development, Chungnam National University, 99 Daehak-ro, Yuseong-gu, Daejeon 34134 (Korea, Republic of)

    2017-03-01

    To overcome the toxicity of excipient or blank nanoparticles for drug delivery nano-system, the surface modified paclitaxel nanocrystals (PTX-NC) have been developed. PTX-NCs were prepared by nano-precipitation method. The surface of PTX-NCs were modified by grafting with apo-transferrin (Tf) or hyaluronic acid (HA). The physical properties of PTX-NCs were evaluated by field emission scanning electron microscope (FE-SEM), zeta-sizer, zeta-potential, differential scanning calorimetry (DSC) and Fourier transform infrared (FT-IR) spectrometry. In vitro drug release study was performed in phosphate buffered saline (PBS) with or without 0.5% (w/v) Tween 80 for 24 h. Cellular uptake was studied at time intervals of 0.5, 1, and 2 h in MCF-7 cells, and cell growth inhibition study was performed for 24 h using MCF-7 cells (cancer cells), and HaCaT cells (normal cells). Three different types of PTX-NCs with a mean size of 236.0 ± 100.6 nm (PTX-NC), 302.0 ± 152.0 nm (Tf-PTX-NC) and 339 ± 180.6 nm (HA-PTX-NC) were successfully prepared. The drug release profiles showed 29.1%/6.9% (PTX (pure)), 40.7%/23.9% (PTX-NC), 50.5%/25.1% (Tf-PTX-NC) and 46.8/24.8% (HA-PTX-NC) in PBS with/without 0.5% (w/v) Tween 80 for 24 h, respectively. As per the results, the drug release of PTX-NCs showed the faster release as compared to that of PTX (pure). Surface modified PTX-NCs exhibited higher values for cell permeability than unmodified PTX-NC in the cellular uptake study. Surface modified PTX-NCs inhibited the cell growth approximately to 60% in MCF-7 cells, however effect of surface modified PTX-NCs on normal cell line was lower than the PTX-NC and PTX (pure). In conclusion, biological macromolecules (Tf or HA) surface modified PTX-NC enhanced the cellular uptake and the cell growth inhibition. - Highlights: • Surface modified PTX-NCs with HA and Tf are successfully prepared by adsorption method. • Enhanced cellular uptake of modified PTX-NCs compared to unmodified PTX-NC • Improved

  2. Observational tests of modified gravity

    International Nuclear Information System (INIS)

    Jain, Bhuvnesh; Zhang Pengjie

    2008-01-01

    Modifications of general relativity provide an alternative explanation to dark energy for the observed acceleration of the Universe. Modified gravity theories have richer observational consequences for large-scale structures than conventional dark energy models, in that different observables are not described by a single growth factor even in the linear regime. We examine the relationships between perturbations in the metric potentials, density and velocity fields, and discuss strategies for measuring them using gravitational lensing, galaxy cluster abundances, galaxy clustering/dynamics, and the integrated Sachs-Wolfe effect. We show how a broad class of gravity theories can be tested by combining these probes. A robust way to interpret observations is by constraining two key functions: the ratio of the two metric potentials, and the ratio of the gravitational 'constant' in the Poisson equation to Newton's constant. We also discuss quasilinear effects that carry signatures of gravity, such as through induced three-point correlations. Clustering of dark energy can mimic features of modified gravity theories and thus confuse the search for distinct signatures of such theories. It can produce pressure perturbations and anisotropic stresses, which break the equality between the two metric potentials even in general relativity. With these two extra degrees of freedom, can a clustered dark energy model mimic modified gravity models in all observational tests? We show with specific examples that observational constraints on both the metric potentials and density perturbations can in principle distinguish modifications of gravity from dark energy models. We compare our result with other recent studies that have slightly different assumptions (and apparently contradictory conclusions).

  3. Effects of preparation process on performance of rubber modified asphalt

    Science.gov (United States)

    Liu, Hanbing; Luo, Guobao; Wang, Xianqiang; Jiao, Yubo

    2015-06-01

    The rational utilization of waste rubber tire is essential for the environmental protection. Utilizing rubber particles to modify asphalt can not only improve asphalt performance, but also help the recycling of waste materials. Considering the effect of different preparation process parameters on the performance of rubber modified asphalt, this paper analyzes the effects of the shear temperature, shear time and shear rate on the performance of rubber modified asphalt, and provided a reference for its preparation.

  4. Preparation and Adsorption Ability of Polysulfone Microcapsules Containing Modified Chitosan Gel

    Institute of Scientific and Technical Information of China (English)

    CHEN Fei; LUO Guangsheng; YANG Weiwei; WANG Yujun

    2005-01-01

    Chemically modified chitosan beads containing polyethyleneimine (PEI) were prepared to improve the metal ion adsorption capacity of the chitosan beads and their mechanical stability and to limit their biodegradability. The modified beads were encapsulated with the polymer material polysulfone by a novel surface coating method named the emulsion phase inversion method. The adsorption properties of the modified beads and the microstructures of the polysulfone coating layer were then analyzed. The experimental results showed that the PEI was successfully linked onto the chitosan beads. The density of the -NH2 groups in the modified beads was significantly increased, while the water content was reduced. The coating layer thickness was about 200 (m. The modified chitosan gel beads had excellent Cu(II) adsorption capacity, with a maximum Cu(II) adsorption capacity 1.34 times higher than that of the unmodified beads. The results show that even with the polysulfone coating the adsorption kinetics of the modified beads is still better than those of the unmodified beads. The modifications improve the mass transfer performance of the chitosan beads as well as the bead stability.

  5. Electrodeposited nanostructured raspberry-like gold-modified electrodes for electrocatalytic applications

    Energy Technology Data Exchange (ETDEWEB)

    Manivannan, Shanmugam; Ramaraj, Ramasamy, E-mail: ramarajr@yahoo.com [Madurai Kamaraj University, Centre for Photoelectrochemistry, School of Chemistry (India)

    2013-10-15

    A facile method for fabrication of raspberry-like Au nanostructures (Au NRBs)-modified electrode by electrodeposition and its applications toward the electrocatalytic oxidation of methanol (MOR) in alkaline medium and oxygen reduction reaction (ORR) in both alkaline and acidic media are demonstrated. The Au NRBs are characterized by UV-Vis absorption spectra, SEM, X-ray diffraction, and electrochemical measurements. The growth of Au NRBs was monitored by recording the in-situ absorption spectral changes during electrodeposition using spectroelectrochemical technique. Here we systematically studied the MOR by varying several reaction parameters such as potential scan rate and methanol concentration. The electrocatalytic poisoning effect due to the MOR products are not observed at the Au NRBs-modified electrode. At the alkaline medium the Au NRBs-modified electrode shows the better catalytic activities toward the MOR and ORR when compared to the poly crystalline gold and bare glassy carbon electrodes. The Au NRBs-modified electrode is a promising and inexpensive electrode material for other electrocatalytic applications.Graphical AbstractRaspberry-like Au nanostructures modified electrode is prepared and used for electrocatalytic applications.

  6. New route for synthesis of electrocatalytic Ni(OH)2 modified ...

    Indian Academy of Sciences (India)

    Administrator

    potential cycling of modified electrode with the above complex in alkali. (2) By thermal ... Chemically modified electrodes; nickel hydroxide; borohydride oxidation; electrocatalysis. 1. ..... Au, Pt and Ag substrates including bimetallic alloys (Bin.

  7. Gclust Server: 168693 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 168693 DME_CG10422_17136610 Cluster Sequences - 442 bam: bag of marbles CG10422-PA ...luster sequences Cluster Sequences Link to related sequences - Sequence length 442 Representative annotation bam: bag of marble

  8. Nanocomposite fibers and film containing polyolefin and surface-modified carbon nanotubes

    Science.gov (United States)

    Chu,Benjamin; Hsiao, Benjamin S.

    2010-01-26

    Methods for modifying carbon nanotubes with organic compounds are disclosed. The modified carbon nanotubes have enhanced compatibility with polyolefins. Nanocomposites of the organo-modified carbon nanotubes and polyolefins can be used to produce both fibers and films having enhanced mechanical and electrical properties, especially the elongation-to-break ratio and the toughness of the fibers and/or films.

  9. Synthesis of 2-Substituted Furo[2,3-b]- and Furo[3,2-c]quinolines via Heterogeneous Palladium-catalyzed Heteroannulation

    International Nuclear Information System (INIS)

    Park, Hee Jung; Yang, Ok-Kyung; Park, Young Chul; Yum, Eul Kgun

    2016-01-01

    As a part of our continuing organometallic studies on diversification of nitrogen-containing biologically active heterocycles, we attempted to synthesize furo[2,3-b]- and furo[3,2-c]quinolines starting from o-halohydroxyquinolines and terminal alkynes with heterogeneous Pd(OAc)2 catalyst, which was supported by nanosized pore carbon ball. 2-substituted furo[2,3-b]quinolines and furo[3,2-c]quinolines were synthesized from the reaction of 3-iodoquinolin-2-ol and 3-iodoquinolin-4-ol, respectively, with diverse alkynes. The heteroannulation reaction proceeds with Sonogashira coupling followed by 5-endo-dig cyclization in good isolated yields under copper and ligand free conditions

  10. Synthesis of 2-Substituted Furo[2,3-b]- and Furo[3,2-c]quinolines via Heterogeneous Palladium-catalyzed Heteroannulation

    Energy Technology Data Exchange (ETDEWEB)

    Park, Hee Jung [Korea Basic Science Institute, Seoul (Korea, Republic of); Yang, Ok-Kyung; Park, Young Chul; Yum, Eul Kgun [Chungnam National University, Daejon (Korea, Republic of)

    2016-06-15

    As a part of our continuing organometallic studies on diversification of nitrogen-containing biologically active heterocycles, we attempted to synthesize furo[2,3-b]- and furo[3,2-c]quinolines starting from o-halohydroxyquinolines and terminal alkynes with heterogeneous Pd(OAc)2 catalyst, which was supported by nanosized pore carbon ball. 2-substituted furo[2,3-b]quinolines and furo[3,2-c]quinolines were synthesized from the reaction of 3-iodoquinolin-2-ol and 3-iodoquinolin-4-ol, respectively, with diverse alkynes. The heteroannulation reaction proceeds with Sonogashira coupling followed by 5-endo-dig cyclization in good isolated yields under copper and ligand free conditions.

  11. Tough and Reinforced Polypropylene/Kaolin Composites using Modified Kaolin

    Science.gov (United States)

    Yao, J. L.; Zhu, H. X.; Qi, Y. B.; Guo, M. J.; Hu, Q.; Gao, L.

    2018-05-01

    Polypropylene (PP)/kaolin composites have been prepared by filling modified kaolin with diethylenetriaminepentaacetic acid (DTPA) into the PP matrix. The surface modification of kaolin particles effectively improves the compatibility between kaolin and PP matrix. It is conducive for uniform dispersion of inorganic particles in the matrix, and enhances the mechanical performance of the composites. Compared with plain kaolin, the mechanical properties of the modified composites exhibit higher tensile strength, bending strength, impact strength and melt index simultaneously. The DTPA modification of kaolin overall enhances the mechanical properties of PP composites. It meets the requirements in various applications, and makes the modified experiment interesting in modern teaching.

  12. Modified mean generation time parameter in the neutron point kinetics equations

    Energy Technology Data Exchange (ETDEWEB)

    Diniz, Rodrigo C.; Gonçalves, Alessandro C.; Rosa, Felipe S.S., E-mail: alessandro@nuclear.ufrj.br, E-mail: frosa@if.ufrj.br [Coordenacao de Pos-Graduacao e Pesquisa de Engenharia (PEN/COPPE/UFRJ), Rio de Janeiro, RJ (Brazil)

    2017-07-01

    This paper proposes an approximation for the modified point kinetics equations proposed by NUNES et. al, 2015, through the adjustment of a kinetic parameter. This approximation consists of analyzing the terms of the modified point kinetics equations in order to identify the least important ones for the solution, resulting in a modification of the mean generation time parameter that incorporates all influences of the additional terms of the modified kinetics. This approximation is applied on the inverse kinetics, to compare the results with the inverse kinetics from the modified kinetics in order to validate the proposed model. (author)

  13. Detection of Genetically Modified Sugarcane by Using Terahertz Spectroscopy and Chemometrics

    Science.gov (United States)

    Liu, J.; Xie, H.; Zha, B.; Ding, W.; Luo, J.; Hu, C.

    2018-03-01

    A methodology is proposed to identify genetically modified sugarcane from non-genetically modified sugarcane by using terahertz spectroscopy and chemometrics techniques, including linear discriminant analysis (LDA), support vector machine-discriminant analysis (SVM-DA), and partial least squares-discriminant analysis (PLS-DA). The classification rate of the above mentioned methods is compared, and different types of preprocessing are considered. According to the experimental results, the best option is PLS-DA, with an identification rate of 98%. The results indicated that THz spectroscopy and chemometrics techniques are a powerful tool to identify genetically modified and non-genetically modified sugarcane.

  14. Modified mean generation time parameter in the neutron point kinetics equations

    International Nuclear Information System (INIS)

    Diniz, Rodrigo C.; Gonçalves, Alessandro C.; Rosa, Felipe S.S.

    2017-01-01

    This paper proposes an approximation for the modified point kinetics equations proposed by NUNES et. al, 2015, through the adjustment of a kinetic parameter. This approximation consists of analyzing the terms of the modified point kinetics equations in order to identify the least important ones for the solution, resulting in a modification of the mean generation time parameter that incorporates all influences of the additional terms of the modified kinetics. This approximation is applied on the inverse kinetics, to compare the results with the inverse kinetics from the modified kinetics in order to validate the proposed model. (author)

  15. 46 CFR 54.01-35 - Corrosion (modifies UG- 25).

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 2 2010-10-01 2010-10-01 false Corrosion (modifies UG- 25). 54.01-35 Section 54.01-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE ENGINEERING PRESSURE VESSELS General Requirements § 54.01-35 Corrosion (modifies UG- 25). (a) Vessels or portions of vessels subject to...

  16. Efficient rate control scheme using modified inter-layer dependency ...

    Indian Academy of Sciences (India)

    The IRC from the prior art is modified to achieve better rate control per layer by recursive updates for mean absolute difference values of eachbasic unit. Proposed modified inter-layer dependency shows improvement in the PSNR for enhancement layers while the updated IRC enforces better IRC for all the layers.

  17. 38 CFR 18.442 - Admissions and recruitment.

    Science.gov (United States)

    2010-07-01

    ..., has been validated as a predictor of success in the education program or activity in question; and (ii... exception. When a recipient is taking remedial action to correct the effects of past discrimination under... paragraph (b)(2) of this section, a recipient may base prediction equations on first year grades, but shall...

  18. Development of Flat Roof Construction with Waterproofing from Modified Self-Compacting Concrete

    Science.gov (United States)

    Bogdanov, R. R.; Ibragimov, R. A.

    2017-11-01

    The given article considers the issues of increase of building flat roof durability by application of the modified self-compacting concrete (SSC). When SSC was modified, a complex modifier was developed and the optimization of the complex modifier composition was carried out using a three-factor experiment. The physico-mechanical properties of the obtained SSC are determined. The microstructure and phase composition of the modified cement stone were studied. On the basis of the studies carried out, namely, X-ray phase analysis and electron microscopy, it was concluded that the reduced content of calcium hydroxide in the samples with a complex modifier is due to the adsorption of calcium hydroxide on highly dispersed particles and the reaction of interaction with metakaolin also contributing to reduction in the content of calcium hydroxide in cement stone. The received data allow one to speak about SSC high operational characteristics. With the mark for the spreading of cone P5, the modified SSC has a class of compressive strength B50, high frost resistance (F600) and water resistance (W16).

  19. Gemini Surfactant-Modified Activated Carbon for Remediation of Hexavalent Chromium from Water

    Directory of Open Access Journals (Sweden)

    Yingying Zhou

    2018-01-01

    Full Text Available Gemini surfactants, with double hydrophilic and hydrophobic groups, offer potentially orders of magnitude greater surface activity compared to similar single unit molecules. A cationic Gemini surfactant (Propyl didodecyldimethylammonium Bromide, PDDDAB and a conventional cationic surfactant (Dodecyltrimethylammonium Bromide, DTAB were used to pre-treat and generate activated carbon. The removal efficiency of the surfactant-modified activated carbon through adsorption of chromium(VI was investigated under controlled laboratory conditions. Fourier-transform infrared spectroscopy (FT-IR and scanning electron microscopy (SEM were used to investigate the surface changes of surfactant-modified activated carbon. The effect of important parameters such as adsorbent dosage, pH, ionic strength and contact time were also investigated. The chromium(VI was adsorbed more significantly on the Gemini surfactant-modified activated carbon than on the conventional surfactant-modified activated carbon. The correlation coefficients show the data best fit the Freundlich model, which confirms the monolayer adsorption of chromium(VI onto Gemini surfactant-modified activated carbon. From this assessment, the surfactant-modified (especially Gemini surfactant-modified activated carbon in this study showed promise for practical applications to treat water pollution.

  20. Preparation and mechanical properties of modified nanocellulose/PLA composites from cassava residue

    Directory of Open Access Journals (Sweden)

    Lijie Huang

    2018-02-01

    Full Text Available Nanocellulose was prepared by a mechanochemical method using cassava residue as a raw material and phosphoric acid as the auxiliary agent. The prepared nanocellulose was hydrophobically modified with stearic acid to improve its dispersibility. This modified nanocellulose was added to polylactic acid (PLA film-forming liquids at concentrations of 0%, 0.5%, 1.0%, 1.5% and 2.0%, and the effect of modified nanocellulose on the mechanical properties of polylactic acid (PLA films were investigated. When at least 0.5% modified nanocellulose is added, more active groups of modified nanocellulose are adsorbed onto the PLA molecular chain. Although the tensile strength of the film is only improved by 13.59%, the flexibility of the film decreases, and the elastic modulus decreases by 28.91%. When 1% modified nanocellulose is added, the modified nanocellulose and PLA are tangled together through molecular chains and they co-crystallize to form a stable network structure. The tensile strength of the nanocomposite films is enhanced by 40.03%, the elastic modulus is enhanced by 55.65%, and the flexibility of the film decreases.

