The Galileo Solid-State Imaging experiment
Belton, M.J.S.; Klaasen, K.P.; Clary, M.C.; Anderson, J.L.; Anger, C.D.; Carr, M.H.; Chapman, C.R.; Davies, M.E.; Greeley, R.; Anderson, D.; Bolef, L.K.; Townsend, T.E.; Greenberg, R.; Head, J. W.; Neukum, G.; Pilcher, C.B.; Veverka, J.; Gierasch, P.J.; Fanale, F.P.; Ingersoll, A.P.; Masursky, H.; Morrison, D.; Pollack, James B.
1992-01-01
The Solid State Imaging (SSI) experiment on the Galileo Orbiter spacecraft utilizes a high-resolution (1500 mm focal length) television camera with an 800 ?? 800 pixel virtual-phase, charge-coupled detector. It is designed to return images of Jupiter and its satellites that are characterized by a combination of sensitivity levels, spatial resolution, geometric fiedelity, and spectral range unmatched by imaging data obtained previously. The spectral range extends from approximately 375 to 1100 nm and only in the near ultra-violet region (??? 350 nm) is the spectral coverage reduced from previous missions. The camera is approximately 100 times more sensitive than those used in the Voyager mission, and, because of the nature of the satellite encounters, will produce images with approximately 100 times the ground resolution (i.e., ??? 50 m lp-1) on the Galilean satellites. We describe aspects of the detector including its sensitivity to energetic particle radiation and how the requirements for a large full-well capacity and long-term stability in operating voltages led to the choice of the virtual phase chip. The F/8.5 camera system can reach point sources of V(mag) ??? 11 with S/N ??? 10 and extended sources with surface brightness as low as 20 kR in its highest gain state and longest exposure mode. We describe the performance of the system as determined by ground calibration and the improvements that have been made to the telescope (same basic catadioptric design that was used in Mariner 10 and the Voyager high-resolution cameras) to reduce the scattered light reaching the detector. The images are linearly digitized 8-bits deep and, after flat-fielding, are cosmetically clean. Information 'preserving' and 'non-preserving' on-board data compression capabilities are outlined. A special "summation" mode, designed for use deep in the Jovian radiation belts, near Io, is also described. The detector is 'preflashed' before each exposure to ensure the photometric linearity
Galileo SSI Observations of Volcanic Activity at Tvashtar Catena, Io
Milazzo, M. P.; Keszthely, L. P.; Radebaugh, J.; Davies, A. G.; Turtle, E. P.; Geissler, P.; Klaasen, K. P.; McEwen, A. S.
2005-01-01
Introduction: We report on the analysis of the Galileo SSI's observations of the volcanic activity at Tvashtar Catena, Io as discussed by Milazzo et al. Galileo's Solid State Imager (SSI) observed Tvashtar Catena (63 deg N, 120 deg W) four times between November 1999 and October 2001, providing a unique look at the distinctive high latitude volcanism on Io. The November 1999 observation spatially resolved, for the first time, an active extraterrestrial fissure eruption. The brightness temperature of the lavas at the November 1999 fissure eruption was 1300 K. The second observation (orbit I27, February 2000) showed a large (approx. 500 sq km) region with many, small spots of hot, active lava. The third observation was taken in conjunction with a Cassini observation in December 2000 and showed a Pele-like plume deposition ring, while the Cassini images revealed a 400 km high Pele-type plume above the Catena. The final Galileo SSI observation of Tvashtar was acquired in October 2001, and all obvious (to SSI) activity had ceased, although data from Galileo's Near Infrared Mapping Spectrometer (NIMS) indicated that there was still significant thermal emission from the Tvashtar region. We have concentrated on analyzing the style of eruption during orbit I27 (February 2000). Comparison with a lava flow cooling model indicates that the behavior of the Tvashtar eruption during I27 does not match that of "simple" advancing lava flows. Instead, it may be an active lava lake or a complex set of lava flows with episodic, overlapping (in time and space) eruptions.
Wamhoff, Steve; Wiseman, Michael
Interactions and overlap of social assistance programs across clients interest policymakers because such interactions affect both the clients' well-being and the programs' efficiency. This article investigates the connections between Supplemental Security Income (SSI) and Temporary Assistance for Needy Families (TANF) and TANF's predecessor, the Aid to Families with Dependent Children (AFDC) program. Connections between receipt of TANF and SSI are widely discussed in both disability policy and poverty research literatures because many families receiving TANF report disabilities. For both states and the individuals involved, it is generally financially advantageous for adults and children with disabilities to transfer from TANF to SSI. States gain because the federal government pays for the SSI benefit, and states can then use the TANF savings for other purposes. The families gain because the SSI benefits they acquire are greater than the TANF benefits they lose. The payoff to states from transferring welfare recipients to SSI was substantially increased when Congress replaced AFDC with TANF in 1996. States retained less than half of any savings achieved through such transfers under AFDC, but they retain all of the savings under TANF. Also, the work participation requirements under TANF have obligated states to address the work support needs of adults with disabilities who remain in TANF, and states can avoid these costs if adults have disabilities that satisfy SSI eligibility requirements. The incentive for TANF recipients to apply for SSI has increased over time as inflation has caused real TANF benefits to fall relative to payments received by SSI recipients. Trends in the financial incentives for transfer to SSI have not been studied in detail, and reliable general data on the extent of the interaction between TANF and SSI are scarce. In addition, some estimates of the prevalence of TANF receipt among SSI awardees are flawed because they fail to include adults
Chemical imaging and solid state analysis at compact surfaces using UV imaging
DEFF Research Database (Denmark)
Wu, Jian X.; Rehder, Sönke; van den Berg, Frans
2014-01-01
and excipients in a non-invasive way, as well as mapping the glibenclamide solid state form. An exploratory data analysis supported the critical evaluation of the mapping results and the selection of model parameters for the chemical mapping. The present study demonstrated that the multi-wavelength UV imaging......Fast non-destructive multi-wavelength UV imaging together with multivariate image analysis was utilized to visualize distribution of chemical components and their solid state form at compact surfaces. Amorphous and crystalline solid forms of the antidiabetic compound glibenclamide...
Supplemental Security Income (SSI) Recipients in each State by Sex and Age, December 2010
Social Security Administration — The Supplemental Security Income (SSI) Recipients in each State by Sex and Age (December 2010) is produced using the data found in Table 10 from the SSI Report of...