  1. Preparation and mechanical properties of modified nanocellulose/PLA composites from cassava residue

    Science.gov (United States)

    Huang, Lijie; Zhang, Xiaoxiao; Xu, Mingzi; Chen, Jie; Shi, Yinghan; Huang, Chongxing; Wang, Shuangfei; An, Shuxiang; Li, Chunying

    2018-02-01

    Nanocellulose was prepared by a mechanochemical method using cassava residue as a raw material and phosphoric acid as the auxiliary agent. The prepared nanocellulose was hydrophobically modified with stearic acid to improve its dispersibility. This modified nanocellulose was added to polylactic acid (PLA) film-forming liquids at concentrations of 0%, 0.5%, 1.0%, 1.5% and 2.0%, and the effect of modified nanocellulose on the mechanical properties of polylactic acid (PLA) films were investigated. When at least 0.5% modified nanocellulose is added, more active groups of modified nanocellulose are adsorbed onto the PLA molecular chain. Although the tensile strength of the film is only improved by 13.59%, the flexibility of the film decreases, and the elastic modulus decreases by 28.91%. When 1% modified nanocellulose is added, the modified nanocellulose and PLA are tangled together through molecular chains and they co-crystallize to form a stable network structure. The tensile strength of the nanocomposite films is enhanced by 40.03%, the elastic modulus is enhanced by 55.65%, and the flexibility of the film decreases.

  2. Modified gravity in Arnowitt-Deser-Misner formalism

    Science.gov (United States)

    Gao, Changjun

    2010-02-01

    Motivated by Hořava-Lifshitz gravity theory, we propose and investigate two kinds of modified gravity theories, the f(R) kind and the K-essence kind, in the Arnowitt-Deser-Misner (ADM) formalism. The f(R) kind includes one ultraviolet (UV) term and one infrared (IR) term together with the Einstein-Hilbert action. We find that these two terms naturally present the ultraviolet and infrared modifications to the Friedmann equation. The UV and IR modifications can avoid the past Big-Bang singularity and the future Big-Rip singularity, respectively. Furthermore, the IR modification can naturally account for the current acceleration of the Universe. The Lagrangian of K-essence kind modified gravity is made up of the three-dimensional Ricci scalar and an arbitrary function of the extrinsic curvature term. We find the cosmic acceleration can also be naturally interpreted without invoking any kind of dark energy. The static, spherically symmetry and vacuum solutions of both theories are Schwarzschild or Schwarzschild-de Sitter solution. Thus these modified gravity theories are viable for solar system tests.

  3. Modified gravity in Arnowitt-Deser-Misner formalism

    International Nuclear Information System (INIS)

    Gao Changjun

    2010-01-01

    Motivated by Horava-Lifshitz gravity theory, we propose and investigate two kinds of modified gravity theories, the f(R) kind and the K-essence kind, in the Arnowitt-Deser-Misner (ADM) formalism. The f(R) kind includes one ultraviolet (UV) term and one infrared (IR) term together with the Einstein-Hilbert action. We find that these two terms naturally present the ultraviolet and infrared modifications to the Friedmann equation. The UV and IR modifications can avoid the past Big-Bang singularity and the future Big-Rip singularity, respectively. Furthermore, the IR modification can naturally account for the current acceleration of the Universe. The Lagrangian of K-essence kind modified gravity is made up of the three-dimensional Ricci scalar and an arbitrary function of the extrinsic curvature term. We find the cosmic acceleration can also be naturally interpreted without invoking any kind of dark energy. The static, spherically symmetry and vacuum solutions of both theories are Schwarzschild or Schwarzschild-de Sitter solution. Thus these modified gravity theories are viable for solar system tests.

  4. Fabrication and characterization of modified-hydroxyapatite/polyetheretherketone coating materials

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Rui [College of Optoelectronic Engineering, Shenzhen University, Shenzhen 518060 (China); College of Chemistry and Chemical Engineering, Shenzhen University, Shenzhen 518060 (China); Fang, Lin, E-mail: fanglinhit@163.com [College of Chemistry and Chemical Engineering, Shenzhen University, Shenzhen 518060 (China); Luo, Zhongkuan [College of Chemistry and Chemical Engineering, Shenzhen University, Shenzhen 518060 (China); Zheng, Ruisheng [College of Optoelectronic Engineering, Shenzhen University, Shenzhen 518060 (China); Song, Shenhua; Weng, Luqian; Lei, JinPing [Materials Science and Engineering, Shenzhen Graduate School, Harbin Institute of Technology, Shenzhen 518055 (China)

    2014-09-30

    Highlights: • 45 wt%-Hydroxyaptite/polyetheretherketone (HA/PEEK) coating materials modified by silane coupling agent (KH560) on PEEK substrate is successfully fabricated by solution casting method. • Strong bonding between the composite coating and the PEEK substrate is achieved. • HA/PEEK coating materials exhibit better bioactivity. - Abstract: 45 wt%-Hydroxyaptite/polyetheretherketone (HA/PEEK) coating materials modified by silane coupling agent (KH560) on PEEK substrate were successfully fabricated by solution casting method and characterized by Fourier transform infrared spectroscopy (FTIR), X-Ray Diffraction (XRD), scanning electron microscopy (SEM), and tensile testing. The modified HA fillers were obtained to be uniformly distributed in the HA/PEEK coating, which has better properties of tensile strength and fracture toughness than those of the unmodified specimen. A good bonding between the composite coating and the PEEK substrate was achieved by solution casting method, resulting in integral-fracture without falling apart or delaminating during tensile loading. The modified specimens dipped into simulated body fluid (SBF) were characterized by SEM, XRD and FTIR, indicating that the bioactivity of the dipped materials was demonstrated more apparent with extending the dipping time. Therefore, the coating materials may become the substitutes for the hard tissues of the human body in the future, which could realize the balance between the mechanical properties and the bioactivity by modifying the structural design of the coating.

  5. Fabrication and characterization of modified-hydroxyapatite/polyetheretherketone coating materials

    International Nuclear Information System (INIS)

    Ma, Rui; Fang, Lin; Luo, Zhongkuan; Zheng, Ruisheng; Song, Shenhua; Weng, Luqian; Lei, JinPing

    2014-01-01

    Highlights: • 45 wt%-Hydroxyaptite/polyetheretherketone (HA/PEEK) coating materials modified by silane coupling agent (KH560) on PEEK substrate is successfully fabricated by solution casting method. • Strong bonding between the composite coating and the PEEK substrate is achieved. • HA/PEEK coating materials exhibit better bioactivity. - Abstract: 45 wt%-Hydroxyaptite/polyetheretherketone (HA/PEEK) coating materials modified by silane coupling agent (KH560) on PEEK substrate were successfully fabricated by solution casting method and characterized by Fourier transform infrared spectroscopy (FTIR), X-Ray Diffraction (XRD), scanning electron microscopy (SEM), and tensile testing. The modified HA fillers were obtained to be uniformly distributed in the HA/PEEK coating, which has better properties of tensile strength and fracture toughness than those of the unmodified specimen. A good bonding between the composite coating and the PEEK substrate was achieved by solution casting method, resulting in integral-fracture without falling apart or delaminating during tensile loading. The modified specimens dipped into simulated body fluid (SBF) were characterized by SEM, XRD and FTIR, indicating that the bioactivity of the dipped materials was demonstrated more apparent with extending the dipping time. Therefore, the coating materials may become the substitutes for the hard tissues of the human body in the future, which could realize the balance between the mechanical properties and the bioactivity by modifying the structural design of the coating

  6. Biosorption of uranium by chemically modified Rhodotorula glutinis

    International Nuclear Information System (INIS)

    Bai Jing; Yao Huijun; Fan Fangli; Lin Maosheng; Zhang Lina; Ding Huajie; Lei Fuan; Wu Xiaolei; Li, Xiaofei; Guo Junsheng; Qin Zhi

    2010-01-01

    The present paper reports the biosorption of uranium onto chemically modified yeast cells, Rhodotorula glutinis, in order to study the role played by various functional groups in the cell wall. Esterification of the carboxyl groups and methylation of the amino groups present in the cells were carried out by methanol and formaldehyde treatment, respectively. The uranium sorption capacity increased 31% for the methanol-treated biomass and 11% for the formaldehyde-treated biomass at an initial uranium concentration of 140 mg/L. The enhancement of uranium sorption capacity was investigated by Fourier transform infrared (FTIR) spectroscopy analysis, with amino and carboxyl groups were determined to be the important functional groups involved in uranium binding. The biosorption isotherms of uranium onto the raw and chemically modified biomass were also investigated with varying uranium concentrations. Langmuir and Freundlich models were well able to explain the sorption equilibrium data with satisfactory correlation coefficients higher than 0.9. -- Research highlights: → Uranium biosorption on to chemically modified yeast cells → Cells before and after uranium sorption were investigate by FTIR spectroscopy → Amino and carboxyl groups were important functional groups involved in uranium binding → The sorption equilibrium date of raw and chemically modified biomass fitted well with Langmuir and Freundlich models

  7. Biosorption of uranium by chemically modified Rhodotorula glutinis

    Energy Technology Data Exchange (ETDEWEB)

    Bai Jing, E-mail: baijing@impcas.ac.c [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Graduate University of Chinese Academy of Sciences, Beijing 100049 (China); Yao Huijun [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Fan Fangli; Lin Maosheng [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Graduate University of Chinese Academy of Sciences, Beijing 100049 (China); Zhang Lina; Ding Huajie; Lei Fuan; Wu Xiaolei [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Li, Xiaofei [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China); Graduate University of Chinese Academy of Sciences, Beijing 100049 (China); Guo Junsheng; Qin Zhi [Institute of Modern Physics, Chinese Academy of Sciences, Lanzhou 730000 (China)

    2010-11-15

    The present paper reports the biosorption of uranium onto chemically modified yeast cells, Rhodotorula glutinis, in order to study the role played by various functional groups in the cell wall. Esterification of the carboxyl groups and methylation of the amino groups present in the cells were carried out by methanol and formaldehyde treatment, respectively. The uranium sorption capacity increased 31% for the methanol-treated biomass and 11% for the formaldehyde-treated biomass at an initial uranium concentration of 140 mg/L. The enhancement of uranium sorption capacity was investigated by Fourier transform infrared (FTIR) spectroscopy analysis, with amino and carboxyl groups were determined to be the important functional groups involved in uranium binding. The biosorption isotherms of uranium onto the raw and chemically modified biomass were also investigated with varying uranium concentrations. Langmuir and Freundlich models were well able to explain the sorption equilibrium data with satisfactory correlation coefficients higher than 0.9. -- Research highlights: {yields} Uranium biosorption on to chemically modified yeast cells {yields} Cells before and after uranium sorption were investigate by FTIR spectroscopy {yields} Amino and carboxyl groups were important functional groups involved in uranium binding {yields} The sorption equilibrium date of raw and chemically modified biomass fitted well with Langmuir and Freundlich models

  8. Electrochemical investigations of Pu(IV)/Pu(III) redox reaction using graphene modified glassy carbon electrodes and a comparison to the performance of SWCNTs modified glassy carbon electrodes

    International Nuclear Information System (INIS)

    Gupta, Ruma; Gamare, Jayashree; Sharma, Manoj K.; Kamat, J.V.

    2016-01-01

    Highlights: • First report of aqueous electrochemistry of Plutonium on graphene modified electrode. • Graphene is best electrocatalytic material for Pu(IV)/Pu(III) redox couple among the reported modifiers viz. reduced graphene oxide (rGO) and SWCNT’s. • The electrochemical reversibility of Pu(IV)/Pu(III) redox couple improves significantly on graphene modified electrode compared to previously reported rGO & SWCNTs modified electrodes • Donnan interaction between plutonium species and graphene surface offers a possibility for designing a highly sensitive sensor for plutonium • Graphene modified electrode shows higher sensitivity for the determination of plutonium compared to glassy carbon and single walled carbon nanotube modified electrode - Abstract: The work reported in this paper demonstrates for the first time that graphene modified glassy carbon electrode (Gr/GC) show remarkable electrocatalysis towards Pu(IV)/Pu(III) redox reaction and the results were compared with that of single-walled carbon nanotubes modified GC (SWCNTs/GC) and glassy carbon (GC) electrodes. Graphene catalyzes the exchange of current of the Pu(IV)/Pu(III) couple by reducing both the anodic and cathodic overpotentials. The Gr/GC electrode shows higher peak currents (i p ) and smaller peak potential separation (ΔE p ) values than the SWCNTs/GC and GC electrodes. The heterogeneous electron transfer rate constants (k s ), charge transfer coefficients (α) and the diffusion coefficients (D) involved in the electrocatalytic redox reaction were determined. Our observations show that graphene is best electrocatalytic material among both the SWCNTs and GC to study Pu(IV)/Pu(III) redox reaction.

  9. Investigation Antiwear Properties of Lubricants with the Geo-Modifiers of Friction

    Directory of Open Access Journals (Sweden)

    I. Levanov

    2017-09-01

    Full Text Available The article describes the influence of the geo-modifiers of friction on the antiwear properties of lubricants. Geo-modifiers of friction are the fine powders of mineral materials. This work is directed on the investigation the influence of the geo-modifiers of friction in the form of the hard lubricant compositions, which based on a mineral serpentine, on the anti-wear properties of greases and gear oils. This composition is the fine powder serpentine with the addition of components such as chalk, borax, kaolin and talc. We compared the antiwear properties of the greases without geo-modifiers of friction and the antiwear properties of greases containing the geo-modifiers of friction from 0.5 % to 3 %. The Litol-24 and transmission oil TAD-17 was used for testihg. The four-ball machine of friction was used for tests accordance with GOST 9490-75. As geo-modifiers the serpentine was used, the fraction of which has a size from 0.87 microns to 2.2 microns. Such parameter as the wear scar diameter was used for evaluation of the antiwear properties of lubricants. As a result of tests it was established that the antiwear greases properties improved on 26-50 % depending on the concentration of the geo-modifiers of friction based on the pure serpentine.

  10. Modified TPA-supported removable pontic

    Directory of Open Access Journals (Sweden)

    Abhay Kumar Jain

    2014-01-01

    Full Text Available Missing posterior teeth or necessary asymmetric orthodontic extraction may lead to migration, tilting of the adjacent teeth, and supra-eruption of the opposing teeth along with compromised esthetics. The modified TPA supported removable pontic acts as an esthetic pontic during orthodontic space closure.

  11. Modified gravity without dark matter

    NARCIS (Netherlands)

    Sanders, Robert; Papantonopoulos, L

    2007-01-01

    On an empirical level, the most successful alternative to dark matter in bound gravitational systems is the modified Newtonian dynamics, or MOND, proposed by Milgrom. Here I discuss the attempts to formulate MOND as a modification of General Relativity. I begin with a summary of the phenomenological

  12. Validity of the modified Reynolds equation for incompressible active lubrication

    DEFF Research Database (Denmark)

    Cerda Varela, Alejandro Javier; Santos, Ilmar

    2016-01-01

    The modified Reynolds equation for active lubrication has been the cornerstone around which the theoretical investigations regarding actively lubricated bearings have evolved over the years. Introduced originally in 1994, it enables to calculate in a simplified manner the bearing pressure field...... as a function of servovalve controlled pressurized oil injection. This article deals with a preliminary critical review of the simplificatory assumptions that are introduced into the modified Reynolds equation in order to model the phenomena taking place in the interface between the injection nozzle...... and the bearing clearance. The analysis is performed by means of direct comparison of the results of the modified Reynolds equation model versus benchmark CFD calculations, applied to a geometry representative of the system analyzed. The results show that the modified Reynolds equation mathematical simplicity...

  13. Cosmological acceleration. Dark energy or modified gravity?

    International Nuclear Information System (INIS)

    Bludman, S.

    2006-05-01

    We review the evidence for recently accelerating cosmological expansion or ''dark energy'', either a negative pressure constituent in General Relativity (Dark Energy) or modified gravity (Dark Gravity), without any constituent Dark Energy. If constituent Dark Energy does not exist, so that our universe is now dominated by pressure-free matter, Einstein gravity must be modified at low curvature. The vacuum symmetry of any Robertson-Walker universe then characterizes Dark Gravity as low- or high-curvature modifications of Einstein gravity. The dynamics of either kind of ''dark energy'' cannot be derived from the homogeneous expansion history alone, but requires also observing the growth of inhomogeneities. Present and projected observations are all consistent with a small fine tuned cosmological constant, but also allow nearly static Dark Energy or gravity modified at cosmological scales. The growth of cosmological fluctuations will potentially distinguish between static and ''dynamic'' ''dark energy''. But, cosmologically distinguishing the Concordance Model ΛCDM from modified gravity will require a weak lensing shear survey more ambitious than any now projected. Dvali-Gabadadze-Porrati low-curvature modifications of Einstein gravity may also be detected in refined observations in the solar system (Lue and Starkman) or at the intermediate Vainstein scale (Iorio) in isolated galaxy clusters. Dark Energy's epicyclic character, failure to explain the original Cosmic Coincidence (''Why so small now?'') without fine tuning, inaccessibility to laboratory or solar system tests, along with braneworld theories, now motivate future precision solar system, Vainstein-scale and cosmological-scale studies of Dark Gravity. (Orig.)