20th International Conference on Solid State Ionics (SSI 20)
2016-05-20
Italy; 2CNST @PoliMI, Istituto Italiano di Tecnologia , Milano, Italy; 3Physical Chemistry of Solids, Max Planck Institute for Solid State Research...Coughlin5; 1Chemical Sciences, University of Padova, Padova, Italy; 2Consorzio Interuniversitario Nazionale per la Scienza e la Tecnologia dei Materiali...Germany; 2Instituto de Tecnologia Quimica , Valencia, Spain; 3Ernst Ruska Center, Jülich, Germany. 4:50 PM J5.05 Hydrogen Permeation through CO2-Stable
Han, Chang Wan; Ortalan, Volkan
2015-09-01
We have demonstrated a new electron tomography technique utilizing the secondary signals (secondary electrons and backscattered electrons) for ultra thick (a few μm) specimens. The Monte Carlo electron scattering simulations reveal that the amount of backscattered electrons generated by 200 and 300keV incident electrons is a monotonic function of the sample thickness and this causes the thickness contrast satisfying the projection requirement for the tomographic reconstruction. Additional contribution of the secondary electrons emitted from the edges of the specimens enhances the visibility of the surface features. The acquired SSI tilt series of the specimen having mesoscopic dimensions are successfully reconstructed verifying that this new technique, so called the secondary signal imaging electron tomography (SSI-ET), can directly be utilized for 3D structural analysis of mesoscale structures. Published by Elsevier Ltd.
Enhanced 2D-image upconversion using solid-state lasers
DEFF Research Database (Denmark)
Pedersen, Christian; Karamehmedovic, Emir; Dam, Jeppe Seidelin
2009-01-01
the image inside a nonlinear PPKTP crystal located in the high intra-cavity field of a 1342 nm solid-state Nd:YVO4 laser, an upconverted image at 488 nm is generated. We have experimentally achieved an upconversion efficiency of 40% under CW conditions. The proposed technique can be further adapted for high...
International Nuclear Information System (INIS)
Cowen, A.R.; Davies, A.G.; Sivananthan, M.U.
2008-01-01
Dynamic, flat-panel, solid-state, x-ray image detectors for use in digital fluoroscopy and fluorography emerged at the turn of the millennium. This new generation of dynamic detectors utilize a thin layer of x-ray absorptive material superimposed upon an electronic active matrix array fabricated in a film of hydrogenated amorphous silicon (a-Si:H). Dynamic solid-state detectors come in two basic designs, the indirect-conversion (x-ray scintillator based) and the direct-conversion (x-ray photoconductor based). This review explains the underlying principles and enabling technologies associated with these detector designs, and evaluates their physical imaging characteristics, comparing their performance against the long established x-ray image intensifier television (TV) system. Solid-state detectors afford a number of physical imaging benefits compared with the latter. These include zero geometrical distortion and vignetting, immunity from blooming at exposure highlights and negligible contrast loss (due to internal scatter). They also exhibit a wider dynamic range and maintain higher spatial resolution when imaging over larger fields of view. The detective quantum efficiency of indirect-conversion, dynamic, solid-state detectors is superior to that of both x-ray image intensifier TV systems and direct-conversion detectors. Dynamic solid-state detectors are playing a burgeoning role in fluoroscopy-guided diagnosis and intervention, leading to the displacement of x-ray image intensifier TV-based systems. Future trends in dynamic, solid-state, digital fluoroscopy detectors are also briefly considered. These include the growth in associated three-dimensional (3D) visualization techniques and potential improvements in dynamic detector design
Solid-state, flat-panel, digital radiography detectors and their physical imaging characteristics
Energy Technology Data Exchange (ETDEWEB)
Cowen, A.R. [LXi Research, Academic Unit of Medical Physics, University of Leeds, West Yorkshire (United Kingdom)], E-mail: a.r.cowen@leeds.ac.uk; Kengyelics, S.M.; Davies, A.G. [LXi Research, Academic Unit of Medical Physics, University of Leeds, West Yorkshire (United Kingdom)
2008-05-15
Solid-state, digital radiography (DR) detectors, designed specifically for standard projection radiography, emerged just before the turn of the millennium. This new generation of digital image detector comprises a thin layer of x-ray absorptive material combined with an electronic active matrix array fabricated in a thin film of hydrogenated amorphous silicon (a-Si:H). DR detectors can offer both efficient (low-dose) x-ray image acquisition plus on-line readout of the latent image as electronic data. To date, solid-state, flat-panel, DR detectors have come in two principal designs, the indirect-conversion (x-ray scintillator-based) and the direct-conversion (x-ray photoconductor-based) types. This review describes the underlying principles and enabling technologies exploited by these designs of detector, and evaluates their physical imaging characteristics, comparing performance both against each other and computed radiography (CR). In standard projection radiography indirect conversion DR detectors currently offer superior physical image quality and dose efficiency compared with direct conversion DR and modern point-scan CR. These conclusions have been confirmed in the findings of clinical evaluations of DR detectors. Future trends in solid-state DR detector technologies are also briefly considered. Salient innovations include WiFi-enabled, portable DR detectors, improvements in x-ray absorber layers and developments in alternative electronic media to a-Si:H.
A Practical and Portable Solids-State Electronic Terahertz Imaging System
Directory of Open Access Journals (Sweden)
Ken Smart
2016-04-01
Full Text Available A practical compact solid-state terahertz imaging system is presented. Various beam guiding architectures were explored and hardware performance assessed to improve its compactness, robustness, multi-functionality and simplicity of operation. The system performance in terms of image resolution, signal-to-noise ratio, the electronic signal modulation versus optical chopper, is evaluated and discussed. The system can be conveniently switched between transmission and reflection mode according to the application. A range of imaging application scenarios was explored and images of high visual quality were obtained in both transmission and reflection mode.
Novakovic, Dunja; Saarinen, Jukka; Rojalin, Tatu; Antikainen, Osmo; Fraser-Miller, Sara J; Laaksonen, Timo; Peltonen, Leena; Isomäki, Antti; Strachan, Clare J
2017-11-07
Two nonlinear imaging modalities, coherent anti-Stokes Raman scattering (CARS) and sum-frequency generation (SFG), were successfully combined for sensitive multimodal imaging of multiple solid-state forms and their changes on drug tablet surfaces. Two imaging approaches were used and compared: (i) hyperspectral CARS combined with principal component analysis (PCA) and SFG imaging and (ii) simultaneous narrowband CARS and SFG imaging. Three different solid-state forms of indomethacin-the crystalline gamma and alpha forms, as well as the amorphous form-were clearly distinguished using both approaches. Simultaneous narrowband CARS and SFG imaging was faster, but hyperspectral CARS and SFG imaging has the potential to be applied to a wider variety of more complex samples. These methodologies were further used to follow crystallization of indomethacin on tablet surfaces under two storage conditions: 30 °C/23% RH and 30 °C/75% RH. Imaging with (sub)micron resolution showed that the approach allowed detection of very early stage surface crystallization. The surfaces progressively crystallized to predominantly (but not exclusively) the gamma form at lower humidity and the alpha form at higher humidity. Overall, this study suggests that multimodal nonlinear imaging is a highly sensitive, solid-state (and chemically) specific, rapid, and versatile imaging technique for understanding and hence controlling (surface) solid-state forms and their complex changes in pharmaceuticals.
Cristol, Y
2013-01-01
Solid State Video Cameras reviews the state of the art in the field of solid-state television cameras as compiled from patent literature. Organized into 10 chapters, the book begins with the basic array types of solid-state imagers and appropriate read-out circuits and methods. Documents relating to improvement of picture quality, such as spurious signal suppression, uniformity correction, or resolution enhancement, are also cited. The last part considerssolid-state color cameras.
DEFF Research Database (Denmark)
Alexandrino, Guilherme L; Amigo Rubio, Jose Manuel; Khorasani, Milad Rouhi
2017-01-01
Solid-state transitions at the surface of pharmaceutical solid dosage forms (SDF) were monitored using multi-series hyperspectral imaging (HSI) along with Multivariate Curve Resolution – Alternating Least Squares (MCR-ALS) and Parallel Factor Analysis (PARAFAC and PARAFAC2). First, the solid-stat...
Understanding solid state physics
Holgate, Sharon Ann
2009-01-01
Where Sharon Ann Holgate has succeeded in this book is in packing it with examples of the application of solid state physics to technology. … All the basic elements of solid state physics are covered … . The range of materials is good, including as it does polymers and glasses as well as crystalline solids. In general, the style makes for easy reading. … Overall this book succeeds in showing the relevance of solid state physics to the modern world … .-Contemporary Physics, Vol. 52, No. 2, 2011I was indeed amused and inspired by the wonderful images throughout the book, carefully selected by th
Soft x-ray imaging by a commercial solid-state television camera
International Nuclear Information System (INIS)
Matsushima, I.; Koyama, K.; Tanimoto, M.; Yano, M.
1987-01-01
A commerical, solid-state television camera has been used to record images of soft x radiation (0.8--12 keV). The performance of the camera is theoretically analyzed and experimentally evaluated compared with an x-ray photographic film (Kodak direct exposure film). In the application, the camera has been used to provide image patterns of x rays from laser-produced plasmas. It is demonstrated that the camera has several advantages over x-ray photographic film
Galileo spacecraft solid-state imaging system view of Antarctica
1990-01-01
Galileo spacecraft solid-state imaging system view of Antarctica was taken during its first encounter with the Earth. This color picture of Antarctica is part of a mosaic of pictures covering the entire polar continent showing the Ross Ice Shelf and its border with the sea and mountains poking through the ice near the McMurdo Station. From top to bottom, the frame looks across about half of Antarctica. View provided by the Jet Propulsion Laboratory (JPL) with alternate number P-37297.
Kimura, Koji; Sawa, Akihiro; Akagi, Shinji; Kihira, Kenji
2007-06-01
We have developed an original system to conduct surgical site infection (SSI) surveillance. This system accumulates SSI surveillance information based on the National Nosocomial Infections Surveillance (NNIS) System and the Japanese Nosocomial Infections Surveillance (JNIS) System. The features of this system are as follows: easy input of data, high generality, data accuracy, SSI rate by operative procedure and risk index category (RIC) can be promptly calculated and compared with the current NNIS SSI rate, and the SSI rates and accumulated data can be exported electronically. Using this system, we monitored 798 patients in 24 operative procedure categories in the Digestive Organs Surgery Department of Mazda Hospital, Mazda Motor Corporation, from January 2004 through December 2005. The total number and rate of SSI were 47 and 5.89%, respectively. The SSI rates of 777 patients were calculated based on 15 operative procedure categories and Risk Index Categories (RIC). The highest SSI rate was observed in the rectum surgery of RIC 1 (30%), followed by the colon surgery of RIC3 (28.57%). About 30% of the isolated infecting bacteria were Enterococcus faecalis, Staphylococcus aureus, Klebsiella pneumoniae, Pseudomonas aeruginosa, and Escherichia coli. Using quantification theory type 2, the American Society of Anesthesiology score (4.531), volume of hemorrhage under operation (3.075), wound classification (1.76), operation time (1.352), and history of diabetes (0.989) increased to higher ranks as factors for SSI. Therefore, we evaluated this system as a useful tool in safety control for operative procedures.
Active Volcanism on Io as Seen by Galileo SSI
McEwen, A.S.; Keszthelyi, L.; Geissler, P.; Simonelli, D.P.; Carr, M.H.; Johnson, T.V.; Klaasen, K.P.; Breneman, H.H.; Jones, T.J.; Kaufman, J.M.; Magee, K.P.; Senske, D.A.; Belton, M.J.S.; Schubert, G.
1998-01-01
Active volcanism on Io has been monitored during the nominal Galileo satellite tour from mid 1996 through late 1997. The Solid State Imaging (SSI) experiment was able to observe many manifestations of this active volcanism, including (1) changes in the color and albedo of the surface, (2) active airborne plumes, and (3) glowing vents seen in eclipse. About 30 large-scale (tens of kilometers) surface changes are obvious from comparison of the SSI images to those acquired by Voyager in 1979. These include new pyroclastic deposits of several colors, bright and dark flows, and caldera-floor materials. There have also been significant surface changes on Io during the Galileo mission itself, such as a new 400-km-diameter dark pyroclastic deposit around Pillan Patera. While these surface changes are impressive, the number of large-scale changes observed in the four months between the Voyager 1 and Voyager 2 flybys in 1979 suggested that over 17 years the cumulative changes would have been much more impressive. There are two reasons why this was not actually the case. First, it appears that the most widespread plume deposits are ephemeral and seem to disappear within a few years. Second, it appears that a large fraction of the volcanic activity is confined to repeated resurfacing of dark calderas and flow fields that cover only a few percent of Io's surface. The plume monitoring has revealed 10 active plumes, comparable to the 9 plumes observed by Voyager. One of these plumes was visible only in the first orbit and three became active in the later orbits. Only the Prometheus plume has been consistently active and easy to detect. Observations of the Pele plume have been particularly intriguing since it was detected only once by SSI, despite repeated attempts, but has been detected several times by the Hubble Space Telescope at 255 nm. Pele's plume is much taller (460 km) than during Voyager 1 (300 km) and much fainter at visible wavelengths. Prometheus-type plumes (50
Imaging of fast-neutron sources using solid-state track-recorder pinhole radiography
International Nuclear Information System (INIS)
Ruddy, F.H.; Gold, R.; Roberts, J.H.; Kaiser, B.J.; Preston, C.C.
1983-08-01
Pinhole imaging methods are being developed and tested for potential future use in imaging the intense neutron source of the Fusion Materials Irradiation Test (FMIT) Facility. Previously reported, extensive calibration measurements of the proton, neutron, and alpha particle response characteristics of CR-39 polymer solid state track recorders (SSTRs) are being used to interpret the results of imaging experiments using both charged particle and neutron pinhole collimators. High resolution, neutron pinhole images of a 252 Cf source have been obtained in the form of neutron induced proton recoil tracks in CR-39 polymer SSTR. These imaging experiments are described as well as their potential future applications to FMIT
The final Galileo SSI observations of Io: Orbits G28-I33
Turtle, E.P.; Keszthelyi, L.P.; McEwen, A.S.; Radebaugh, J.; Milazzo, M.; Simonelli, D.P.; Geissler, P.; Williams, D.A.; Perry, J.; Jaeger, W.L.; Klaasen, K.P.; Breneman, H.H.; Denk, T.; Phillips, C.B.