  14. Cosmological acceleration. Dark energy or modified gravity?

    Energy Technology Data Exchange (ETDEWEB)

    Bludman, S

    2006-05-15

    We review the evidence for recently accelerating cosmological expansion or ''dark energy'', either a negative pressure constituent in General Relativity (Dark Energy) or modified gravity (Dark Gravity), without any constituent Dark Energy. If constituent Dark Energy does not exist, so that our universe is now dominated by pressure-free matter, Einstein gravity must be modified at low curvature. The vacuum symmetry of any Robertson-Walker universe then characterizes Dark Gravity as low- or high-curvature modifications of Einstein gravity. The dynamics of either kind of ''dark energy'' cannot be derived from the homogeneous expansion history alone, but requires also observing the growth of inhomogeneities. Present and projected observations are all consistent with a small fine tuned cosmological constant, but also allow nearly static Dark Energy or gravity modified at cosmological scales. The growth of cosmological fluctuations will potentially distinguish between static and ''dynamic'' ''dark energy''. But, cosmologically distinguishing the Concordance Model {lambda}CDM from modified gravity will require a weak lensing shear survey more ambitious than any now projected. Dvali-Gabadadze-Porrati low-curvature modifications of Einstein gravity may also be detected in refined observations in the solar system (Lue and Starkman) or at the intermediate Vainstein scale (Iorio) in isolated galaxy clusters. Dark Energy's epicyclic character, failure to explain the original Cosmic Coincidence (''Why so small now?'') without fine tuning, inaccessibility to laboratory or solar system tests, along with braneworld theories, now motivate future precision solar system, Vainstein-scale and cosmological-scale studies of Dark Gravity. (Orig.)

  15. Technologically modified exposures to natural radiation. Annex C

    International Nuclear Information System (INIS)

    1982-01-01

    This Annex deals with some examples of technologically modified exposures to natural radiation. Radiation exposures due to coal-fired power plants, geothermal energy production, exploitation of phosphate rock, aircraft travel, and consumer products are discussed. The present state of knowledge does not allow an accurate estimate of the collective effective dose equivalent from technologically modified exposures to natural radiation to be made. This annex has an extensive bibliography with at least 200 references.

  16. Modified perturbation theory for strongly correlated electron systems

    International Nuclear Information System (INIS)

    Takagi, Osamu; Saso, Tetsuro

    1999-01-01

    We propose a modified scheme for calculating the single-particle excitation spectrum of the impurity Anderson model. It is based on the second order perturbation theory, but modifies the self-energy so as to reproduce the correct atomic limit and to fulfill the Friedel sum rule. Therefore, it offers a simple scheme valid over wide range of excitation energy and parameters, and would be useful also for potential application to the lattice problems. (author)

  17. Modified dispersion relations and black hole physics

    International Nuclear Information System (INIS)

    Ling Yi; Li Xiang; Hu Bo

    2006-01-01

    A modified formulation of the energy-momentum relation is proposed in the context of doubly special relativity. We investigate its impact on black hole physics. It turns out that such a modification will give corrections to both the temperature and the entropy of black holes. In particular, this modified dispersion relation also changes the picture of Hawking radiation greatly when the size of black holes approaches the Planck scale. It can prevent black holes from total evaporation, as a result providing a plausible mechanism to treat the remnant of black holes as a candidate for dark matter

  18. Study of melting of molecular crystals by a modified Pople-Karasz model

    Science.gov (United States)

    Yazıcı, Mustafa; Özgan, Şükrü; Keskin, Mustafa

    2005-02-01

    A new modified model that combines the modified models of Chandrasekhar et al. with those of Keskin and Özgan, which are based on the Pople-Karasz theory, is applied to study the thermodynamics of melting and solid-solid transitions of molecular crystals. The thermodynamic properties of the disordered system are evaluated relative to those of the perfectly ordered one using the lowest approximation of the cluster-variation method, which is identical to the mean-field approximation. A good agreement is found between the present modified theory and the available experimental data. For melting transitions the agreement is excellent and much better than with the calculations of the Pople-Karasz theory and its previous modified theories. Approximate agreement is obtained for the solid-solid transitions. However, for these transition the experimental agreement with the present modified theory is still better than previous modified theories except at zero and low pressures.

  19. Modified duval procedure for small-duct chronic pancreatitis without head dominance.

    Science.gov (United States)

    Oida, Takatsugu; Aramaki, Osamu; Kano, Hisao; Mimatsu, Kenji; Kawasaki, Atsushi; Kuboi, Youichi; Fukino, Nobutada; Kida, Kazutoshi; Amano, Sadao

    2011-01-01

    In the case of small-duct chronic pancreatitis, surgery for pain relief is broadly divided into resection and drainage procedures. These procedures should be selected according to the location of dominant lesion, diameter of the pancreatic duct and extent of the disease. The appropriate procedure for the treatment of small-duct chronic pancreatitis, especially small-duct chronic pancreatitis without head dominance, remains controversial. We developed the modified Duval procedure for the treatment of small-duct chronic pancreatitis without head dominance and determined the efficacy of this procedure. We retrospectively studied 14 patients who underwent surgical drainage with or without pancreatic resection for chronic pancreatitis with small pancreatic duct (Puestow procedure group and the modified Duval procedure group. No complications occurred in the modified Duval group. In the modified Puestow procedure group, complete and partial pain relief were observed in 62.5%, and 37.5% of patients respectively. In contrast, complete pain relief was observed in all the patients in the modified Duval procedure group. Our modified Duval procedure is useful and should be considered the appropriate surgical technique for the treatment of small-duct chronic pancreatitis without head dominance.

  20. Some Effects of a Modified Workweek

    Science.gov (United States)

    Wood, Jack M.

    1977-01-01

    Reports on a study that included examination of the degree of change in selected aspects of job satisfaction and organizational performance after the organization adopted a form of modified workweek. (Author/IRT)

  1. Acceptance of genetically modified foods: the relation between technology and evaluation.

    Science.gov (United States)

    Tenbült, Petra; De Vries, Nanne K; van Breukelen, Gerard; Dreezens, Ellen; Martijn, Carolien

    2008-07-01

    This study investigates why consumers accept different genetically modified food products to different extents. The study shows that whether food products are genetically modified or not and whether they are processed or not are the two important features that affect the acceptance of food products and their evaluation (in terms of perceived healthiness, naturalness, necessity and tastiness). The extent to which these evaluation attributes and acceptance of a product are affected by genetic modification or processing depends on whether the product is negatively affected by the other technology: Any technological change to a 'natural' product (when nonprocessed products are genetically modified or when non-genetically modified products are processed) affect evaluation and acceptance stronger than a change to an technologically adapted product (when processed products are also genetically modified or vice versa). Furthermore, evaluation attributes appear to mediate the effects of genetic modification and processing on acceptance.

  2. Laboratory Evaluation of Aging Behaviour of SBS Modified Asphalt

    Directory of Open Access Journals (Sweden)

    Jie Wang

    2017-01-01

    Full Text Available To study the effect of aging SBS modified asphalt on the performance of asphalt pavement, aging at various times and temperatures was conducted with thin film oven, and then tests were made about the penetration, softening point, ductility, viscosity, toughness, and fluorescence microscopy of modified asphalt with different aging levels. The results show that, with the increasing of aging time, the penetration and ductility of modified asphalt decrease while its softening point and viscosity increase, and the variation trend of the toughness and tenacity is related to the aging temperature; the aging dynamic model with viscosity as parameter can well characterize the aging process of modified asphalt; at microlevel, with the decreasing of SBS particle size, the uniformity of particle size is better. Analysis of macroscopic properties, microscopic characteristics, and significance shows that the SBS particle area ratio has a significant correlation with tenacity as the aging temperature changes. When the aging temperature is 163°C, the SBS particle area ratio still has a significant correlation with tenacity as the aging time changes.

  3. Adsorption behavior of bisphenol A on CTAB-modified graphite

    Science.gov (United States)

    Wang, Li-Cong; Ni, Xin-jiong; Cao, Yu-Hua; Cao, Guang-qun

    2018-01-01

    In this work, the adsorption behavior of BPA on CTAB-modified graphite was investigated thoroughly to develop a novel absorbent material. Atomic force microscopy revealed that conical admicelles formed on the surface of graphite. The surface area of graphite decreased significantly from 1.46 to 0.95 m2 g-1, which confirmed the formation of the larger size admicelle instead of the original smaller particle on the surface. CTAB concentration and incubation time affected the progress of admicelle formation on the surface of graphite. Adsolubilization is key in BPA adsorption by CTAB-modified graphite. An extraordinary cation-π electron interaction between CTAB and BPA, revealed by a red-shift in the ultraviolet spectrum, as well as a hydrophobic interaction contribute substantially to BPA adsolubilization. The equilibrium adsorption capacity of the modified graphite for BPA was 125.01 mg g-1. The adsorption kinetic curves of BPA on modified graphite were shown to follow a pseudosecond-order rate. The adsorption process was observed to be both spontaneous and exothermic complied with the Freundlich model.

  4. Generated effect modifiers (GEM’s) in randomized clinical trials

    Science.gov (United States)

    Petkova, Eva; Tarpey, Thaddeus; Su, Zhe; Ogden, R. Todd

    2017-01-01

    In a randomized clinical trial (RCT), it is often of interest not only to estimate the effect of various treatments on the outcome, but also to determine whether any patient characteristic has a different relationship with the outcome, depending on treatment. In regression models for the outcome, if there is a non-zero interaction between treatment and a predictor, that predictor is called an “effect modifier”. Identification of such effect modifiers is crucial as we move towards precision medicine, that is, optimizing individual treatment assignment based on patient measurements assessed when presenting for treatment. In most settings, there will be several baseline predictor variables that could potentially modify the treatment effects. This article proposes optimal methods of constructing a composite variable (defined as a linear combination of pre-treatment patient characteristics) in order to generate an effect modifier in an RCT setting. Several criteria are considered for generating effect modifiers and their performance is studied via simulations. An example from a RCT is provided for illustration. PMID:27465235

  5. A modified discrete element model for sea ice dynamics

    Institute of Scientific and Technical Information of China (English)

    LI Baohui; LI Hai; LIU Yu; WANG Anliang; JI Shunying

    2014-01-01

    Considering the discontinuous characteristics of sea ice on various scales, a modified discrete element mod-el (DEM) for sea ice dynamics is developed based on the granular material rheology. In this modified DEM, a soft sea ice particle element is introduced as a self-adjustive particle size function. Each ice particle can be treated as an assembly of ice floes, with its concentration and thickness changing to variable sizes un-der the conservation of mass. In this model, the contact forces among ice particles are calculated using a viscous-elastic-plastic model, while the maximum shear forces are described with the Mohr-Coulomb fric-tion law. With this modified DEM, the ice flow dynamics is simulated under the drags of wind and current in a channel of various widths. The thicknesses, concentrations and velocities of ice particles are obtained, and then reasonable dynamic process is analyzed. The sea ice dynamic process is also simulated in a vortex wind field. Taking the influence of thermodynamics into account, this modified DEM will be improved in the future work.

  6. Copper nanoparticle modified carbon electrode for determination of dopamine

    International Nuclear Information System (INIS)

    Oztekin, Yasemin; Tok, Mutahire; Bilici, Esra; Mikoliunaite, Lina; Yazicigil, Zafer; Ramanaviciene, Almira; Ramanavicius, Arunas

    2012-01-01

    This paper reports the synthesis and characterization of copper nanoparticles (CuNPs) and application of copper nanoparticle-modified glassy carbon electrode for the electrochemical determination of dopamine. Electrochemical measurements were performed using differently modified glassy carbon (GC) electrodes. Bare, oxidized before modification and copper nanoparticle-modified glassy carbon electrodes (bare-GC, ox-GC and CuNP/GC electrodes, respectively) were characterized by cyclic voltammetry and electrochemical impedance spectroscopy in the presence of redox probes. Atomic force microscopy was used for the visualization of electrode surfaces. The CuNP/GC electrode was found to be suitable for the selective determination of dopamine even in the presence of ascorbic acid, uric acid, and p-acetamidophenol. The observed linear range of CuNP/GC for dopamine was from 0.1 nM to 1.0 μM while the detection limit was estimated to be 50 pM. It was demonstrated that here reported glassy carbon electrode modified by copper nanoparticles is suitable for the determination of dopamine in real samples such as human blood serum.

  7. Genetically modified trees: State and perspectives

    Directory of Open Access Journals (Sweden)

    Nonić Marina

    2012-01-01

    Full Text Available Genetically modified trees are the result of modern plant breeding. Its introduction into the environment for experimental purposes or wider cultivation is defined differently from country to country. Public opinion is divided! Conducted research are part of the activities within the COST Action FP0905 „Biosafety of forest transgenic trees”, which aims to collect information and define the scientific attitude on genetically modified trees as a basis for future European Union (EU policy in this field. The collected information refer to eight countries: four EU member states (Italy, Slovenia, Romania and Bulgaria and four countries in the process of pre-accession (Croatia, Montenegro, Serbia and Bosnia and Herzegovina. A comparative analysis involved the state of forest resources (area of forest land and forest cover, forestry legislation, legislation relating to genetically modified organisms and the general public attitude on this issue. The collected information provide a good basis for understanding this issue in order to define a clear scientific attitude as a recommendation. [Acknowledgements. The authors wish to acknowledge the support of the COST Action FP0905 „Biosafety of forest transgenic trees” for assigned STSM and financial support, also special thanks to the Host institution (Tuscany Region - Directorate General in Florence for kind cooperation. The performed research was partially conducted within the Project „Establishment of Wood Plantations Intended for Afforestation of Serbia“ TP 31041

  8. Modifying Bananas: From Transgenics to Organics?

    Directory of Open Access Journals (Sweden)

    James Dale

    2017-02-01

    Full Text Available Bananas are one of the top ten world food crops. Unlike most other major food crops, bananas are difficult to genetically improve. The challenge is that nearly all banana cultivars and landraces are triploids, with high levels of male and female infertility. There are a number of international conventional breeding programs and many of these are developing new cultivars. However, it is virtually impossible to backcross bananas, thus excluding the possibility of introgressing new traits into a current cultivar. The alternative strategy is to “modify” the cultivar itself. We have been developing the capacity to modify Cavendish bananas and other cultivars for both disease resistance and enhanced fruit quality. Initially, we were using transgenes; genes that were derived from species outside of the Musa or banana genus. However, we have recently incorporated two banana genes (cisgenes into Cavendish; one to enhance the level of pro-vitamin A and the other to increase the resistance to Panama disease. Modified Cavendish with these cisgenes have been employed in a field trial. Almost certainly, the next advance will be to edit the Cavendish genome, to generate the desired traits. As these banana cultivars are essentially sterile, transgene flow and the outcrossing of modified genes into wild Musa species. are highly unlikely and virtually impossible in other triploid cultivars. Therefore, genetic changes in bananas may be compatible with organic farming.

  9. Disease-modifying drugs in Alzheimer's disease

    Directory of Open Access Journals (Sweden)

    Ghezzi L

    2013-12-01

    Full Text Available Laura Ghezzi, Elio Scarpini, Daniela Galimberti Neurology Unit, Department of Pathophysiology and Transplantation, University of Milan, Fondazione Cà Granda, IRCCS Ospedale Maggiore Policlinico, Milan, Italy Abstract: Alzheimer's disease (AD is an age-dependent neurodegenerative disorder and the most common cause of dementia. The early stages of AD are characterized by short-term memory loss. Once the disease progresses, patients experience difficulties in sense of direction, oral communication, calculation, ability to learn, and cognitive thinking. The median duration of the disease is 10 years. The pathology is characterized by deposition of amyloid beta peptide (so-called senile plaques and tau protein in the form of neurofibrillary tangles. Currently, two classes of drugs are licensed by the European Medicines Agency for the treatment of AD, ie, acetylcholinesterase inhibitors for mild to moderate AD, and memantine, an N-methyl-D-aspartate receptor antagonist, for moderate and severe AD. Treatment with acetylcholinesterase inhibitors or memantine aims at slowing progression and controlling symptoms, whereas drugs under development are intended to modify the pathologic steps leading to AD. Herein, we review the clinical features, pharmacologic properties, and cost-effectiveness of the available acetylcholinesterase inhibitors and memantine, and focus on disease-modifying drugs aiming to interfere with the amyloid beta peptide, including vaccination, passive immunization, and tau deposition. Keywords: Alzheimer's disease, acetylcholinesterase inhibitors, memantine, disease-modifying drugs, diagnosis, treatment

  10. Modified Angle's Classification for Primary Dentition.

    Science.gov (United States)

    Chandranee, Kaushik Narendra; Chandranee, Narendra Jayantilal; Nagpal, Devendra; Lamba, Gagandeep; Choudhari, Purva; Hotwani, Kavita

    2017-01-01

    This study aims to propose a modification of Angle's classification for primary dentition and to assess its applicability in children from Central India, Nagpur. Modification in Angle's classification has been proposed for application in primary dentition. Small roman numbers i/ii/iii are used for primary dentition notation to represent Angle's Class I/II/III molar relationships as in permanent dentition, respectively. To assess applicability of modified Angle's classification a cross-sectional preschool 2000 children population from central India; 3-6 years of age residing in Nagpur metropolitan city of Maharashtra state were selected randomly as per the inclusion and exclusion criteria. Majority 93.35% children were found to have bilateral Class i followed by 2.5% bilateral Class ii and 0.2% bilateral half cusp Class iii molar relationships as per the modified Angle's classification for primary dentition. About 3.75% children had various combinations of Class ii relationships and 0.2% children were having Class iii subdivision relationship. Modification of Angle's classification for application in primary dentition has been proposed. A cross-sectional investigation using new classification revealed various 6.25% Class ii and 0.4% Class iii molar relationships cases in preschool children population in a metropolitan city of Nagpur. Application of the modified Angle's classification to other population groups is warranted to validate its routine application in clinical pediatric dentistry.

  11. Neutron stars in screened modified gravity: Chameleon versus dilaton

    Science.gov (United States)

    Brax, Philippe; Davis, Anne-Christine; Jha, Rahul

    2017-04-01

    We consider the scalar field profile around relativistic compact objects such as neutron stars for a range of modified gravity models with screening mechanisms of the chameleon and Damour-Polyakov types. We focus primarily on inverse power law chameleons and the environmentally dependent dilaton as examples of both mechanisms. We discuss the modified Tolman-Oppenheimer-Volkoff equation and then implement a relaxation algorithm to solve for the scalar profiles numerically. We find that chameleons and dilatons behave in a similar manner and that there is a large degeneracy between the modified gravity parameters and the neutron star equation of state. This is exemplified by the modifications to the mass-radius relationship for a variety of model parameters.