2004-01-01
We present the observations of Io acquired by the Solid State Imaging (SSI) experiment during the Galileo Millennium Mission (GMM) and the strategy we used to plan the exploration of Io. Despite Galileo's tight restrictions on data volume and downlink capability and several spacecraft and camera anomalies due to the intense radiation close to Jupiter, there were many successful SSI observations during GMM. Four giant, high-latitude plumes, including the largest plume ever observed on Io, were documented over a period of eight months; only faint evidence of such plumes had been seen since the Voyager 2 encounter, despite monitoring by Galileo during the previous five years. Moreover, the source of one of the plumes was Tvashtar Catena, demonstrating that a single site can exhibit remarkably diverse eruption styles - from a curtain of lava fountains, to extensive surface flows, and finally a ??? 400 km high plume - over a relatively short period of time (??? 13 months between orbits 125 and G29). Despite this substantial activity, no evidence of any truly new volcanic center was seen during the six years of Galileo observations. The recent observations also revealed details of mass wasting processes acting on Io. Slumping and landsliding dominate and occur in close proximity to each other, demonstrating spatial variation in material properties over distances of several kilometers. However, despite the ubiquitous evidence for mass wasting, the rate of volcanic resurfacing seems to dominate; the floors of paterae in proximity to mountains are generally free of debris. Finally, the highest resolution observations obtained during Galileo's final encounters with Io provided further evidence for a wide diversity of surface processes at work on Io. ?? 2003 Elsevier Inc. All rights reserved.
Time-Domain Fluorescence Lifetime Imaging Techniques Suitable for Solid-State Imaging Sensor Arrays
Directory of Open Access Journals (Sweden)
Robert K. Henderson
2012-05-01
Full Text Available We have successfully demonstrated video-rate CMOS single-photon avalanche diode (SPAD-based cameras for fluorescence lifetime imaging microscopy (FLIM by applying innovative FLIM algorithms. We also review and compare several time-domain techniques and solid-state FLIM systems, and adapt the proposed algorithms for massive CMOS SPAD-based arrays and hardware implementations. The theoretical error equations are derived and their performances are demonstrated on the data obtained from 0.13 μm CMOS SPAD arrays and the multiple-decay data obtained from scanning PMT systems. In vivo two photon fluorescence lifetime imaging data of FITC-albumin labeled vasculature of a P22 rat carcinosarcoma (BD9 rat window chamber are used to test how different algorithms perform on bi-decay data. The proposed techniques are capable of producing lifetime images with enough contrast.
DEFF Research Database (Denmark)
Alexandrino, Guilherme L; Khorasani, Milad Rouhi; Amigo Rubio, Jose Manuel
2015-01-01
The assessment of the solid-state stability of active pharmaceutical ingredient (API) and/or excipients in solid dosage forms during manufacturing and storage is mandatory for safeguarding quality of the final products. In this work, the solid-state transformations in tablets prepared as blends...... of piroxicam monohydrate (API), polyvinylpyrrolidone and the lactose forms monohydrate or anhydrate were studied when the tablets were exposed to the 23-120°C range. Multi-series near-infrared hyperspectral images were obtained from the surface of each sample for unveiling the local evolution of the solid......-state transformations. The preprocessed spectra from the images (dataset) were arranged in augmented matrices, according to the composition of the tablets, and the profile of the overlapped compounds (relative concentration) along the solid-state transformations in the pixels was resolved by using multivariate curve...
2010-10-01
... SSI. (a) Marking of paper records. In the case of paper records containing SSI, a covered person must... limitation statement on the bottom, of— (1) The outside of any front and back cover, including a binder cover... types of records. In the case of non-paper records that contain SSI, including motion picture films...
Overview of solid state lasers with applications as LIDAR transmitters and optical image amplifiers
International Nuclear Information System (INIS)
Powell, R.C.; Basiev, T.T.; Zverev, P.G.
2000-01-01
Full text: This talk will review the current status of solid state lasers. Then a specific class of solid state lasers, Raman lasers, will be discussed as a specific example of new technology development. The spectroscopic properties of the materials are used in these lasers is presented and the use of these materials in shared-, coupled-, and external-resonator laser systems is described. System design parameters affecting efficiency, beam quality, and temporal pulse width are discussed. Examples will be presented of the use of these lasers for transmitters in atmospheric and marine imaging light detection and ranging (LIDAR) systems and in optical amplifiers
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI339 (Link to dictyBase) - - - Contig-U04467-1 SSI339Z (Link... to Original site) - - SSI339Z 563 - - - - Show SSI339 Library SS (Link to library) Clone ID SSI339 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U04467-1 Original site URL http://dict...1998. 1.22 Translated Amino Acid sequence ---FTCSNNQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICT...NQVISSSLVSENNCIYTVEMSGNIFCPTPTPTPTPTPTPTPNPTSNVTCKSS NGISITSSDIITCIGYGQSICTTSSGYSCETNQTNGVLKCISPDNSISCIGNQFY
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI473 (Link to dictyBase) - - - - SSI473Z (Link to Original s...ite) - - SSI473Z 416 - - - - Show SSI473 Library SS (Link to library) Clone ID SSI473 (Link to dictyBase) Atlas ID - NBRP ID - dict...yBase ID - Link to Contig - Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/...uences producing significant alignments: (bits) Value N M77492 |M77492.1 Dictyost...Hdk03092 Head kidney cDNA library Ictalurus punctatus cDNA 5' similar to Dual specificity phosphatase 10 (DU
SSI's review of SKB's RDandD Program 2007
International Nuclear Information System (INIS)
Wiebert, Anders
2008-05-01
In this report, the Swedish Radiation Protection Authority (SSI) provides a review of the Swedish Nuclear Fuel and Waste Managements Company's (SKB) RDandD programme 2007. The report is a statement from SSI in the matter submitted earlier to SKI. In the review, SSI comments SKB's feedback to the continuous research and development program on the basis of the latest carried out safety analysis, SR-Can and the biosphere research. In the statement SSI points to a number of issues that need to be resolved before a licence application is handed in. SSI suggests that the Government asks for complements to the RDandD programme 2007. According to SSI, the programme concerning low and intermediate level waste and decommissioning of the nuclear power plants does not fulfil the requirements established by the Act on Nuclear Activities. Neither does the programme fulfil the expectations set by the Government decision regarding the RDandD programme 2004. SSI suggests that the programme should be complemented
Vanderspiegel, Jan
1994-01-01
This report surveys different technologies and approaches to realize sensors for image warping. The goal is to study the feasibility, technical aspects, and limitations of making an electronic camera with special geometries which implements certain transformations for image warping. This work was inspired by the research done by Dr. Juday at NASA Johnson Space Center on image warping. The study has looked into different solid-state technologies to fabricate image sensors. It is found that among the available technologies, CMOS is preferred over CCD technology. CMOS provides more flexibility to design different functions into the sensor, is more widely available, and is a lower cost solution. By using an architecture with row and column decoders one has the added flexibility of addressing the pixels at random, or read out only part of the image.
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI468 (Link to dictyBase) - - - Contig-U16310-1 SSI468Z (Link... to Original site) - - SSI468Z 300 - - - - Show SSI468 Library SS (Link to library) Clone ID SSI468 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16310-1 Original site URL http://dict...gnments: (bits) Value N AC116330 |AC116330.2 Dictyostelium discoideum chromosome 2 map 3191214-3323468 strai...NCING IN PROGRESS ***, 3 unordered pieces. 46 6.0 2 BM029242 |BM029242.1 IpSkn00196 Skin cDNA library Ictalu
Li, Feng; Li, Hongren; Cui, Tianfang
2017-11-01
Fluorescent carbon-based nanomaterials(CNs) with tunable visible emission are biocompatible, environment friendly and most suitable for various biomedical applications. Despite the successes in preparing strongly fluorescent CNs, preserving the luminescence in solid materials is still challenging because of the serious emission quenching of CNs in solid state materials. In this work, fluorescent carbon and silica nanohybrids (SiCNHs) were synthesized via a simple one-step hydrothermal approach by carbonizing sodium citrate and (3-aminopropyl)triethoxysilane(APTES), and hydrolysis of tetraethyl orthosilicate(TEOS). The resultant SiCNs were characterized through X-ray diffraction (XRD), transmission electron microscopy (TEM), FT-IR, X-ray photoelectron spectroscopy (XPS), and photoluminescence (PL) spectroscopy. The SiCNs exhibited strong fluorescence in both aqueous and solid states. The luminescent solid state SiCNs power were successfully used as a fluorescent labeling material for enhanced imaging of latent fingerprints(LFPs) on single background colour and multi-coloured surfaces substrates in forensic science for individual identification.
Lifescience Database Archive (English)
Full Text Available SS (Link to library) SSI527 (Link to dictyBase) - - - Contig-U16209-1 SSI527F (Link... to Original site) SSI527F 685 - - - - - - Show SSI527 Library SS (Link to library) Clone ID SSI527 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16209-1 Original site URL http://dict...N BM438323 |BM438323.1 IpLvr01076 Liver cDNA library Ictalurus punctatus cDNA 5' ...6357825 5' similar to SW:RSP4_CHICK P50890 40S RIBOSOMAL PROTEIN SA ;, mRNA sequence. 46 4e-06 2 BQ096846 |BQ096846.1 IfHdk00487 Ict
Lifescience Database Archive (English)
Full Text Available ate cortex cDNA, RIKEN full-length enriched library, clone:A830088K09, 3' end partial sequence. 42 5.7 1 AC068663 |AC068663.4 Mus mu...SS (Link to library) SSI485 (Link to dictyBase) - - - Contig-U14077-1 SSI485F (Link... to Original site) SSI485F 438 - - - - - - Show SSI485 Library SS (Link to library) Clone ID SSI485 (Link to dic...cia MC0-3 ... 115 4e-25 EF100191_35( EF100191 |pid:none) Uncultured marine bacterium HF10_... 115 5e-25 AP00...9385_2657( AP009385 |pid:none) Burkholderia multivorans ATCC 1... 114 1e-24 BC056
Galileo SSI Observations of Io During Orbits C30 I33
Keszthelyi, L.; Turtle, E.; McEwen, A.; Simonelli, D.; Geissler, P.; Williams, D.; Milazzo, M.; Radebaugh, J.; Jaeger, W.; Klaasen, K. P.
2002-01-01
New Galileo SSI imaging of Io from orbits C30 I33 will be presented. The aging Galileo spacecraft continues to produce spectacular new results, including the tallest volcanic plume yet found on Io. Additional information is contained in the original extended abstract.
Zhao, Qiaole; Schelen, Ben; Schouten, Raymond; van den Oever, Rein; Leenen, René; van Kuijk, Harry; Peters, Inge; Polderdijk, Frank; Bosiers, Jan; Raspe, Marcel; Jalink, Kees; Geert Sander de Jong, Jan; van Geest, Bert; Stoop, Karel; Young, Ian Ted
2012-12-01
We have built an all-solid-state camera that is directly modulated at the pixel level for frequency-domain fluorescence lifetime imaging microscopy (FLIM) measurements. This novel camera eliminates the need for an image intensifier through the use of an application-specific charge coupled device design in a frequency-domain FLIM system. The first stage of evaluation for the camera has been carried out. Camera characteristics such as noise distribution, dark current influence, camera gain, sampling density, sensitivity, linearity of photometric response, and optical transfer function have been studied through experiments. We are able to do lifetime measurement using our modulated, electron-multiplied fluorescence lifetime imaging microscope (MEM-FLIM) camera for various objects, e.g., fluorescein solution, fixed green fluorescent protein (GFP) cells, and GFP-actin stained live cells. A detailed comparison of a conventional microchannel plate (MCP)-based FLIM system and the MEM-FLIM system is presented. The MEM-FLIM camera shows higher resolution and a better image quality. The MEM-FLIM camera provides a new opportunity for performing frequency-domain FLIM.
SSI's Review of RD and D Programme 98
International Nuclear Information System (INIS)
1999-06-01
The report contains SSI's review of SKB's research programme and SSI's background review PM. In the interest of transparency of the site selection process, SSI has made requirements concerning additional reporting from SKB, prior to the next step in the site selection process, and advice to the government regarding the need for clarification on a number of issues
Initial clinical experience with dedicated ultra fast solid state cardiac gamma camera
International Nuclear Information System (INIS)
Aland, Nusrat; Lele, V.