  12. Synthesis and magnetic properties of prussian blue modified Fe nanoparticles

    International Nuclear Information System (INIS)

    Arun, T.; Prakash, K.; Justin Joseyphus, R.

    2013-01-01

    Fe nanoparticles are prepared using a unique polyol process and modified with prussian blue (PB) at various concentrations. The presence of PB in the Fe nanoparticles are confirmed from thermal, Fourier transform infrared spectroscopy and electron microscopic analyses. The prussian blue existed on ;the surface of the nanoparticles when the concentration is 200 μM and in excess with 1000 μM. ;Fe nanoparticles are reduced in size using Pt as nucleating agent and modified with the optimum concentration of PB. The saturation magnetization decreases with the concentration of PB whereas the coercivity is influenced by the size of the Fe nanoparticles. The presence of oxide layer in Fe nanoparticles helps in the surface modification with PB. The Fe nanoparticles of particle size 53 nm modified with 200 μM of PB showed a saturation magnetization of 110 emu/g. The magnetic properties suggest that the PB modified Fe nanoparticles are better candidates for detoxification applications. - Highlights: • Fe nanoparticles surface modified with prussian blue (PB) were synthesized. • Optimum PB concentration on size reduced Fe showed better magnetic properties. • Coercivity decreased with increasing concentration of PB. • Fe-PB nanoparticles could be used for detoxification applications

  13. [Hypothetical link between endometriosis and xenobiotics-associated genetically modified food].

    Science.gov (United States)

    Aris, A; Paris, K

    2010-12-01

    Endometriosis is an oestrogen-dependent inflammatory disease affecting 10 % of reproductive-aged women. Often accompanied by chronic pelvic pain and infertility, endometriosis rigorously interferes with women's quality of life. Although the pathophysiology of endometriosis remains unclear, a growing body of evidence points to the implication of environmental toxicants. Over the last decade, an increase in the incidence of endometriosis has been reported and coincides with the introduction of genetically modified foods in our diet. Even though assessments of genetically modified food risk have not indicated any hazard on human health, xenobiotics-associated genetically modified food, such as pesticides residues and xenoproteins, could be harmful in the long-term. The "low-dose hypothesis", accumulation and biotransformation of pesticides-associated genetically modified food and the multiplied toxicity of pesticides-formulation adjuvants support this hypothesis. This review summarizes toxic effects (in vitro and on animal models) of some xenobiotics-associated genetically modified food, such as glyphosate and Cry1Ab protein, and extrapolates on their potential role in the pathophysiology of endometriosis. Their roles as immune toxicants, pro-oxidants, endocrine disruptors and epigenetic modulators are discussed. Copyright © 2010 Elsevier Masson SAS. All rights reserved.

  14. Atomic diffusion in laser surface modified AISI H13 steel

    Science.gov (United States)

    Aqida, S. N.; Brabazon, D.; Naher, S.

    2013-07-01

    This paper presents a laser surface modification process of AISI H13 steel using 0.09 and 0.4 mm of laser spot sizes with an aim to increase surface hardness and investigate elements diffusion in laser modified surface. A Rofin DC-015 diffusion-cooled CO2 slab laser was used to process AISI H13 steel samples. Samples of 10 mm diameter were sectioned to 100 mm length in order to process a predefined circumferential area. The parameters selected for examination were laser peak power, pulse repetition frequency (PRF), and overlap percentage. The hardness properties were tested at 981 mN force. Metallographic study and energy dispersive X-ray spectroscopy (EDXS) were performed to observe presence of elements and their distribution in the sample surface. Maximum hardness achieved in the modified surface was 1017 HV0.1. Change of elements composition in the modified layer region was detected in the laser modified samples. Diffusion possibly occurred for C, Cr, Cu, Ni, and S elements. The potential found for increase in surface hardness represents an important method to sustain tooling life. The EDXS findings signify understanding of processing parameters effect on the modified surface composition.

  15. Investigation of properties of modified oxides structured by nano technology

    International Nuclear Information System (INIS)

    Kurina, I.S.; Serebrennikova, O.V.; Rumyantsev, V.N.; Dvoryashin, A.M.

    2009-01-01

    Research results on the PuO 2 +MgO fuel composition with CeO 2 as a PuO 2 simulator are presented. The water nano technology for the production of oxide ceramic materials, developed in IPPE, was used for fabrication of powders and modified pellets. This technology includes obtaining precipitate, consisting of particles of different sizes as well as of nanoparticles, which is further calcined, pressed and sintered. It results in modifying structure of the sintered pellets. Modified pellets have anomalously high thermal conductivity measured by the axial heat flux method [ru

  16. Environmental impact assessment of genetically modified biocontrol agents

    International Nuclear Information System (INIS)

    Migheli, Q.

    2001-01-01

    This review summarises the theoretical basis of risk analysis, and the political and social implications of introducing new biotechnology products in agricultural environments. The main factors to be considered under the present European regulation in the environmental impact assessment of genetically modified biocontrol agents are briefly discussed. Finally, an alternative risk assessment paradigm is proposed for genetically modified microorganisms, which shall consider the intrinsic properties of each antagonist, rather than the method used for generating it [it

  17. Turing patterns in a modified Lotka-Volterra model

    International Nuclear Information System (INIS)

    McGehee, Edward A.; Peacock-Lopez, Enrique

    2005-01-01

    In this Letter we consider a modified Lotka-Volterra model widely known as the Bazykin model, which is the MacArthur-Rosenzweig (MR) model that includes a prey-dependent response function and is modified with the inclusion of intraspecies interactions. We show that a quadratic intra-prey interaction term, which is the most realistic nonlinearity, yields sufficient conditions for Turing patterns. For the Bazykin model we find the Turing region in parameter space and Turing patterns in one dimension

  18. Modified holographic dark energy in DGP brane world

    International Nuclear Information System (INIS)

    Liu, Dao-Jun; Wang, Hua; Yang, Bin

    2010-01-01

    In this Letter, the cosmological dynamics of a modified holographic dark energy which is derived from the UV/IR duality by considering the black hole mass in higher dimensions as UV cutoff, is investigated in Dvali-Gabadadze-Porrati (DGP) brane world model. We choose Hubble horizon and future event horizon as IR cutoff respectively. And the two branches of the DGP model are both taken into account. When Hubble horizon is considered as IR cutoff, the modified holographic dark energy (HDE) behaves like an effect dark energy that modification of gravity in pure DGP brane world model acts and it can drive the expansion of the universe speed up at late time in ε=-1 branch which in pure DGP model cannot undergo an accelerating phase. When future event horizon acts as IR cutoff, the equation of state parameter of the modified HDE can cross the phantom divide.

  19. Synthesis of 3'-, or 5'-, or internal methacrylamido-modified oligonucleotides

    Science.gov (United States)

    Golova, Julia B.; Chernov, Boris K.

    2010-04-27

    New modifiers were synthesized for incorporation of a methacrylic function in 3'-, 5'- and internal positions of oligonucleotides during solid phase synthesis. A modifier was used for synthesis of 5'-methacrylated oligonucleotides for preparation of microarrays by a co-polymerization method.

  20. Sonocatalytic Degradation of Antibiotics Tetracycline by Mn-Modified Diatomite

    Directory of Open Access Journals (Sweden)

    Yiping Guo

    2017-01-01

    Full Text Available Mn-modified diatomite was prepared by wet impregnation and subsequent calcinations processes. It was used as catalyst for sonocatalytic degradation of antibiotics tetracycline. Characterizations by scanning electron microscopy and X-ray diffraction pattern showed that the morphology and crystal structure of the modified diatomite were similar to these of raw diatomite. Despite containing very limited amount of Mn oxides, the Mn-modified diatomite showed much higher sonocatalytic activity than the raw diatomite. The increases in both MnSO4 concentration of the wet impregnation solution and the catalyst dosage could enhance the degradation of antibiotics tetracycline significantly. Kapp values for ultrasonication, catalyst adsorption, and both processes combined (0.10 mol/L MnSO4-modified diatomite were 1.22 × 10−4, 0.00193, and 0.00453 min−1, respectively, while the corresponding values of R2 were 0.956, 0.986, and 0.953, respectively. These results demonstrated the significant synergetic effect by combining ultrasonication and catalyst adsorption processes. The presence of isopropanol, KBr, and NaN3 quenched a series of reactive oxygen species sharply, indicating the dominant role of reactive oxygen species in the sonocatalytic process. In contrast, the addition of Fe(II enhanced the degradation due to the generation of more OH∙ radicals in the concurrent Fenton reaction. All the results indicated that Mn-modified diatomite had the great potential for water treatment by sonocatalytic oxidation.

  1. Protective properties of radiation-modified polyethylene

    Energy Technology Data Exchange (ETDEWEB)

    Surnina, N.N.; Saltykova, L.A.; Strochkova, E.M.; Tatarenko, O.F.

    1986-09-01

    A study was made of the mass transfer of corrosive liquids and gases through polyethylene films modified by radiation surface grafting. Studies were performed on an unstabilized type A film with graft adhesion-active layer based on polymethacrylic acid. The protective properties of the polymer coating in corrosive fluids with low vapor tension were estimated by impedance measurements. Steel specimens with a protective coating of radiation-modified polyethylene film were exposed to 10% sulfuric acid at room temperature. The results indicated that the acid did not penetrate through to the metal surface. The films retain their protective properties and protect the metal from the acid. Radiation modification significantly improves the adhesion of polyethylene to metals without reducing physical and mechanical properties of the polymers. 50 references, 1 figure.

  2. An investigation for structure transformation in electric pulse modified liquid aluminum

    Energy Technology Data Exchange (ETDEWEB)

    Qi Jingang, E-mail: Qijingang1974@sina.co [School of Material Science and Engineering, Liaoning University of Technology, Jinzhou 121001 (China); Wang Jianzhong; He Lijia; Zhao Zuofu; Du Huiling [School of Material Science and Engineering, Liaoning University of Technology, Jinzhou 121001 (China)

    2011-02-15

    The electric pulse (EP) modification of liquid metal is a novel method for grain refinement. In this work, the structure tests of EP-modified liquid aluminum were conducted and investigated using high-temperature X-ray diffractometer by virtue of the outstanding structural heredity of EP-modified liquid aluminum. The results show that the EP-modified liquid structure tends to be slack and unordered with increasing temperature similar to that of the unmodified. Nevertheless, the quantitative characterization denoted by the liquid structural parameters exhibits its discrepancy. At the modifying temperature of 750 {sup o}C, the order of degree of EP-modified liquid aluminum is remarkably strengthened and the value of average atomic number per cluster changes from 119 (no EP) up to 174 (EP) by an increase of 46%. These tests experimentally testified Wang's electric pulse modification (EPM) model that was built only by phenomenology, and hereby the mechanism of grain refinement resulting from EPM is further elucidated.

  3. Modified performance test of vented lead acid batteries for stationary applications

    International Nuclear Information System (INIS)

    Uhlir, K.W.; Fletcher, R.J.

    1995-01-01

    The concept of a modified performance test for vented lead acid batteries in stationary applications has been developed by the IEEE Battery Working Group. The modified performance test is defined as a test in the ''as found'' condition of the battery capacity and its ability to provide a high rate, short duration load (usually the highest rate of the duty cycle) that will confirm the battery's ability to meet the critical period of the load duty cycle, in addition to determining its percentage of rated capacity. This paper will begin by reviewing performance and service test requirements and concerns associated with both types of tests. The paper will then discuss the rationale for developing a modified performance test along with the benefits that can be derived from performing a modified performance test in lieu of a capacity test and/or a service test. The paper will conclude with an example on how to apply a modified performance test and test acceptance criteria

  4. The development of polyurethane modified bitumen emulsions for cold mix applications

    OpenAIRE

    Carrera Páez, Virginia; Cuadri Vega, Antonio Abad; García Morales, Moisés; Partal López, Pedro

    2015-01-01

    Bitumen emulsions stand for an alternative paving practice to the traditional hot-mix asphalts. In addition, modified bitumen emulsions show a better performance than unmodified ones. This work studies the feasibility of obtaining polyurethane modified bitumen emulsions, in which an isocyanate-functionalized polyol constitutes the bitumen modifier (in varying concentration from 1 to 4 wt.%). Storage stability and high in-service performance are evaluated by means of evolution of droplet size ...

  5. A modifier of Huntington's disease onset at the MLH1 locus.

    Science.gov (United States)

    Lee, Jong-Min; Chao, Michael J; Harold, Denise; Abu Elneel, Kawther; Gillis, Tammy; Holmans, Peter; Jones, Lesley; Orth, Michael; Myers, Richard H; Kwak, Seung; Wheeler, Vanessa C; MacDonald, Marcy E; Gusella, James F

    2017-10-01

    Huntington's disease (HD) is a dominantly inherited neurodegenerative disease caused by an expanded CAG repeat in HTT. Many clinical characteristics of HD such as age at motor onset are determined largely by the size of HTT CAG repeat. However, emerging evidence strongly supports a role for other genetic factors in modifying the disease pathogenesis driven by mutant huntingtin. A recent genome-wide association analysis to discover genetic modifiers of HD onset age provided initial evidence for modifier loci on chromosomes 8 and 15 and suggestive evidence for a locus on chromosome 3. Here, genotyping of candidate single nucleotide polymorphisms in a cohort of 3,314 additional HD subjects yields independent confirmation of the former two loci and moves the third to genome-wide significance at MLH1, a locus whose mouse orthologue modifies CAG length-dependent phenotypes in a Htt-knock-in mouse model of HD. Both quantitative and dichotomous association analyses implicate a functional variant on ∼32% of chromosomes with the beneficial modifier effect that delays HD motor onset by 0.7 years/allele. Genomic DNA capture and sequencing of a modifier haplotype localize the functional variation to a 78 kb region spanning the 3'end of MLH1 and the 5'end of the neighboring LRRFIP2, and marked by an isoleucine-valine missense variant in MLH1. Analysis of expression Quantitative Trait Loci (eQTLs) provides modest support for altered regulation of MLH1 and LRRFIP2, raising the possibility that the modifier affects regulation of both genes. Finally, polygenic modification score and heritability analyses suggest the existence of additional genetic modifiers, supporting expanded, comprehensive genetic analysis of larger HD datasets. © The Author 2017. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  6. Consumer reaction to information on the labels of genetically modified food

    Science.gov (United States)

    Sebastian-Ponce, Miren Itxaso; Sanz-Valero, Javier; Wanden-Berghe, Carmina

    2014-01-01

    OBJECTIVE To analyze consumer opinion on genetically modified foods and the information included on the label. METHODS A systematic review of the scientific literature on genetically modified food labeling was conducted consulting bibliographic databases (Medline – via PubMed –, EMBASE, ISI-Web of knowledge, Cochrane Library Plus, FSTA, LILACS, CINAHL and AGRICOLA) using the descriptors “organisms, genetically modified” and “food labeling”. The search covered the first available date, up to June 2012, selecting relevant articles written in English, Portuguese or Spanish. RESULTS Forty articles were selected after applying the inclusion and exclusion criteria. All of them should have conducted a population-based intervention focused on consumer awareness of genetically modified foods and their need or not, to include this on the label. The consumers expressed a preference for non-genetically modified products, and added that they were prepared to pay more for this but, ultimately, the product bought was that with the best price, in a market which welcomes new technologies. In 18 of the articles, the population was in favor of obligatory labelling, and in six, in favor of this being voluntary; seven studies showed the consumer knew little about genetically modified food, and in three, the population underestimated the quantity they consumed. Price was an influencing factor in all cases. CONCLUSIONS Label should be homogeneous and clarify the degree of tolerance of genetically modified products in humans, in comparison with those non-genetically modified. Label should also present the content or not of genetically modified products and how these commodities are produced and should be accompanied by the certifying entity and contact information. Consumers express their preference for non-genetically modifiedproducts and they even notice that they are willing to pay more for it, but eventually they buy the item with the best price, in a market that welcomes

  7. Effects of Using Modified Items to Test Students with Persistent Academic Difficulties

    Science.gov (United States)

    Elliott, Stephen N.; Kettler, Ryan J.; Beddow, Peter A.; Kurz, Alexander; Compton, Elizabeth; McGrath, Dawn; Bruen, Charles; Hinton, Kent; Palmer, Porter; Rodriguez, Michael C.; Bolt, Daniel; Roach, Andrew T.

    2010-01-01

    This study investigated the effects of using modified items in achievement tests to enhance accessibility. An experiment determined whether tests composed of modified items would reduce the performance gap between students eligible for an alternate assessment based on modified achievement standards (AA-MAS) and students not eligible, and the…

  8. Stability of Modified K-dV soliton in plasma with negative ion

    International Nuclear Information System (INIS)

    Matsukawa, Michiaki; Watanabe, Shinsuke

    1988-01-01

    The K-P and Modified K-P equations for ion acoustic wave are derived from the fluid equations for plasma with negative ion. At the critical density of the negative ion where the nonlinearity of the K-P equation vanishes, the ion acoustic soliton is described by the Modified K-P equation. The stability of Modified K-dV soliton against bending are investigated by using the Modified K-P equation. It is found that the soliton is stable, independent of the sign of amplitude. (author)

  9. Correction of Cardy–Verlinde formula for Fermions and Bosons with modified dispersion relation

    Energy Technology Data Exchange (ETDEWEB)

    Sadatian, S. Davood, E-mail: sd-sadatian@um.ac.ir; Dareyni, H.