2010-01-01
Full text: To analyze the imaging and diagnostic performance of new dedicated ultra fast solid state detector gamma camera and compare it with standard dual detector gamma camera in myocardial perfusion imaging. Material and Methods: In total 900 patients underwent myocardial perfusion imaging between 1st February 2010 and 29th August 2010 either stress/rest or rest/stress protocol. There was no age or gender bias (there were 630 males and 270 females). 5 and 15 mCi of 99m Tc - Tetrofosmin/MIBI was injected for 1st and 2nd part of the study respectively. Waiting period after injection was 20 min for regular stress and 40 min for pharmacological stress and 40 min after rest injection. Acquisition was performed on solid state detector gamma camera for a duration of 5 min and 3 min for 1st and 2nd part respectively. Interpretation of myocardial perfusion was done and QGS/QPS protocol was used for EF analysis. Out of these, 20 random patients underwent back to back myocardial perfusion SPECT imaging on standard dual detector gamma camera on same day. There was no age or gender bias (there were 9 males, 11 females). Acquisition time was 20 min for each part of the study. Interpretation was done using Autocard and EF analyses with 4 DM SPECT. Images obtained were then compared with those of solid state detector gamma camera. Result: Good quality and high count myocardial perfusion images were obtained with lesser amount of tracer activity on solid state detector gamma camera. Obese patients also showed good quality images with less tracer activity. As compared to conventional dual detector gamma camera images were brighter and showed better contrast with solid state gamma camera. Right ventricular imaging was better seen. Analyses of diastolic dysfunction was possible with 16 frame gated studies with solid state gamma camera. Shorter acquisition time with comfortable position reduced possibility of patient motion. All cardiac views were obtained with no movement of the
Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood
The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to translate SSI-4 into Persian language and to discuss its relative and absolute reliability as well as its criterion validity for Persian adults who stutter (PWS). We also aimed to study how the new subjective self-reports of the SSI-4 complement the stuttering severity score obtained from the SSI-3 or the SSI-4. The cross-cultural guideline recommended by the International Quality of Life Assessment project was used to translate the SSI-4 into Persian language. Thirty five PWS from ages 17 to 42 were recruited and 10 speech and language pathologists assessed their stuttering severity using either the SSI-4 or stuttering severity ratings (SR) to test validity and reliability of the Persian translated version. A very high inter-judge relative reliability along with a poor absolute inter-judge reliability was found for the SSI-4 scores. The results were more promising for the intra-judge absolute reliability. Test-retest reliability of the complementary questions to the SSI-4 was also found acceptable. However, no strong relationship was found between the SSI-4 scores and its complementary questions. The Persian version of the SSI-4 can be used reliably by trained SLPs for research and clinical purposes, but not to document small changes in stuttering severity. We argue that the response of participants to the complementary self-report questions should also be considered in calculating their stuttering severity score. Copyright © 2018 Elsevier Inc. All rights reserved.
2009-12-01
The Supplemental Security Income (SSI) program remains an important source of financial support for low-income families of children with special health care needs and disabling conditions. In most states, SSI eligibility also qualifies children for the state Medicaid program, providing access to health care services. The Social Security Administration (SSA), which administers the SSI program, considers a child disabled under SSI if there is a medically determinable physical or mental impairment or combination of impairments that results in marked and severe functional limitations. The impairment(s) must be expected to result in death or have lasted or be expected to last for a continuous period of at least 12 months. The income and assets of families of children with disabilities are also considered when determining financial eligibility. When an individual with a disability becomes an adult at 18 years of age, the SSA considers only the individual's income and assets. The SSA considers an adult to be disabled if there is a medically determinable impairment (or combination of impairments) that prevents substantial gainful activity for at least 12 continuous months. SSI benefits are important for youth with chronic conditions who are transitioning to adulthood. The purpose of this statement is to provide updated information about the SSI medical and financial eligibility criteria and the disability-determination process. This statement also discusses how pediatricians can help children and youth when they apply for SSI benefits.
Coherent diffractive imaging of solid state reactions in zinc oxide crystals
Leake, Steven J.; Harder, Ross; Robinson, Ian K.
2011-11-01
We investigated the doping of zinc oxide (ZnO) microcrystals with iron and nickel via in situ coherent x-ray diffractive imaging (CXDI) in vacuum. Evaporated thin metal films were deposited onto the ZnO microcrystals. A single crystal was selected and tracked through annealing cycles. A solid state reaction was observed in both iron and nickel experiments using CXDI. A combination of the shrink wrap and guided hybrid-input-output phasing methods were applied to retrieve the electron density. The resolution was 33 nm (half order) determined via the phase retrieval transfer function. The resulting images are nevertheless sensitive to sub-angstrom displacements. The exterior of the microcrystal was found to degrade dramatically. The annealing of ZnO microcrystals coated with metal thin films proved an unsuitable doping method. In addition the observed defect structure of one crystal was attributed to the presence of an array of defects and was found to change upon annealing.
Development of a solid-state multi-sensor array camera for real time imaging of magnetic fields
International Nuclear Information System (INIS)
Benitez, D; Gaydecki, P; Quek, S; Torres, V
2007-01-01
The development of a real-time magnetic field imaging camera based on solid-state sensors is described. The final laboratory comprises a 2D array of 33 x 33 solid state, tri-axial magneto-inductive sensors, and is located within a large current-carrying coil. This may be excited to produce either a steady or time-varying magnetic field. Outputs from several rows of sensors are routed to a sub-master controller and all sub-masters route to a master-controller responsible for data coordination and signal pre-processing. The data are finally streamed to a host computer via a USB interface and the image generated and displayed at a rate of several frames per second. Accurate image generation is predicated on a knowledge of the sensor response, magnetic field perturbations and the nature of the target respecting permeability and conductivity. To this end, the development of the instrumentation has been complemented by extensive numerical modelling of field distribution patterns using boundary element methods. Although it was originally intended for deployment in the nondestructive evaluation (NDE) of reinforced concrete, it was soon realised during the course of the work that the magnetic field imaging system had many potential applications, for example, in medicine, security screening, quality assurance (such as the food industry), other areas of nondestructive evaluation (NDE), designs associated with magnetic fields, teaching and research
Development of a solid-state multi-sensor array camera for real time imaging of magnetic fields
Benitez, D.; Gaydecki, P.; Quek, S.; Torres, V.
2007-07-01
The development of a real-time magnetic field imaging camera based on solid-state sensors is described. The final laboratory comprises a 2D array of 33 x 33 solid state, tri-axial magneto-inductive sensors, and is located within a large current-carrying coil. This may be excited to produce either a steady or time-varying magnetic field. Outputs from several rows of sensors are routed to a sub-master controller and all sub-masters route to a master-controller responsible for data coordination and signal pre-processing. The data are finally streamed to a host computer via a USB interface and the image generated and displayed at a rate of several frames per second. Accurate image generation is predicated on a knowledge of the sensor response, magnetic field perturbations and the nature of the target respecting permeability and conductivity. To this end, the development of the instrumentation has been complemented by extensive numerical modelling of field distribution patterns using boundary element methods. Although it was originally intended for deployment in the nondestructive evaluation (NDE) of reinforced concrete, it was soon realised during the course of the work that the magnetic field imaging system had many potential applications, for example, in medicine, security screening, quality assurance (such as the food industry), other areas of nondestructive evaluation (NDE), designs associated with magnetic fields, teaching and research.
Science teachers teaching socioscientific issues (SSI): Four case studies
Lee, Hyunju
Socioscientific issues (SSI) are a class of issues that represent the social, ethical, and moral aspects of science in society. The need for the inclusion of SSI into science curricula has been generally accepted, but relatively few science teachers have incorporated SSI into their courses. Most science teachers feel that their most important task by far is to teach the principles of science, and any substantive pedagogical changes represent a burden. However, there are some teachers who address SSI out of personal initiatives. This dissertation study investigates four high school science teachers who address SSI out of their own initiative and explores their deeper inspirations, values, philosophies, and personal ideals that lead them to teach SSI. The overall approach is based on essentialist methodology (Witz, Goodwin, Hart, & Thomas, 2001; Witz, 2006a) with its focus on "the participant as ally" and "essentialist portraiture." The primary data source is four to six in-depth interviews with individual teachers (about 40-90 minutes for each interview). The interviews are complemented by extensive classroom observations of individual teachers' teaching SSI and by document analysis (including teaching materials, rubrics, student group projects and journals, etc.). There are two major findings. First, the teachers' deeper values and ideals are a source of larger inspiration that plays a significant role in changing their teaching practice. This inspiration may involve higher aspects (e.g., deep concern for students' development, unselfishness, caring, etc.) and commitment. Their teaching represents an integration of their personal experiences, values, concerns, and worldviews, which forms a larger inspiration for teaching. Teaching SSI is a part of this larger process. Second, the current curriculum reforms (STS, SSI, and NOS) only suggest theoretical ideals and do not effectively touch teachers' deeper values and ideals. Basically, the teachers are doing what they
Burns, Gerald
2013-01-01
Solid State Physics, International Edition covers the fundamentals and the advanced concepts of solid state physics. The book is comprised of 18 chapters that tackle a specific aspect of solid state physics. Chapters 1 to 3 discuss the symmetry aspects of crystalline solids, while Chapter 4 covers the application of X-rays in solid state science. Chapter 5 deals with the anisotropic character of crystals. Chapters 6 to 8 talk about the five common types of bonding in solids, while Chapters 9 and 10 cover the free electron theory and band theory. Chapters 11 and 12 discuss the effects of moveme
Multi-equilibrium property of metabolic networks: SSI module
Directory of Open Access Journals (Sweden)
Chen Luonan
2011-06-01
Full Text Available Abstract Background Revealing the multi-equilibrium property of a metabolic network is a fundamental and important topic in systems biology. Due to the complexity of the metabolic network, it is generally a difficult task to study the problem as a whole from both analytical and numerical viewpoint. On the other hand, the structure-oriented modularization idea is a good choice to overcome such a difficulty, i.e. decomposing the network into several basic building blocks and then studying the whole network through investigating the dynamical characteristics of the basic building blocks and their interactions. Single substrate and single product with inhibition (SSI metabolic module is one type of the basic building blocks of metabolic networks, and its multi-equilibrium property has important influence on that of the whole metabolic networks. Results In this paper, we describe what the SSI metabolic module is, characterize the rates of the metabolic reactions by Hill kinetics and give a unified model for SSI modules by using a set of nonlinear ordinary differential equations with multi-variables. Specifically, a sufficient and necessary condition is first given to describe the injectivity of a class of nonlinear systems, and then, the sufficient condition is used to study the multi-equilibrium property of SSI modules. As a main theoretical result, for the SSI modules in which each reaction has no more than one inhibitor, a sufficient condition is derived to rule out multiple equilibria, i.e. the Jacobian matrix of its rate function is nonsingular everywhere. Conclusions In summary, we describe SSI modules and give a general modeling framework based on Hill kinetics, and provide a sufficient condition for ruling out multiple equilibria of a key type of SSI module.
An automatic analyzer of solid state nuclear track detectors using an optic RAM as image sensor
International Nuclear Information System (INIS)
Staderini, E.M.; Castellano, A.
1986-01-01
An optic RAM is a conventional digital random access read/write dynamic memory device featuring a quartz windowed package and memory cells regularly ordered on the chip. Such a device is used as an image sensor because each cell retains data stored in it for a time depending on the intensity of the light incident on the cell itself. The authors have developed a system which uses an optic RAM to acquire and digitize images from electrochemically etched CR39 solid state nuclear track detectors (SSNTD) in the track count rate up to 5000 cm -2 . On the digital image so obtained, a microprocessor, with appropriate software, performs image analysis, filtering, tracks counting and evaluation. (orig.)
20 CFR 416.266 - Continuation of SSI status for Medicaid
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Continuation of SSI status for Medicaid 416... Disabling Impairment § 416.266 Continuation of SSI status for Medicaid If we stop your benefits because of... to be considered an SSI recipient for purposes of eligibility for Medicaid during the time it takes...
"Jazz Ruuler" toob dzhässi Rock Cafesse
2008-01-01
Muhu tulevikumuusika festival "Ju jääb" ja Rock Cafe avavad uue dzhässiürituste sarja "Jazz Ruuler", mille raames soovitakse igal kuul Eesti publiku ette tuua mõni maailma dzhässi tuntud artist. Kontserdist 24. jaan. Rock Cafés
Achieving sub-millimetre precision with a solid-state full-field heterodyning range imaging camera
Dorrington, A. A.; Cree, M. J.; Payne, A. D.; Conroy, R. M.; Carnegie, D. A.
2007-09-01
We have developed a full-field solid-state range imaging system capable of capturing range and intensity data simultaneously for every pixel in a scene with sub-millimetre range precision. The system is based on indirect time-of-flight measurements by heterodyning intensity-modulated illumination with a gain modulation intensified digital video camera. Sub-millimetre precision to beyond 5 m and 2 mm precision out to 12 m has been achieved. In this paper, we describe the new sub-millimetre class range imaging system in detail, and review the important aspects that have been instrumental in achieving high precision ranging. We also present the results of performance characterization experiments and a method of resolving the range ambiguity problem associated with homodyne and heterodyne ranging systems.
Wronski, M; Zhao, W; Tanioka, K; Decrescenzo, G; Rowlands, J A
2012-11-01
The authors are investigating the feasibility of a new type of solid-state x-ray imaging sensor with programmable avalanche gain: scintillator high-gain avalanche rushing photoconductor active matrix flat panel imager (SHARP-AMFPI). The purpose of the present work is to investigate the inherent x-ray detection properties of SHARP and demonstrate its wide dynamic range through programmable gain. A distributed resistive layer (DRL) was developed to maintain stable avalanche gain operation in a solid-state HARP. The signal and noise properties of the HARP-DRL for optical photon detection were investigated as a function of avalanche gain both theoretically and experimentally, and the results were compared with HARP tube (with electron beam readout) used in previous investigations of zero spatial frequency performance of SHARP. For this new investigation, a solid-state SHARP x-ray image sensor was formed by direct optical coupling of the HARP-DRL with a structured cesium iodide (CsI) scintillator. The x-ray sensitivity of this sensor was measured as a function of avalanche gain and the results were compared with the sensitivity of HARP-DRL measured optically. The dynamic range of HARP-DRL with variable avalanche gain was investigated for the entire exposure range encountered in radiography∕fluoroscopy (R∕F) applications. The signal from HARP-DRL as a function of electric field showed stable avalanche gain, and the noise associated with the avalanche process agrees well with theory and previous measurements from a HARP tube. This result indicates that when coupled with CsI for x-ray detection, the additional noise associated with avalanche gain in HARP-DRL is negligible. The x-ray sensitivity measurements using the SHARP sensor produced identical avalanche gain dependence on electric field as the optical measurements with HARP-DRL. Adjusting the avalanche multiplication gain in HARP-DRL enabled a very wide dynamic range which encompassed all clinically relevant
International Nuclear Information System (INIS)
Wronski, M.; Zhao, W.; Tanioka, K.; DeCrescenzo, G.; Rowlands, J. A.