    2017-05-15

    Cardy–Verlinde formula links the entropy of conformal symmetry field to the total energy and its Casimir energy in a D-dimensional space. To correct black hole thermodynamics, modified dispersion relation can be used which is proposed as a general feature of quantum gravity approaches. In this paper, the thermodynamics of Schwarzschild four-dimensional black hole is corrected using the modified dispersion relation for Fermions and Bosons. Finally, using modified thermodynamics of Schwarzschild four-dimensional black hole, generalization for Cardy–Verlinde formula is obtained. - Highlights: • The modified Cardy–Verlinde formula obtained using MDR for Fermions and Bosons. • The modified entropy of the black hole used to correct the Cardy–Verlinde formula. • The modified entropy of the CFT has been obtained.

  10. AquAdvantage Salmon Genetically modified organism

    OpenAIRE

    Núñez Saurí, Ester; Universitat Autònoma de Barcelona. Facultat de Veterinària

    2014-01-01

    Póster AquAdvantage Salmon is a genetically modified organism developed by AquBounty Technologies. The objective of this transgenic organism is to increase the growth rate to obtain the same of conventional salmon faster.

  11. Phosphate Removal using Modified Bayoxide®E33 Adsorption Media

    Science.gov (United States)

    The adsorption of phosphate onto modified Bayoxide® E33 (E33) and underlying mechanisms were comparatively investigated by batch kinetics, sorption isotherms, rapid small scale column tests, and material characterization. Synthesis of modified E33 was conducted by the addition of...

  12. Multiple organ histopathological changes in broiler chickens fed on genetically modified organism.

    Science.gov (United States)

    Cîrnatu, Daniela; Jompan, A; Sin, Anca Ileana; Zugravu, Cornelia Aurelia

    2011-01-01

    Diet can influence the structural characteristics of internal organs. An experiment involving 130 meat broilers was conducted during 42 days (life term for a meat broiler) to study the effect of feed with protein from genetically modified soy. The 1-day-old birds were randomly allocated to five study groups, fed with soy, sunflower, wheat, fish flour, PC starter. In the diet of each group, an amount of protein from soy was replaced with genetically modified soy (I - 0%, II - 25%, III - 50%, IV - 75%, V - 100% protein from genetically modified soy). The level of protein in soy, either modified, or non-modified, was the same. Organs and carcass weights were measured at about 42 days of age of the birds and histopathology exams were performed during May-June 2009. No statistically significant differences were observed in mortality, growth performance variables or carcass and organ yields between broilers consuming diets produced with genetically modified soybean fractions and those consuming diets produced with near-isoline control soybean fractions. Inflammatory and degenerative liver lesions, muscle hypertrophy, hemorrhagic necrosis of bursa, kidney focal tubular necrosis, necrosis and superficial ulceration of bowel and pancreatic dystrophies were found in tissues from broilers fed on protein from genetically modified soy. Different types of lesions found in our study might be due to other causes (parasites, viral) superimposed but their presence exclusively in groups fed with modified soy raises some serious questions about the consequences of use of this type of feed.

  13. Doxycycline-loaded nanotube-modified adhesives inhibit MMP in a dose-dependent fashion.

    Science.gov (United States)

    Palasuk, Jadesada; Windsor, L Jack; Platt, Jeffrey A; Lvov, Yuri; Geraldeli, Saulo; Bottino, Marco C

    2018-04-01

    This article evaluated the drug loading, release kinetics, and matrix metalloproteinase (MMP) inhibition of doxycycline (DOX) released from DOX-loaded nanotube-modified adhesives. DOX was chosen as the model drug, since it is the only MMP inhibitor approved by the U.S. Food and Drug Administration. Drug loading into the nanotubes was accomplished using DOX solution at distinct concentrations. Increased concentrations of DOX significantly improved the amount of loaded DOX. The modified adhesives were fabricated by incorporating DOX-loaded nanotubes into the adhesive resin of a commercial product. The degree of conversion (DC), Knoop microhardness, DOX release kinetics, antimicrobial, cytocompatibility, and anti-MMP activity of the modified adhesives were investigated. Incorporation of DOX-loaded nanotubes did not compromise DC, Knoop microhardness, or cell compatibility. Higher concentrations of DOX led to an increase in DOX release in a concentration-dependent manner from the modified adhesives. DOX released from the modified adhesives did not inhibit the growth of caries-related bacteria, but more importantly, it did inhibit MMP-1 activity. The loading of DOX into the nanotube-modified adhesives did not compromise the physicochemical properties of the adhesives and the released levels of DOX were able to inhibit MMP activity without cytotoxicity. Doxycycline released from the nanotube-modified adhesives inhibited MMP activity in a concentration-dependent fashion. Therefore, the proposed nanotube-modified adhesive may hold clinical potential as a strategy to preserve resin/dentin bond stability.

  14. ENU mutagenesis to generate genetically modified rat models.

    Science.gov (United States)

    van Boxtel, Ruben; Gould, Michael N; Cuppen, Edwin; Smits, Bart M G

    2010-01-01

    The rat is one of the most preferred model organisms in biomedical research and has been extremely useful for linking physiology and pathology to the genome. However, approaches to genetically modify specific genes in the rat germ line remain relatively scarce. To date, the most efficient approach for generating genetically modified rats has been the target-selected N-ethyl-N-nitrosourea (ENU) mutagenesis-based technology. Here, we describe the detailed protocols for ENU mutagenesis and mutant retrieval in the rat model organism.

  15. Method for modifying trigger level for adsorber regeneration

    Science.gov (United States)

    Ruth, Michael J.; Cunningham, Michael J.

    2010-05-25

    A method for modifying a NO.sub.x adsorber regeneration triggering variable. Engine operating conditions are monitored until the regeneration triggering variable is met. The adsorber is regenerated and the adsorbtion efficiency of the adsorber is subsequently determined. The regeneration triggering variable is modified to correspond with the decline in adsorber efficiency. The adsorber efficiency may be determined using an empirically predetermined set of values or by using a pair of oxygen sensors to determine the oxygen response delay across the sensors.

  16. Pool boiling of nanoparticle-modified surface with interlaced wettability

    KAUST Repository

    Hsu, Chin-Chi; Su, Tsung-Wen; Chen, Ping-Hei

    2012-01-01

    This study investigated the pool boiling heat transfer under heating surfaces with various interlaced wettability. Nano-silica particles were used as the coating element to vary the interlaced wettability of the surface. The experimental results revealed that when the wettability of a surface is uniform, the critical heat flux increases with the more wettable surface; however, when the wettability of a surface is modified interlacedly, regardless of whether the modified region becomes more hydrophilic or hydrophobic, the critical heat flux is consistently higher than that of the isotropic surface. In addition, this study observed that critical heat flux was higher when the contact angle difference between the plain surface and the modified region was smaller. © 2012 Hsu et al.

  17. Automatic Circuit Design and Optimization Using Modified PSO Algorithm

    Directory of Open Access Journals (Sweden)

    Subhash Patel

    2016-04-01

    Full Text Available In this work, we have proposed modified PSO algorithm based optimizer for automatic circuit design. The performance of the modified PSO algorithm is compared with two other evolutionary algorithms namely ABC algorithm and standard PSO algorithm by designing two stage CMOS operational amplifier and bulk driven OTA in 130nm technology. The results show the robustness of the proposed algorithm. With modified PSO algorithm, the average design error for two stage op-amp is only 0.054% in contrast to 3.04% for standard PSO algorithm and 5.45% for ABC algorithm. For bulk driven OTA, average design error is 1.32% with MPSO compared to 4.70% with ABC algorithm and 5.63% with standard PSO algorithm.

  18. Chemically-modified cellulose paper as a microstructured catalytic reactor.

    Science.gov (United States)

    Koga, Hirotaka; Kitaoka, Takuya; Isogai, Akira

    2015-01-15

    We discuss the successful use of chemically-modified cellulose paper as a microstructured catalytic reactor for the production of useful chemicals. The chemical modification of cellulose paper was achieved using a silane-coupling technique. Amine-modified paper was directly used as a base catalyst for the Knoevenagel condensation reaction. Methacrylate-modified paper was used for the immobilization of lipase and then in nonaqueous transesterification processes. These catalytic paper materials offer high reaction efficiencies and have excellent practical properties. We suggest that the paper-specific interconnected microstructure with pulp fiber networks provides fast mixing of the reactants and efficient transport of the reactants to the catalytically-active sites. This concept is expected to be a promising route to green and sustainable chemistry.

  19. Chemically-Modified Cellulose Paper as a Microstructured Catalytic Reactor

    Directory of Open Access Journals (Sweden)

    Hirotaka Koga

    2015-01-01

    Full Text Available We discuss the successful use of chemically-modified cellulose paper as a microstructured catalytic reactor for the production of useful chemicals. The chemical modification of cellulose paper was achieved using a silane-coupling technique. Amine-modified paper was directly used as a base catalyst for the Knoevenagel condensation reaction. Methacrylate-modified paper was used for the immobilization of lipase and then in nonaqueous transesterification processes. These catalytic paper materials offer high reaction efficiencies and have excellent practical properties. We suggest that the paper-specific interconnected microstructure with pulp fiber networks provides fast mixing of the reactants and efficient transport of the reactants to the catalytically-active sites. This concept is expected to be a promising route to green and sustainable chemistry.

  20. Halo scale predictions of symmetron modified gravity

    Energy Technology Data Exchange (ETDEWEB)

    Clampitt, Joseph; Jain, Bhuvnesh; Khoury, Justin, E-mail: clampitt@sas.upenn.edu, E-mail: bjain@physics.upenn.edu, E-mail: jkhoury@sas.upenn.edu [Center for Particle Cosmology and Department of Physics and Astronomy, University of Pennsylvania, 209 South 33rd St., Philadelphia, PA 19104 (United States)

    2012-01-01

    We offer predictions of symmetron modified gravity in the neighborhood of realistic dark matter halos. The predictions for the fifth force are obtained by solving the nonlinear symmetron equation of motion in the spherical NFW approximation. In addition, we compare the three major known screening mechanisms: Vainshtein, Chameleon, and Symmetron around such dark matter halos, emphasizing the significant differences between them and highlighting observational tests which exploit these differences. Finally, we demonstrate the host halo environmental screening effect (''blanket screening'') on smaller satellite halos by solving for the modified forces around a density profile which is the sum of satellite and approximate host components.

  1. HYBRIDIZATION STUDY BETWEEN GENETICALLY MODIFIED BRASSICA NAPUS AND NON-GENETICALLY MODIFIED B. NAPUS AND B. RAPA

    Science.gov (United States)

    Gene exchange between cultivated crops and wild species has gained significance in recent years because of concerns regarding the potential for gene flow between genetically modified (GM) crops and their domesticated and wild relatives. As part of our ecological effects of gene ...

  2. Investigation of the antibiofilm capacity of peptide-modified stainless steel.

    Science.gov (United States)

    Cao, Pan; Li, Wen-Wu; Morris, Andrew R; Horrocks, Paul D; Yuan, Cheng-Qing; Yang, Ying

    2018-03-01

    Biofilm formation on surfaces is an important research topic in ship tribology and medical implants. In this study, dopamine and two types of synthetic peptides were designed and attached to 304 stainless steel surfaces, aiming to inhibit the formation of biofilms. A combinatory surface modification procedure was applied in which dopamine was used as a coupling agent, allowing a strong binding ability with the two peptides. X-ray photoelectron spectroscopy (XPS), elemental analysis, contact angle measurement and surface roughness test were used to evaluate the efficiency of the peptide modification. An antibiofilm assay against Staphylococcus aureus was conducted to validate the antibiofilm capacity of the peptide-modified stainless steel samples. XPS analysis confirmed that the optimal dopamine concentration was 40 µg ml -1 in the coupling reaction. Element analysis showed that dopamine and the peptides had bound to the steel surfaces. The robustness assay of the modified surface demonstrated that most peptide molecules had bound on the surface of the stainless steel firmly. The contact angle of the modified surfaces was significantly changed. Modified steel samples exhibited improved antibiofilm properties in comparison to untreated and dopamine-only counterpart, with the peptide 1 modification displaying the best antibiofilm effect. The modified surfaces showed antibacterial capacity. The antibiofilm capacity of the modified surfaces was also surface topography sensitive. The steel sample surfaces polished with 600# sandpaper exhibited stronger antibiofilm capacity than those polished with other types of sandpapers after peptide modification. These findings present valuable information for future antifouling material research.

  3. Bifunctional avidin with covalently modifiable ligand binding site.

    Directory of Open Access Journals (Sweden)

    Jenni Leppiniemi

    Full Text Available The extensive use of avidin and streptavidin in life sciences originates from the extraordinary tight biotin-binding affinity of these tetrameric proteins. Numerous studies have been performed to modify the biotin-binding affinity of (streptavidin to improve the existing applications. Even so, (streptavidin greatly favours its natural ligand, biotin. Here we engineered the biotin-binding pocket of avidin with a single point mutation S16C and thus introduced a chemically active thiol group, which could be covalently coupled with thiol-reactive molecules. This approach was applied to the previously reported bivalent dual chain avidin by modifying one binding site while preserving the other one intact. Maleimide was then coupled to the modified binding site resulting in a decrease in biotin affinity. Furthermore, we showed that this thiol could be covalently coupled to other maleimide derivatives, for instance fluorescent labels, allowing intratetrameric FRET. The bifunctional avidins described here provide improved and novel tools for applications such as the biofunctionalization of surfaces.

  4. Uranium (Vi) sorption onto zirconium diphosphate chemically modified

    International Nuclear Information System (INIS)

    Garcia G, N.; Ordonez R, E.

    2010-10-01

    This work deals with the uranium (Vi) speciation after sorption onto zirconium diphosphate (ZrP 2 O 7 ) surface, hydrated and in a surface modified with organic acids. Oxalic and citric acids were chosen to modify the ZrP 2 O 7 surface because they have poly carboxylic groups and they mimic the organic matter in nature. Thus the interest of this work is to evaluate the uranium (Vi) sorption edge at different s ph values in natural and modified surfaces. The luminescence technique (fluorescence and phosphorescence, respectively) was used for the quantification and speciation of uranyl sorbed at the zirconium diphosphate interface. The fluorescence experiment, showed that adsorption of uranyl on surface of zirconium diphosphate tends to 100%. The speciation shows that there are different complexes in surface which were formed between zirconium diphosphate and uranyl, since it is produced a displacement of wavelength in fluorescence spectra of each system. (Author)

  5. Prognostic Value of Bismuth Typing and Modified T-stage in Hilar Cholangiocarcinoma

    Directory of Open Access Journals (Sweden)

    Shengen Yi

    2015-01-01

    Conclusion: The majority of our patients with HCC were characterized as Subtype IV in Bismuth typing and Stage T3 in modified T-stage. Both Bismuth typing and modified T-stage showed prognostic value in HCC. Compared with Bismuth typing, modified T-stage is a better indicator of the resectability of HCC.

  6. Pre-Diabetes Non-Modifiable Risk Factors

    Science.gov (United States)

    ... Artery Disease Venous Thromboembolism Aortic Aneurysm More Pre-diabetes Non-modifiable Risk Factors Updated:Nov 9,2015 ... This content was last reviewed August 2015. Pre-diabetes • Introduction • About Pre-diabetes • What's the Problem? Intro ...

  7. Nano-engineered polyurethane resin-modified concrete.

    Science.gov (United States)

    2014-04-01

    The goal of the proposed work is to investigate the application of nano-engineered polyurethane (NEPU) emulsions for latex modified : concrete (LMC). NEPU emulsions are non-toxic, environment friendly, durable over a wide temperature range, provide b...

  8. preconditioning the modified conjugate gradient method

    African Journals Online (AJOL)

    Admin

    steepest descent method, the number of matrix-vector products per iteration .... modified CGM algorithm is used for large class of problems that is not ..... New Trends in the Mathematical and Computer Sciences with Applications to Real World.

  9. A novel fractional technique for the modified point kinetics equations

    Directory of Open Access Journals (Sweden)

    Ahmed E. Aboanber

    2016-10-01

    Full Text Available A fractional model for the modified point kinetics equations is derived and analyzed. An analytical method is used to solve the fractional model for the modified point kinetics equations. This methodical technique is based on the representation of the neutron density as a power series of the relaxation time as a small parameter. The validity of the fractional model is tested for different cases of step, ramp and sinusoidal reactivity. The results show that the fractional model for the modified point kinetics equations is the best representation of neutron density for subcritical and supercritical reactors.

  10. Environmentally responsive surface-modified silica nanoparticles for enhanced oil recovery

    International Nuclear Information System (INIS)

    Behzadi, Abed; Mohammadi, Aliasghar

    2016-01-01

    Environmentally responsive surface-modified nanoparticles are colloidal nanoparticles coated with, at least, two physicochemically distinct surface groups. Recent advances in the synthesis and production of nanoparticles have enabled the production of environmentally responsive surface-modified nanoparticles with both hydrophilic and hydrophobic surface groups. These nanoparticles act like colloidal surfactants. In this paper, environmentally responsive surface-modified silica nanoparticles are synthesized and used for enhancement of oil recovery. For this purpose, silica nanoparticles are coated with polyethylene glycol chains as hydrophilic agent and propyl chains as hydrophobic agent at various quantities, and their ability to modulate oil–water interface properties and oil recovery is examined. Oil–water interfacial tension and water surface tension are decreased by 50 % in the presence of silica nanoparticles coated with both agents. Measuring oil-drop contact angle on oil-wetted glass slides and carbonate rock sections, after aging in various surface-modified silica nanofluids, indicates that the wettability of various oil-wetted surfaces is modified from strongly oil-wet to water-wet. Flooding nanofluids to glass micro-models and pore-level investigations demonstrate that surface modification of silica nanoparticles, specially, with both hydrophilic and hydrophobic agents improves considerably their performance in increasing oil recovery and wettability alteration.

  11. Environmentally responsive surface-modified silica nanoparticles for enhanced oil recovery

    Energy Technology Data Exchange (ETDEWEB)

    Behzadi, Abed; Mohammadi, Aliasghar, E-mail: amohammadi@sharif.edu [Sharif University of Technology, Department of Chemical and Petroleum Engineering (Iran, Islamic Republic of)

    2016-09-15

    Environmentally responsive surface-modified nanoparticles are colloidal nanoparticles coated with, at least, two physicochemically distinct surface groups. Recent advances in the synthesis and production of nanoparticles have enabled the production of environmentally responsive surface-modified nanoparticles with both hydrophilic and hydrophobic surface groups. These nanoparticles act like colloidal surfactants. In this paper, environmentally responsive surface-modified silica nanoparticles are synthesized and used for enhancement of oil recovery. For this purpose, silica nanoparticles are coated with polyethylene glycol chains as hydrophilic agent and propyl chains as hydrophobic agent at various quantities, and their ability to modulate oil–water interface properties and oil recovery is examined. Oil–water interfacial tension and water surface tension are decreased by 50 % in the presence of silica nanoparticles coated with both agents. Measuring oil-drop contact angle on oil-wetted glass slides and carbonate rock sections, after aging in various surface-modified silica nanofluids, indicates that the wettability of various oil-wetted surfaces is modified from strongly oil-wet to water-wet. Flooding nanofluids to glass micro-models and pore-level investigations demonstrate that surface modification of silica nanoparticles, specially, with both hydrophilic and hydrophobic agents improves considerably their performance in increasing oil recovery and wettability alteration.

  12. Cosmological tests of modified gravity.

    Science.gov (United States)

    Koyama, Kazuya

    2016-04-01

    We review recent progress in the construction of modified gravity models as alternatives to dark energy as well as the development of cosmological tests of gravity. Einstein's theory of general relativity (GR) has been tested accurately within the local universe i.e. the Solar System, but this leaves the possibility open that it is not a good description of gravity at the largest scales in the Universe. This being said, the standard model of cosmology assumes GR on all scales. In 1998, astronomers made the surprising discovery that the expansion of the Universe is accelerating, not slowing down. This late-time acceleration of the Universe has become the most challenging problem in theoretical physics. Within the framework of GR, the acceleration would originate from an unknown dark energy. Alternatively, it could be that there is no dark energy and GR itself is in error on cosmological scales. In this review, we first give an overview of recent developments in modified gravity theories including f(R) gravity, braneworld gravity, Horndeski theory and massive/bigravity theory. We then focus on common properties these models share, such as screening mechanisms they use to evade the stringent Solar System tests. Once armed with a theoretical knowledge of modified gravity models, we move on to discuss how we can test modifications of gravity on cosmological scales. We present tests of gravity using linear cosmological perturbations and review the latest constraints on deviations from the standard [Formula: see text]CDM model. Since screening mechanisms leave distinct signatures in the non-linear structure formation, we also review novel astrophysical tests of gravity using clusters, dwarf galaxies and stars. The last decade has seen a number of new constraints placed on gravity from astrophysical to cosmological scales. Thanks to on-going and future surveys, cosmological tests of gravity will enjoy another, possibly even more, exciting ten years.

  13. Modified Steiner functional string action

    International Nuclear Information System (INIS)

    Baillie, C.F.; Johnston, D.A.

    1992-01-01

    It has recently been suggested by Ambartzumian et al. that the modified Steiner functional has desirable properties as an action for random surfaces and hence string world sheets. We perform a simulation of this action on a dynamically triangulated random surface to investigate this claim and find that the surfaces are in a flat phase

  14. Complications after modified radical mastectomy in early breast cancer

    International Nuclear Information System (INIS)

    Bhatty, I.; Shaharyar; Ibrahim, M.; Chaudhry, M.L.

    2004-01-01

    Objective: To study the frequency of complications, particularly the lymphedema of the arm, after modified radical mastectomy in early breast cancer patients who have not been given post-operative radiotherapy to axilla. Design: Hospital based descriptive study. Results: Median age of these patients was 47 years with a range of 25-58 years. Majority of these patients were stage II (84%) and infiltrating ductal carcinoma was the most frequent type of cancer (88%). Fifty-six percent of these patients had high grade tumors. None of the patients received radiotherapy to axilla after modified radical mastectomy. Early complications documented from history and medical record revealed that seroma formation was the most frequent early complication seen after modified radical mastectomy (20%). Frequent late complications included anterior chest tightness (56%), shoulder dysfunction (36%), lymphedema (26%) and sensory loss (22%). Shoulder dysfunction included limited range of movement in all 18 patients. Gross multiple restrictions were seen in 11 (61.11%) of these patients. Conclusion: It is concluded from this study that lymphedema and shoulder dysfunction are the two major complications in patients of early breast cancer who have undergone modified radical mastectomy without post-operative axillary radiation. (author)

  15. Gelatin modified lipid nanoparticles for anti- viral drug delivery.

    Science.gov (United States)

    K S, Joshy; S, Snigdha; Kalarikkal, Nandakumar; Pothen, Laly A; Thomas, Sabu

    2017-10-01

    The major challenges to clinical application of zidovudine are its moderate aqueous solubility and relative short half-life and serious side effects due to frequent administrations. We investigated the preparation of zidovudine-loaded nanoparticles based on lipids which were further modified with the polymer gelatin. Formulation and stability of the modified nanoparticles were analysed from the physico-chemical characterizations. The interactions of nanoparticles with blood components were tested by haemolysis and aggregation studies. The drug content and entrapment efficiencies were assessed by UV analysis. The effect of nanoparticles on protein adsorption was assessed by native polyacrylamide gel electrophoresis (PAGE). In vitro release studies showed a sustained release profile of zidovudine. In vitro cytotoxicity and cellular uptake of the zidovudine-loaded nanoparticles were performed in MCF-7 and neuro 2a brain cells. The enhanced cellular internalization of drug loaded modified nanoparticles in both the cell lines were revealed by fluorescence microscopy. Hence the present study focuses on the feasibility of zidovudine-loaded polymer modified lipid nanoparticles as carriers for safe and efficient HIV/AIDS therapy. Copyright © 2017 Elsevier B.V. All rights reserved.

  16. Multicriteria Personnel Selection by the Modified Fuzzy VIKOR Method

    Directory of Open Access Journals (Sweden)

    Rasim M. Alguliyev

    2015-01-01

    Full Text Available Personnel evaluation is an important process in human resource management. The multicriteria nature and the presence of both qualitative and quantitative factors make it considerably more complex. In this study, a fuzzy hybrid multicriteria decision-making (MCDM model is proposed to personnel evaluation. This model solves personnel evaluation problem in a fuzzy environment where both criteria and weights could be fuzzy sets. The triangular fuzzy numbers are used to evaluate the suitability of personnel and the approximate reasoning of linguistic values. For evaluation, we have selected five information culture criteria. The weights of the criteria were calculated using worst-case method. After that, modified fuzzy VIKOR is proposed to rank the alternatives. The outcome of this research is ranking and selecting best alternative with the help of fuzzy VIKOR and modified fuzzy VIKOR techniques. A comparative analysis of results by fuzzy VIKOR and modified fuzzy VIKOR methods is presented. Experiments showed that the proposed modified fuzzy VIKOR method has some advantages over fuzzy VIKOR method. Firstly, from a computational complexity point of view, the presented model is effective. Secondly, compared to fuzzy VIKOR method, it has high acceptable advantage compared to fuzzy VIKOR method.

  17. Modified Synthesis of Erlotinib Hydrochloride

    Directory of Open Access Journals (Sweden)

    Leila Barghi

    2012-06-01

    Full Text Available Purpose: An improved and economical method has been described for the synthesis of erlotinib hydrochloride, as a useful drug in treatment of non-small-cell lung cancer. Methods: Erlotinib hydrochloride was synthesized in seven steps starting from 3, 4-dihydroxy benzoic acid. In this study, we were able to modify one of the key steps which involved the reduction of the 6-nitrobenzoic acid derivative to 6-aminobenzoic acid derivative. An inexpensive reagent such as ammonium formate was used as an in situ hydrogen donor in the presence of palladium/charcoal (Pd/C instead of hydrogen gas at high pressure. Results: This proposed method proceeded with 92% yield at room temperature. Synthesis of erlotinib was completed in 7 steps with overall yield of 44%.Conclusion: From the results obtained it can be concluded that the modified method eliminated the potential danger associated with the use of hydrogen gas in the presence of flammable catalysts. It should be mentioned that the catalyst was recovered after the reaction and could be used again.

  18. Modified angle's classification for primary dentition

    Directory of Open Access Journals (Sweden)

    Kaushik Narendra Chandranee

    2017-01-01

    Full Text Available Aim: This study aims to propose a modification of Angle's classification for primary dentition and to assess its applicability in children from Central India, Nagpur. Methods: Modification in Angle's classification has been proposed for application in primary dentition. Small roman numbers i/ii/iii are used for primary dentition notation to represent Angle's Class I/II/III molar relationships as in permanent dentition, respectively. To assess applicability of modified Angle's classification a cross-sectional preschool 2000 children population from central India; 3–6 years of age residing in Nagpur metropolitan city of Maharashtra state were selected randomly as per the inclusion and exclusion criteria. Results: Majority 93.35% children were found to have bilateral Class i followed by 2.5% bilateral Class ii and 0.2% bilateral half cusp Class iii molar relationships as per the modified Angle's classification for primary dentition. About 3.75% children had various combinations of Class ii relationships and 0.2% children were having Class iii subdivision relationship. Conclusions: Modification of Angle's classification for application in primary dentition has been proposed. A cross-sectional investigation using new classification revealed various 6.25% Class ii and 0.4% Class iii molar relationships cases in preschool children population in a metropolitan city of Nagpur. Application of the modified Angle's classification to other population groups is warranted to validate its routine application in clinical pediatric dentistry.

  19. OnWien Bridge Oscillators as Modified Multi-vibrators

    DEFF Research Database (Denmark)

    Lindberg, Erik

    2014-01-01

    A tutorial introduction to electrical oscilla- tors. Investigating Wien bridge oscillators as modified multi-vibrators. Introducing chaotic behavior into a Wien bridge oscillator by means of adding a simple nonlinear cir- cuit as a load of one of the amplifier input terminals......A tutorial introduction to electrical oscilla- tors. Investigating Wien bridge oscillators as modified multi-vibrators. Introducing chaotic behavior into a Wien bridge oscillator by means of adding a simple nonlinear cir- cuit as a load of one of the amplifier input terminals...

  20. Chemical sensors based on molecularly modified metallic nanoparticles

    International Nuclear Information System (INIS)

    Haick, Hossam

    2007-01-01

    This paper presents a concise, although admittedly non-exhaustive, didactic review of some of the main concepts and approaches related to the use of molecularly modified metal nanoparticles in or as chemical sensors. This paper attempts to pull together different views and terminologies used in sensors based on molecularly modified metal nanoparticles, including those established upon electrochemical, optical, surface Plasmon resonance, piezoelectric and electrical transduction approaches. Finally, this paper discusses briefly the main advantages and disadvantages of each of the presented class of sensors. (review article)

  1. Thermophysical properties of polyethylene modified under γ radiation

    International Nuclear Information System (INIS)

    Shut, N.I.; Musaelyan, I.N.; Besklubenko, Yu.D.; Karpovich, N.B.; Kasperskij, A.V.

    1986-01-01

    Thermophysical properties (thermal conductivity, specific heat) of polyethylene (PE) modified under gamma radiation were studied. Thermophysical parameter dependences on the temperature (-100-+100 deg C) and an absorbed radiation dose are given. Degree of polymere crystallinity using a structural method for determination of the crystallinity degree by density was ascertained. It is shown that the PE thermophysical characteristics correlate to a value of absorbed gamma radiation dose, therefore gamma radiation can be recommended as a modifying factor for the production of polymer materials with the given properties

  2. Photoelectrocatalytic reduction of CO2 into chemicals using Pt-modified reduced graphene oxide combined with Pt-modified TiO2 nanotubes.

    Science.gov (United States)

    Cheng, Jun; Zhang, Meng; Wu, Gai; Wang, Xin; Zhou, Junhu; Cen, Kefa

    2014-06-17

    The photoelectrocatalytic (PEC) reduction of CO2 into high-value chemicals is beneficial in alleviating global warming and advancing a low-carbon economy. In this work, Pt-modified reduced graphene oxide (Pt-RGO) and Pt-modified TiO2 nanotubes (Pt-TNT) were combined as cathode and photoanode catalysts, respectively, to form a PEC reactor for converting CO2 into valuable chemicals. XRD, XPS, TEM, AFM, and SEM were employed to characterize the microstructures of the Pt-RGO and Pt-TNT catalysts. Reduction products, such as C2H5OH and CH3COOH, were obtained from CO2 under band gap illumination and biased voltage. A combined liquid product generation rate (CH3OH, C2H5OH, HCOOH, and CH3COOH) of approximately 600 nmol/(h·cm(2)) was observed. Carbon atom conversion rate reached 1,130 nmol/(h·cm(2)), which were much higher than those achieved using Pt-modified carbon nanotubes and platinum carbon as cathode catalysts.

  3. Ligand-Modified Human Serum Albumin Nanoparticles for Enhanced Gene Delivery.

    Science.gov (United States)

    Look, Jennifer; Wilhelm, Nadine; von Briesen, Hagen; Noske, Nadja; Günther, Christine; Langer, Klaus; Gorjup, Erwin

    2015-09-08

    The development of nonviral gene delivery systems is a great challenge to enable safe gene therapy. In this study, ligand-modified nanoparticles based on human serum albumin (HSA) were developed and optimized for an efficient gene therapy. Different glutaraldehyde cross-linking degrees were investigated to optimize the HSA nanoparticles for gene delivery. The peptide sequence arginine-glycine-aspartate (RGD) and the HIV-1 transactivator of transduction sequence (Tat) are well-known as promising targeting ligands. Plasmid DNA loaded HSA nanoparticles were covalently modified on their surface with these different ligands. The transfection potential of the obtained plasmid DNA loaded RGD- and Tat-modified nanoparticles was investigated in vitro, and optimal incubation conditions for these preparations were studied. It turned out that Tat-modified HSA nanoparticles with the lowest cross-linking degree of 20% showed the highest transfection potential. Taken together, ligand-functionalized HSA nanoparticles represent promising tools for efficient and safe gene therapy.

  4. Modifier constraint in alkali borophosphate glasses using topological constraint theory

    Energy Technology Data Exchange (ETDEWEB)

    Li, Xiang [Key Laboratory for Ultrafine Materials of Ministry of Education, School of Materials Science and Engineering, East China University of Science and Technology, Shanghai 200237 (China); Zeng, Huidan, E-mail: hdzeng@ecust.edu.cn [Key Laboratory for Ultrafine Materials of Ministry of Education, School of Materials Science and Engineering, East China University of Science and Technology, Shanghai 200237 (China); Jiang, Qi [Key Laboratory for Ultrafine Materials of Ministry of Education, School of Materials Science and Engineering, East China University of Science and Technology, Shanghai 200237 (China); Zhao, Donghui [Unifrax Corporation, Niagara Falls, NY 14305 (United States); Chen, Guorong [Key Laboratory for Ultrafine Materials of Ministry of Education, School of Materials Science and Engineering, East China University of Science and Technology, Shanghai 200237 (China); Wang, Zhaofeng; Sun, Luyi [Department of Chemical & Biomolecular Engineering and Polymer Program, Institute of Materials Science, University of Connecticut, Storrs, CT 06269 (United States); Chen, Jianding [Key Laboratory for Ultrafine Materials of Ministry of Education, School of Materials Science and Engineering, East China University of Science and Technology, Shanghai 200237 (China)

    2016-12-01

    In recent years, composition-dependent properties of glasses have been successfully predicted using the topological constraint theory. The constraints of the glass network are derived from two main parts: network formers and network modifiers. The constraints of the network formers can be calculated on the basis of the topological structure of the glass. However, the latter cannot be accurately calculated in this way, because of the existing of ionic bonds. In this paper, the constraints of the modifier ions in phosphate glasses were thoroughly investigated using the topological constraint theory. The results show that the constraints of the modifier ions are gradually increased with the addition of alkali oxides. Furthermore, an improved topological constraint theory for borophosphate glasses is proposed by taking the composition-dependent constraints of the network modifiers into consideration. The proposed theory is subsequently evaluated by analyzing the composition dependence of the glass transition temperature in alkali borophosphate glasses. This method is supposed to be extended to other similar glass systems containing alkali ions.

  5. Systematic simulations of modified gravity: symmetron and dilaton models

    International Nuclear Information System (INIS)

    Brax, Philippe; Davis, Anne-Christine; Li, Baojiu; Winther, Hans A.; Zhao, Gong-Bo

    2012-01-01

    We study the linear and nonlinear structure formation in the dilaton and symmetron models of modified gravity using a generic parameterisation which describes a large class of scenarios using only a few parameters, such as the coupling between the scalar field and the matter, and the range of the scalar force on very large scales. For this we have modified the N-body simulation code ECOSMOG, which is a variant of RAMSES working in modified gravity scenarios, to perform a set of 110 simulations for different models and parameter values, including the default ΛCDM. These simulations enable us to explore a large portion of the parameter space. We have studied the effects of modified gravity on the matter power spectrum and mass function, and found a rich and interesting phenomenology where the difference with the ΛCDM template cannot be reproduced by a linear analysis even on scales as large as k ∼ 0.05 hMpc −1 . Our results show the full effect of screening on nonlinear structure formation and the associated deviation from ΛCDM. We also investigate how differences in the force mediated by the scalar field in modified gravity models lead to qualitatively different features for the nonlinear power spectrum and the halo mass function, and how varying the individual model parameters changes these observables. The differences are particularly large in the nonlinear power spectra whose shapes for f(R), dilaton and symmetron models vary greatly, and where the characteristic bump around 1 hMpc −1 of f(R) models is preserved for symmetrons, whereas an increase on much smaller scales is particular to symmetrons. No bump is present for dilatons where a flattening of the power spectrum takes place on small scales. These deviations from ΛCDM and the differences between modified gravity models, such as dilatons and symmetrons, could be tested with future surveys

  6. Mechanical and thermal properties of polypropylene (PP) composites filled with modified shell waste

    Energy Technology Data Exchange (ETDEWEB)

    Yao, Z.T., E-mail: sxyzt@126.com [College of Materials Science and Environmental Engineering, Hangzhou Dianzi University, Hangzhou 310018 (China); Chen, T. [Department of Ocean Science and Engineering, Zhejiang University, Hangzhou 310058 (China); Li, H.Y. [Zhoushan Ocean Research Institute, Zhejiang University, Zhoushan 316021 (China); Xia, M.S., E-mail: msxia@zju.edu.cn [Department of Ocean Science and Engineering, Zhejiang University, Hangzhou 310058 (China); Ye, Y.; Zheng, H. [Department of Ocean Science and Engineering, Zhejiang University, Hangzhou 310058 (China)

    2013-11-15

    Highlights: • Adding modified shell powder could significantly increase the properties of PP. • The modified shell powder could act as a nucleating agent in PP matrix. • The modified shell powder has a potential to be used as a bio-filler. -- Abstract: Shell waste, with its high content of calcium carbonate (CaCO{sub 3}) plus organic matrix, has a potential to be used as a bio-filler. In this work, shell waste was modified by furfural and then incorporated to reinforce polypropylene (PP). The shell waste and modified powder were characterized by means of X-ray diffraction (XRD), scanning electron microscopy equipped with an energy dispersive spectrometer (SEM-EDS), X-ray photoelectronic spectroscopy (XPS), and Fourier transformed infrared spectroscopy (FTIR). The mechanical and thermal properties of neat PP and PP composites were investigated as well. Thermal gravimetric (TG) analyses confirmed the reinforcing role of modified powder in PP composites. The mechanical properties studied showed that adding modified powder could significantly increase the impact strength, elongation at break point and flexural modulus of composites. The maximum incorporation content could reach 15 wt.% with a good balance between toughness and stiffness of PP composites. Differential scanning calorimetry (DSC) results showed that the modified powder could act as a nucleating agent and thus increase the crystallization temperature of PP. Polarized optical microscopy (POM) observation also indicated that the introduction of modified powder could promote the heterogeneous nucleation of PP matrix.

  7. Preparation and Characterization of Modified Montmorillonite/Paraffin Phase Change Microcapsules for Energy Storage

    Directory of Open Access Journals (Sweden)

    LIN Sen

    2017-03-01

    Full Text Available The phase change microcapsules of modified montmorillonite/paraffin were prepared by Pickering emulsion method. Analytic techniques of optical microscopy, scanning electron microscopy(SEM, infrared spectroscopy(FTIR, differential scanning calorimetry(DSC and thermogravimetry(TG were utilized for characterizing chemical structure, morphology and thermal properties. Results show that modified montmorillonite as a new type wall material has excellent performance for protecting core material of paraffin. FTIR spectra of phase change of modified montmorillonite/paraffin microcapsules shows that their characteristic peaks match with corresponding peaks of pure paraffin and modified montmorillonite. DSC results indicate that modified montmorillonite/paraffin microcapsules have similar solid-liquid phase change temperature with pure paraffin. The phase transition enthalpy values of microcapsules with paraffin contents varying from 55% to 80% are 110.5-147.2J/g, indicating that microcapsules have excellent thermal storage performance and the phase change properties can be adjusted by changing contents of paraffin. TG results confirm that modified montmorillonite/paraffin microcapsules have outstanding thermal stability. The presented study indicates that modified montmorillonite is a suitable wall material for preparing paraffin microcapsule. Modified montmorillonite/paraffin microcapsules have advantages of low cost and high performance with a great application potential in the field of thermal storage.

  8. Iron and manganese oxides modified maize straw to remove tylosin from aqueous solutions.

    Science.gov (United States)

    Yin, Yongyuan; Guo, Xuetao; Peng, Dan

    2018-08-01

    Maize straw modified by iron and manganese oxides was synthesized via a simple and environmentally friendly method. Three maize straw materials, the original maize straw, maize straw modified by manganese oxides and maize straw modified by iron and manganese oxides, were detected by SEM, BET, XPS, XRD and FTIR. The results showed that maize straw was successfully modified and maize straw modified by iron and manganese oxides has a larger surface area than MS. According to the experimental data, the sorption trend could conform to the pseudo-second-order kinetic model well, and the sorption ability of tylosin on sorbents followed the order of original maize straw oxides iron and manganese oxides. The study indicated that manganese oxides and iron-manganese oxides could significantly enhance the sorption capacity of original maize straw. The sorption isotherm data of tylosin on original maize straw fit a linear model well, while Freundlich models were more suitable for maize straw modified by manganese oxides and maize straw modified by iron and manganese oxides. The pH, ionic strength and temperature can affect the sorption process. The sorption mechanisms of tylosin on iron and manganese oxides modified maize straw were attribute to the surface complexes, electrostatic interactions, H bonding and hydrophobic interactions. Copyright © 2018 Elsevier Ltd. All rights reserved.

  9. [A modified technique of liposuction with excision for gynecomastia].

    Science.gov (United States)

    Yang, Hong-Yan; Xu, Jun; Yan, Xiao-Qing; You, Lei

    2007-11-20

    To introduce a modified technique of liposuction with excision for gynecomastia. From 2003 to 2007, 32 cases of gynecomastia were treated with the modified technique: the operative region was divided into central and periphery parts, liposuction was performed only in the periphery part and the deep layer of the central part, while the breast gland in the superficial layer of the central part underwent sharp dissection, the subcutaneous tissue of the central part was conserved, and blood supply was reserved and saucer deformity was avoided. Follow-up was conducted for 3.0 - 18.5 months. Normal men breast appearance was achieved. No complication happened such as hematoma, seroma, saucer deformity, and necrosis in nipple and areola. This modified operative technique for gynecomastia proves to be an excellent and effective technique.

  10. Modification of Al-Si (13%) alloy using different modifiers

    International Nuclear Information System (INIS)

    Ikram, N.; Raza, M.R.; Ahmad, R.

    2007-01-01

    During present research work LM 13 aluminium silicon alloy was prepared using high purity aluminium ingot and various master alloys of AI-Si, AI-Cu, AI-Ni, AIFe, AI-Mn and AI-Mg. A gas fired crucible pit type furnace was used to prepare various heats of LM 13 alloy. Degassing procedure was carried out by using perforated bell type plunger using the degassing tablet. Modification was performed by plunging the modifier at the bottom of the crucible containing the molten metal. Three types of modifiers sodium salt, metallic sodium and strontium in the form of AI-Sr master alloy were used in order to evaluate the microstructure and tensile properties of the alloy. Degassed, unmodified and modified test samples for metallurgical testing purposes were prepared according to the standard procedures. (author)

  11. Copper hexacyanoferrate formation on the modified silica surface with DAB-Am-16 dendrimer

    International Nuclear Information System (INIS)

    Carmo, Devaney R. do; Gabriel Junior, Suelino; Bicalho, Urquisa O.; Paim, Leonardo L.

    2009-01-01

    The dendrimer hexadecamine poly(propylene)imine (DAB-Am-16) of third generation (G-3) was anchored on the silica gel surface. The modified silica interact easily with Cu 2+ and then with hexacyanoferrate to form copper hexacyanoferrate. The modified silica was characterized by following techniques: nuclear magnetic resonance (NMR), infrared (FTIR), energy dispersive X-ray (EDX) and cyclic voltammetry. As application of the composite obtained, the modified silica containing copper hexacyanoferrate (CuHCFSD) was tested for a voltammetric determination of nitrite using a graphite paste modified electrode. The modified graphite paste electrode can be applied also to the determination of others biological substances with success. (author)

  12. Chemically modified carboxypeptidase Y with increased amidase activity

    International Nuclear Information System (INIS)

    Breddam, K.

    1984-01-01

    Treatment of carboxypeptidase Y with 14 C-iodoacetamide caused a drastic reduction in the peptidase activity towards FA-Phe-Leu-OH while the esterase activity towards FA-Phe-OMe, the amidase activity towards FA-Phe-NH 2 and the peptidyl amino acid amide hydrolase activity towards FA-Phe-Gly-NH 2 were much less affected. The loss of peptidase activity could be correlated with the incorporation of a single equivalent of reagent and it was demonstrated that the site of reaction was a methionyl residue, thus forming a sulfonium derivative. Analogous methionyl modifications were performed: carboxypeptidase Y modified with phenacylbromide hydrolysed substrates with bulky leaving groups in the P position, i.e. -OEt, -OBzl, -Gly-NH 2 ,-Gly-OH, and -Leu-OH, at reduced rates while substrates with small groups in that position, i.e. -OMe and -NH 2 , were hydrolysed with increased rates. These results indicate that the methionyl residue modified by phenacylbromide is located in the S binding site of the enzyme. Similar results were obtained with carboxypeptidase Y modified with m-nitrophen- acylbromide and p-nitrophenacylbromide. The increase in amidase activity and decrease in peptidyl amino acid amide hydrolase activity of carboxypeptidase Y following modification with phenacylbromide, m-nitrophenacylbromide, and p-nitrophenacylbromide was exploited in deamidation of peptide amides. These modified enzymes deamidated peptide amides with the exception of those containing a C-terminal glycyl or seryl residue in yields of 80-100% which is significantly higher than with unmodified carboxypeptidase Y. (author)

  13. Synthesis of base-modified 2'-deoxyribonucleoside triphosphates and their use in enzymatic synthesis of modified DNA for applications in bioanalysis and chemical biology.

    Science.gov (United States)

    Hocek, Michal

    2014-11-07

    The synthesis of 2'-deoxyribonucleoside triphosphates (dNTPs) either by classical triphosphorylation of nucleosides or by aqueous cross-coupling reactions of halogenated dNTPs is discussed. Different enzymatic methods for synthesis of modified oligonucleotides and DNA by polymerase incorporation of modified nucleotides are summarized, and the applications in redox or fluorescent labeling, as well as in bioconjugations and modulation of interactions of DNA with proteins, are outlined.

  14. Disseminating genetically modified (GM) maize technology to ...

    African Journals Online (AJOL)

    Disseminating genetically modified (GM) maize technology to smallholder farmers in the Eastern Cape province of South Africa: extension personnel's awareness of stewardship requirements and dissemination practices.

  15. Effective control of modified palygorskite to NH4+-N release from sediment.

    Science.gov (United States)

    Chen, Lei; Zheng, Tianyuan; Zhang, Junjie; Liu, Jie; Zheng, Xilai

    2014-01-01

    Sediment capping is an in situ treatment technology that can effectively restrain nutrient and pollutant release from the sediment in lakes and reservoirs. Research on sediment capping has focused on the search for effective, non-polluting and affordable capping materials. The efficiency and mechanism of sediment capping with modified palygorskite in preventing sediment ammonia nitrogen (NH4+-N) release to surface water were investigated through a series of batch and sediment capping experiments. Purified palygorskite and different types of modified palygorskite (i.e. heated, acid-modified and NaCI-modified palygorskite) were used in this investigation. Factors affecting control efficiency, including the temperature, thickness and grain size of the capping layer, were also analysed. The batch tests showed that the adsorption of NH4+-N on modified palygorskite achieved an equilibration in the initial 45 min, and the adsorption isotherm followed the Freundlich equation. Sediment capping experiments showed that compared with non-capped condition, covering the sediment with modified palygorskite and sand both inhibited NH4+-N release to the overlying water. Given its excellent chemical stability and strong adsorption, heated palygorskite, which has a NH4+-N release inhibition ratio of 41.3%, is a more effective sediment capping material compared with sand. The controlling effectiveness of the modified palygorskite increases with thicker capping layer, lower temperature and smaller grain size of the capping material.

  16. Spatiotemporal patterns of non-genetically modified crops in the era of expansion of genetically modified food.

    Science.gov (United States)

    Sun, Jing; Wu, Wenbin; Tang, Huajun; Liu, Jianguo

    2015-09-18

    Despite heated debates over the safety of genetically modified (GM) food, GM crops have been expanding rapidly. Much research has focused on the expansion of GM crops. However, the spatiotemporal dynamics of non-genetically modified (non-GM) crops are not clear, although they may have significant environmental and agronomic impacts and important policy implications. To understand the dynamics of non-GM crops and to inform the debates among relevant stakeholders, we conducted spatiotemporal analyses of China's major non-GM soybean production region, the Heilongjiang Province. Even though the total soybean planting area decreased from 2005 to 2010, surprisingly, there were hotspots of increase. The results also showed hotspots of loss as well as a large decline in the number and continuity of soybean plots. Since China is the largest non-GM soybean producer in the world, the decline of its major production region may signal the continual decline of global non-GM soybeans.

  17. Organically modified clay removes oil from water

    International Nuclear Information System (INIS)

    Alther, G.R.

    1995-01-01

    When bentonite or other clays and zeolites are modified with quaternary amines, they become organophilic. Such modified bentonites are used to remove mechanically emulsified oil and grease, and other sparingly soluble organics. If the organoclay is granulated, it is placed into a liquid phase carbon filter vessel to remove FOG's and chlorinated hydrocarbons. In this application the clay is mixed with anthrazite to prevent early plugging of the filter by oil or grease droplets. In batch systems a powered organoclay is employed. Types of oil found in water can include fats, lubricants, cutting fluids, heavy hydrocarbons such as tars, grease, crude oil, diesel oils; and light hydrocarbons such as kerosene, jet fuel, and gasoline

  18. Modified Arthroscopic Brostrom Procedure With Bone Tunnels.

    Science.gov (United States)

    Lui, Tun Hing

    2016-08-01

    The open anatomic repair of the anterior talofibular and calcaneofibular ligaments (modified Brostrom procedure) is widely accepted as the standard surgical stabilization procedure for lateral ankle instability that does not respond to conservative measures. Arthroscopic Brostrom procedures with a suture anchor have been reported to achieve both anatomic repair of the lateral ankle ligaments and management of the associated intra-articular lesions. However, the complication rates are higher than open Brostom procedures. Many of these complications are associated with the use of a suture anchor. We report a modified arthroscopic Brostrom procedure in which the anterolateral ankle capsule is anchored to the lateral malleolus through small bone tunnels instead of suture anchors.

  19. Methyl methacrylate oligomerically-modified clay and its poly(methyl methacrylate) nanocomposites

    International Nuclear Information System (INIS)

    Zheng Xiaoxia; Jiang, David D.; Wilkie, Charles A.

    2005-01-01

    A methyl methacrylate oligomerically-modified clay was used to prepare poly(methyl methacrylate) clay nanocomposites by melt blending and the effect of the clay loading level on the modified clay and corresponding nanocomposite was studied. These nanocomposites were characterized by X-ray diffraction, transmission electron microscopy, thermogravimetric analysis and cone calorimetry. The results show a mixed intercalated/delaminated morphology with good nanodispersion. The compatibility between the methylacrylate-subsituted clay and poly(methyl methacrylate) (PMMA) are greatly improved compared to other oligomerically-modified clays

  20. RESEARCH OF THE STRESS STATE OF A MODIFIED IN-SITU CONCRETE

    Directory of Open Access Journals (Sweden)

    D. V. Rudenko

    2016-12-01

    Full Text Available Purpose. The article focuses on investigation of the stress state of a modified in-situ concrete of natural hardening. Methodology. To achieve the aim, the research of the microstructure of the modified cement matrix of concrete, as well as the mechanism of structure formation of modified concrete with natural hardening was conducted; the methods for reliable evaluation of concrete strength were defined. Findings. The development of internal stresses affects the properties of concretedifferently. With an increase in temperature-shrinkage deformations in time and, thus, with increasing structural stresses in the cement sheath around the grains of the filler two opposite processes may develop: zone of plastic flow or cracking. Originality. It was established that the structural features complex of the modified concrete when the load transfer leads to the formation of extensive zones of prefracture which is able to absorb a significant amount of elastic strain energy that provides the design deformation properties of the concrete for special purposes. Ideas about the definition of the criteria of cracking modified concrete, hardening under natural conditions had further development. Practical value. The resulting equations allow to solve the problem about the minimum level of structural stress in monolithic concrete in a saturated large placeholder, as well as to assess the influence of structural stresses on the properties of concrete. In normal concrete with a relatively thin cement sheath at temperature-shrinkage deformations, high tangential and low radial tension occur. In vivo, this stress is higher as a result of higher values of Δε(τ, which is not observed in the modified concrete. In the modified concretes only tangential stresses are the greatest danger to structures. The change of shrinkage stress with time is straightforward. The total temperature-shrinkage deformations have a sawtooth graph. For modified concrete the amplitude is 48

  1. Evaluation of Modified Risk Claim Advertising Formats for Camel Snus

    Science.gov (United States)

    Fix, Brian V.; Adkison, Sarah E.; O'Connor, Richard J.; Bansal-Travers, Maansi; Cummings, K. Michael; Rees, Vaughan W.; Hatsukami, Dorothy K.

    2017-01-01

    Objectives: The US Food and Drug Administration (FDA) has regulatory authority for modified risk tobacco product advertising claims. To guide future regulatory efforts, we investigated how variations in modified risk claim advertisements influence consumer perceptions of product risk claims for Camel Snus. Methods: Young people and adults (15-65),…

  2. Modified calcium oxide as stable solid base catalyst for Aldol

    Indian Academy of Sciences (India)

    A highly efficient and stable solid-base catalyst for Aldol condensation was prepared by modifying commercial CaO with benzyl bromide in a simple way. It was found that modified CaO can effectively catalyse the Aldol condensation of cyclohexanone and benzaldehyde, as well as various benzaldehydes, to produce ...

  3. Papapetrou energy-momentum tensor for Chern-Simons modified gravity

    International Nuclear Information System (INIS)

    Guarrera, David; Hariton, A. J.

    2007-01-01

    We construct a conserved, symmetric energy-momentum (pseudo-)tensor for Chern-Simons modified gravity, thus demonstrating that the theory is Lorentz invariant. The tensor is discussed in relation to other gravitational energy-momentum tensors and analyzed for the Schwarzschild, Reissner-Nordstrom, and Friedmann-Robertson-Walker solutions. To our knowledge this is the first confirmation that the Reissner-Nordstrom and Friedmann-Robertson-Walker metrics are solutions of the modified theory

  4. Decontamination of radioactive liquid systems by modified clay minerals

    OpenAIRE

    Petrushka, Ihor; Moroz, Olexandr

    2016-01-01

    The process mechanism for sorption of strontium and cesium from liquid radioactive waste using modified bentonites from Yaziv sulfur deposit was investigated. The technique for predicting the intensity of the sorption process based on the comparison of experimental and calculated values of mass transfer coefficients was proposed. It was detected that the process of sorption extraction of strontium and cesium from liquid medium using modified clay minerals may be bes...

  5. The global distribution of diet breadth in insect herbivores

    Czech Academy of Sciences Publication Activity Database

    Forister, M. J.; Novotný, Vojtěch; Panorska, A. K.; Baje, L.; Basset, Y.; Butterill, Philip T.; Čížek, Lukáš; Coley, P. D.; Dem, F.; Diniz, I. R.; Drozd, P.; Fox, M.; Glassmire, A. E.; Hazen, R.; Hrček, Jan; Jahner, J. P.; Kaman, Ondřej; Kozubowski, T. J.; Kursar, T. A.; Lewis, O. T.; Lill, J.; Marquis, R. J.; Miller, S. E.; Morais, H. C.; Murakami, M.; Nickel, H.; Pardikes, N. A.; Ricklefs, R. E.; Singer, M. S.; Smilanich, A. M.; Stireman, J. O.; Villamarín-Cortez, S.; Vodka, Štěpán; Volf, Martin; Wagner, D. L.; Walla, T.; Weiblen, G. D.; Dyer, L. A.

    2015-01-01

    Roč. 112, č. 2 (2015), s. 442-447 ISSN 0027-8424 Institutional support: RVO:60077344 Keywords : host range * latitudinal gradient * niche width Subject RIV: EH - Ecology, Behaviour Impact factor: 9.423, year: 2015 http://www.pnas.org/content/112/2/442.full.pdf+html

  6. Systematic simulations of modified gravity: chameleon models

    Energy Technology Data Exchange (ETDEWEB)

    Brax, Philippe [Institut de Physique Theorique, CEA, IPhT, CNRS, URA 2306, F-91191Gif/Yvette Cedex (France); Davis, Anne-Christine [DAMTP, Centre for Mathematical Sciences, University of Cambridge, Wilberforce Road, Cambridge CB3 0WA (United Kingdom); Li, Baojiu [Institute for Computational Cosmology, Department of Physics, Durham University, Durham DH1 3LE (United Kingdom); Winther, Hans A. [Institute of Theoretical Astrophysics, University of Oslo, 0315 Oslo (Norway); Zhao, Gong-Bo, E-mail: philippe.brax@cea.fr, E-mail: a.c.davis@damtp.cam.ac.uk, E-mail: baojiu.li@durham.ac.uk, E-mail: h.a.winther@astro.uio.no, E-mail: gong-bo.zhao@port.ac.uk [Institute of Cosmology and Gravitation, University of Portsmouth, Portsmouth PO1 3FX (United Kingdom)

    2013-04-01

    In this work we systematically study the linear and nonlinear structure formation in chameleon theories of modified gravity, using a generic parameterisation which describes a large class of models using only 4 parameters. For this we have modified the N-body simulation code ecosmog to perform a total of 65 simulations for different models and parameter values, including the default ΛCDM. These simulations enable us to explore a significant portion of the parameter space. We have studied the effects of modified gravity on the matter power spectrum and mass function, and found a rich and interesting phenomenology where the difference with the ΛCDM paradigm cannot be reproduced by a linear analysis even on scales as large as k ∼ 0.05 hMpc{sup −1}, since the latter incorrectly assumes that the modification of gravity depends only on the background matter density. Our results show that the chameleon screening mechanism is significantly more efficient than other mechanisms such as the dilaton and symmetron, especially in high-density regions and at early times, and can serve as a guidance to determine the parts of the chameleon parameter space which are cosmologically interesting and thus merit further studies in the future.

  7. Systematic simulations of modified gravity: chameleon models

    International Nuclear Information System (INIS)

    Brax, Philippe; Davis, Anne-Christine; Li, Baojiu; Winther, Hans A.; Zhao, Gong-Bo

    2013-01-01

    In this work we systematically study the linear and nonlinear structure formation in chameleon theories of modified gravity, using a generic parameterisation which describes a large class of models using only 4 parameters. For this we have modified the N-body simulation code ecosmog to perform a total of 65 simulations for different models and parameter values, including the default ΛCDM. These simulations enable us to explore a significant portion of the parameter space. We have studied the effects of modified gravity on the matter power spectrum and mass function, and found a rich and interesting phenomenology where the difference with the ΛCDM paradigm cannot be reproduced by a linear analysis even on scales as large as k ∼ 0.05 hMpc −1 , since the latter incorrectly assumes that the modification of gravity depends only on the background matter density. Our results show that the chameleon screening mechanism is significantly more efficient than other mechanisms such as the dilaton and symmetron, especially in high-density regions and at early times, and can serve as a guidance to determine the parts of the chameleon parameter space which are cosmologically interesting and thus merit further studies in the future

  8. Generation of TALE-Based Designer Epigenome Modifiers.

    Science.gov (United States)

    Nitsch, Sandra; Mussolino, Claudio

    2018-01-01

    Manipulation of gene expression can be facilitated by editing the genome or the epigenome. Precise genome editing is traditionally achieved by using designer nucleases which are generally exploited to eliminate a specific gene product. Upon the introduction of a site-specific DNA double-strand break (DSB) by the nuclease, endogenous DSB repair mechanisms are in turn harnessed to induce DNA sequence changes that can result in target gene inactivation. Minimal off-target effects can be obtained by endowing designer nucleases with the highly specific DNA-binding domain (DBD) derived from transcription activator-like effectors (TALEs). In contrast, epigenome editing allows gene expression control without inducing changes in the DNA sequence by specifically altering epigenetic marks, as histone tails modifications or DNA methylation patterns within promoter or enhancer regions. Importantly, this approach allows both up- and downregulation of the target gene expression, and the effect is generally reversible. TALE-based designer epigenome modifiers combine the high specificity of TALE-derived DBDs with the power of epigenetic modifier domains to induce fast and long-lasting changes in the epigenetic landscape of a target gene and control its expression. Here we provide a detailed description for the generation of TALE-based designer epigenome modifiers and of a suitable reporter cell line to easily monitor their activity.

  9. Investigation of squeal noise under positive friction characteristics condition provided by friction modifiers

    Science.gov (United States)

    Liu, Xiaogang; Meehan, Paul A.

    2016-06-01

    Field application of friction modifiers on the top of rail has been shown to effectively curb squeal and reduce lateral forces, but performance can be variable, according to other relevant research. Up to now, most investigations of friction modifiers were conducted in the field, where it is difficult to control or measure important parameters such as angle of attack, rolling speed, adhesion ratio etc. In the present investigation, the effect of different friction modifiers on the occurrence of squeal was investigated on a rolling contact two disk test rig. In particular, friction-creep curves and squeal sound pressure levels were measured under different rolling speeds and friction modifiers. The results show friction modifiers can eliminate or reduce the negative slope of friction-creep curves, but squeal noise still exists. Theoretical modelling of instantaneous creep behaviours reveals a possible reason why wheel squeal still exists after the application of friction modifiers.

  10. Inorganically modified diatomite as a potential prolonged-release drug carrier.

    Science.gov (United States)

    Janićijević, Jelena; Krajišnik, Danina; Calija, Bojan; Dobričić, Vladimir; Daković, Aleksandra; Krstić, Jugoslav; Marković, Marija; Milić, Jela

    2014-09-01

    Inorganic modification of diatomite was performed with the precipitation product of partially neutralized aluminum sulfate solution at three different mass ratios. The starting and the modified diatomites were characterized by SEM-EDS, FTIR, thermal analysis and zeta potential measurements and evaluated for drug loading capacity in adsorption batch experiments using diclofenac sodium (DS) as a model drug. In vitro drug release studies were performed in phosphate buffer pH6.8 from comprimates containing: the drug adsorbed onto the selected modified diatomite sample (DAMD), physical mixture of the drug with the selected modified diatomite sample (PMDMD) and physical mixture of the drug with the starting diatomite (PMDD). In vivo acute toxicity testing of the modified diatomite samples was performed on mice. High adsorbent loading of the selected modified diatomite sample (~250mg/g in 2h) enabled the preparation of comprimates containing adsorbed DS in the amount near to its therapeutic dose. Drug release studies demonstrated prolonged release of DS over a period of 8h from both DAMD comprimates (18% after 8h) and PMDMD comprimates (45% after 8h). The release kinetics for DAMD and PMDMD comprimates fitted well with Korsmeyer-Peppas and Bhaskar models, indicating that the release mechanism was a combination of non-Fickian diffusion and ion exchange process. Copyright © 2014 Elsevier B.V. All rights reserved.

  11. Biocompatible Silver Nanoparticle-Modified Natural Diatomite with Anti-Infective Property

    Directory of Open Access Journals (Sweden)

    Haolin Sun

    2018-01-01

    Full Text Available Nanosilver as an alternative antibacterial agent of antibiotics has been researched for possible applications in various orthopedic implants. However, it is imperative to achieve controllable release of Ag+ to reduce its cytotoxic effect on normal tissue. Here, a nanosilver release system that has potential to be used in anti-infective bone cement was reported. Nanosilver modified diatomite was developed through the reaction of Tollens’ reagent to improve the antibacterial effect and natural diatomite was used as the carrier of Ag+ ions for controlled release. Cytotoxicity and the antibacterial activities of the nanosilver release system were characterized. After 3 days, the NIH3T3 cells cultured in the extract of nanosilver modified diatomite with an initial concentration of 0.5 mg/ml showed better cell viability than cells cultured in α-MEM. The density of MC3T3-E1 cells cultured in the extract of nanosilver modified diatomite at the same concentration did not differ significantly from the density of cells cultured in α-MEM. The nanosilver modified diatomite exhibited antibacterial effect against E. coli and S. aureus when the concentration was higher than 0.5 mg/ml. With appropriate selection of Ag+ concentration, the nanosilver modified diatomite is promising for improving the antibacterial effect while not affecting the biocompatibility of reinforced calcium phosphate bone cement.

  12. A Modified Scheme of Triplectic Quantization

    OpenAIRE

    Geyer, B.; Gitman, D. M.; Lavrov, P. M.

    1998-01-01

    A modified version of triplectic quantization, first introduce by Batalin and Martnelius, is proposed which makes use of two independent master equations, one for the action and one for the gauge functional such that the initial classical action also obeys that master equation.

  13. Cosmology with modified Newtonian dynamics (MOND)

    NARCIS (Netherlands)

    Sanders, R. H.

    1998-01-01

    It is well known that the application of Newtonian dynamics to an expanding spherical region leads to the correct relativistic expression (the Friedmann equation) for the evolution of the cosmic scalefactor. Here, the cosmological implications of Milgrom's modified Newtonian dynamics (MOND) are

  14. PVC mixtures’ mechanical properties with the addition of modified calcite as filler

    Directory of Open Access Journals (Sweden)

    Vučinić Dušica R.

    2012-01-01

    Full Text Available In this study mechanical properties of PVC mixtures (PVC, stabilizer, lubricant, filler such as tensile strength, tensile elongation, breaking strength, and breaking elongation were investigated. Unmodified calcite, as well as calcite modified by stearic acid, were used as fillers in wet and dry processes. The PVC mixtures containing the calcite modified by wet procedure have better mechanical properties compared to those with the calcite modified by the dry process. Tensile and breaking strength of the PVC mixture containing the calcite modified with 1.5% stearic acid using wet process, are higher for 2.8% and 5.2%, respectively, compared to the PVC mixture containing the calcite modified with the same amount of acid used in the dry process. The tensile strength difference between the mixtures increases with the increase of the concentration of used stearic acid up to 3%. The strength of PVC mixture with the calcite modified by wet process is 3.1% higher compared to the mixture containing calcite modified by dry process. The results showed that the bonding strength between calcite and the adsorbed organic component affected tensile strength, tensile elongation and breaking strength of the PVC mixtures. The best filler was obtained by wet modification using 1.5% stearic acid solution that provided the formation of a stearate monolayer chemisorbed on calcite. The PVC mixtures containing the calcite modified by wet process using 1.5% stearic acid solution exhibited the best mechanical properties. This calcite was completely hydrophobic with dominant chemically adsorbed surfactant, which means that stearate chemisorbed on calcite provided stronger interaction in the calcite-stearic acid-PVC system.

  15. Modified-BRISQUE as no reference image quality assessment for structural MR images.

    Science.gov (United States)

    Chow, Li Sze; Rajagopal, Heshalini

    2017-11-01

    An effective and practical Image Quality Assessment (IQA) model is needed to assess the image quality produced from any new hardware or software in MRI. A highly competitive No Reference - IQA (NR - IQA) model called Blind/Referenceless Image Spatial Quality Evaluator (BRISQUE) initially designed for natural images were modified to evaluate structural MR images. The BRISQUE model measures the image quality by using the locally normalized luminance coefficients, which were used to calculate the image features. The modified-BRISQUE model trained a new regression model using MR image features and Difference Mean Opinion Score (DMOS) from 775 MR images. Two types of benchmarks: objective and subjective assessments were used as performance evaluators for both original and modified-BRISQUE models. There was a high correlation between the modified-BRISQUE with both benchmarks, and they were higher than those for the original BRISQUE. There was a significant percentage improvement in their correlation values. The modified-BRISQUE was statistically better than the original BRISQUE. The modified-BRISQUE model can accurately measure the image quality of MR images. It is a practical NR-IQA model for MR images without using reference images. Copyright © 2017 Elsevier Inc. All rights reserved.

  16. Generating Solutions to Discrete sine-Gordon Equation from Modified Baecklund Transformation

    International Nuclear Information System (INIS)

    Kou Xin; Zhang Dajun; Shi Ying; Zhao Songlin

    2011-01-01

    We modify the bilinear Baecklund transformation for the discrete sine-Gordon equation and derive variety, of solutions by freely choosing parameters from the modified Baecklund transformation. Dynamics of solutions and continuum limits are also discussed. (general)

  17. Image Compression using Haar and Modified Haar Wavelet Transform

    Directory of Open Access Journals (Sweden)

    Mohannad Abid Shehab Ahmed

    2013-04-01

    Full Text Available Efficient image compression approaches can provide the best solutions to the recent growth of the data intensive and multimedia based applications. As presented in many papers the Haar matrix–based methods and wavelet analysis can be used in various areas of image processing such as edge detection, preserving, smoothing or filtering. In this paper, color image compression analysis and synthesis based on Haar and modified Haar is presented. The standard Haar wavelet transformation with N=2 is composed of a sequence of low-pass and high-pass filters, known as a filter bank, the vertical and horizontal Haar filters are composed to construct four 2-dimensional filters, such filters applied directly to the image to speed up the implementation of the Haar wavelet transform. Modified Haar technique is studied and implemented for odd based numbers i.e. (N=3 & N=5 to generate many solution sets, these sets are tested using the energy function or numerical method to get the optimum one.The Haar transform is simple, efficient in memory usage due to high zero value spread (it can use sparse principle, and exactly reversible without the edge effects as compared to DCT (Discrete Cosine Transform. The implemented Matlab simulation results prove the effectiveness of DWT (Discrete Wave Transform algorithms based on Haar and Modified Haar techniques in attaining an efficient compression ratio (C.R, achieving higher peak signal to noise ratio (PSNR, and the resulting images are of much smoother as compared to standard JPEG especially for high C.R. A comparison between standard JPEG, Haar, and Modified Haar techniques is done finally which approves the highest capability of Modified Haar between others.

  18. A nonstandard numerical method for the modified KdV equation

    Indian Academy of Sciences (India)

    Ayhan Aydin

    2017-10-25

    Oct 25, 2017 ... Nonstandard finite difference; modified Korteweg–de Vries equation; local truncation error. PACS Nos 02.70.Bf; 02.30.Jr; 02.60.Lj. 1. Introduction. Many physical phenomena in various fields of science such as fluid mechanics and quantum field theory can be described by the modified Koreteweg–de Vries ...

  19. Exploring the Relationship between Modified Output and Working Memory Capacity

    Science.gov (United States)

    Mackey, Alison; Adams, Rebecca; Stafford, Catherine; Winke, Paula

    2010-01-01

    This study examines the relationship between learners' production of modified output and their working memory (WM) capacity. The task-based interactions of 42 college-level, native English-speaking learners of Spanish as a foreign language were examined. A relationship was found between learners' WM test scores and their tendency to modify output.…

  20. The Adsorption Mechanism of Modified Activated Carbon on Phenol

    Directory of Open Access Journals (Sweden)

    Lin J. Q.

    2016-01-01

    Full Text Available Modified activated carbon was prepared by thermal treatment at high temperature under nitrogen flow. The surface properties of the activated carbon were characterized by Boehm titration, BET and point of zero charge determination. The adsorption mechanism of phenol on modified activated carbon was explained and the adsorption capacity of modified activated carbon for phenol when compared to plain activated carbon was evaluated through the analysis of adsorption isotherms, thermodynamic and kinetic properties. Results shows that after modification the surface alkaline property and pHpzc value of the activated carbon increase and the surface oxygen-containing functional groups decrease. The adsorption processes of the plain and modified carbon fit with Langmuir isotherm equation well, and the maximum adsorption capacity increase from 123.46, 111.11, 103.09mg/g to 192.31, 178.57, 163,93mg/g under 15, 25 and 35°C after modification, respectively. Thermodynamic parameters show that the adsorption of phenol on activated carbon is a spontaneously exothermic process of entropy reduction, implying that the adsorption is a physical adsorption. The adsorption of phenol on activated carbon follows the pseudo-second-order kinetics (R2>0.99. The optimum pH of adsorption is 6~8.