2012-01-01
Purpose: The authors are investigating the feasibility of a new type of solid-state x-ray imaging sensor with programmable avalanche gain: scintillator high-gain avalanche rushing photoconductor active matrix flat panel imager (SHARP-AMFPI). The purpose of the present work is to investigate the inherent x-ray detection properties of SHARP and demonstrate its wide dynamic range through programmable gain. Methods: A distributed resistive layer (DRL) was developed to maintain stable avalanche gain operation in a solid-state HARP. The signal and noise properties of the HARP-DRL for optical photon detection were investigated as a function of avalanche gain both theoretically and experimentally, and the results were compared with HARP tube (with electron beam readout) used in previous investigations of zero spatial frequency performance of SHARP. For this new investigation, a solid-state SHARP x-ray image sensor was formed by direct optical coupling of the HARP-DRL with a structured cesium iodide (CsI) scintillator. The x-ray sensitivity of this sensor was measured as a function of avalanche gain and the results were compared with the sensitivity of HARP-DRL measured optically. The dynamic range of HARP-DRL with variable avalanche gain was investigated for the entire exposure range encountered in radiography/fluoroscopy (R/F) applications. Results: The signal from HARP-DRL as a function of electric field showed stable avalanche gain, and the noise associated with the avalanche process agrees well with theory and previous measurements from a HARP tube. This result indicates that when coupled with CsI for x-ray detection, the additional noise associated with avalanche gain in HARP-DRL is negligible. The x-ray sensitivity measurements using the SHARP sensor produced identical avalanche gain dependence on electric field as the optical measurements with HARP-DRL. Adjusting the avalanche multiplication gain in HARP-DRL enabled a very wide dynamic range which encompassed all
Preliminary field evaluation of solid state cameras for security applications
International Nuclear Information System (INIS)
Murray, D.W.
1987-01-01
Recent developments in solid state imager technology have resulted in a series of compact, lightweight, all-solid-state closed circuit television (CCTV) cameras. Although it is widely known that the various solid state cameras have less light sensitivity and lower resolution than their vacuum tube counterparts, the potential for having a much longer Mean Time Between Failure (MTBF) for the all-solid-state cameras is generating considerable interest within the security community. Questions have been raised as to whether the newest and best of the solid state cameras are a viable alternative to the high maintenance vacuum tube cameras in exterior security applications. To help answer these questions, a series of tests were performed by Sandia National Laboratories at various test sites and under several lighting conditions. The results of these tests as well as a description of the test equipment, test sites, and procedures are presented in this report
Solid-state NMR spectroscopy on complex biomolecules
Renault, M.A.M.; Cukkemane, A.A.; Baldus, M.
2010-01-01
Biomolecular applications of NMR spectroscopy are often merely associated with soluble molecules or magnetic resonance imaging. However, since the late 1970s, solid-state NMR (ssNMR) spectroscopy has demonstrated its ability to provide atomic-level insight into complex biomolecular systems ranging
International Nuclear Information System (INIS)
Green, P.H.; Watson, D.M.
1989-08-01
This report contains brief discussions on work done in the Solid State Division of Oak Ridge National Laboratory. The topics covered are: Theoretical Solid State Physics; Neutron scattering; Physical properties of materials; The synthesis and characterization of materials; Ion beam and laser processing; and Structure of solids and surfaces
Energy Technology Data Exchange (ETDEWEB)
Green, P.H.; Watson, D.M. (eds.)
1989-08-01
This report contains brief discussions on work done in the Solid State Division of Oak Ridge National Laboratory. The topics covered are: Theoretical Solid State Physics; Neutron scattering; Physical properties of materials; The synthesis and characterization of materials; Ion beam and laser processing; and Structure of solids and surfaces. (LSP)
Toward 1-mm depth precision with a solid state full-field range imaging system
Dorrington, Adrian A.; Carnegie, Dale A.; Cree, Michael J.
2006-02-01
Previously, we demonstrated a novel heterodyne based solid-state full-field range-finding imaging system. This system is comprised of modulated LED illumination, a modulated image intensifier, and a digital video camera. A 10 MHz drive is provided with 1 Hz difference between the LEDs and image intensifier. A sequence of images of the resulting beating intensifier output are captured and processed to determine phase and hence distance to the object for each pixel. In a previous publication, we detailed results showing a one-sigma precision of 15 mm to 30 mm (depending on signal strength). Furthermore, we identified the limitations of the system and potential improvements that were expected to result in a range precision in the order of 1 mm. These primarily include increasing the operating frequency and improving optical coupling and sensitivity. In this paper, we report on the implementation of these improvements and the new system characteristics. We also comment on the factors that are important for high precision image ranging and present configuration strategies for best performance. Ranging with sub-millimeter precision is demonstrated by imaging a planar surface and calculating the deviations from a planar fit. The results are also illustrated graphically by imaging a garden gnome.
SNAPSHOT SPECTRAL AND COLOR IMAGING USING A REGULAR DIGITAL CAMERA WITH A MONOCHROMATIC IMAGE SENSOR
Directory of Open Access Journals (Sweden)
J. Hauser
2017-10-01
Full Text Available Spectral imaging (SI refers to the acquisition of the three-dimensional (3D spectral cube of spatial and spectral data of a source object at a limited number of wavelengths in a given wavelength range. Snapshot spectral imaging (SSI refers to the instantaneous acquisition (in a single shot of the spectral cube, a process suitable for fast changing objects. Known SSI devices exhibit large total track length (TTL, weight and production costs and relatively low optical throughput. We present a simple SSI camera based on a regular digital camera with (i an added diffusing and dispersing phase-only static optical element at the entrance pupil (diffuser and (ii tailored compressed sensing (CS methods for digital processing of the diffused and dispersed (DD image recorded on the image sensor. The diffuser is designed to mix the spectral cube data spectrally and spatially and thus to enable convergence in its reconstruction by CS-based algorithms. In addition to performing SSI, this SSI camera is capable to perform color imaging using a monochromatic or gray-scale image sensor without color filter arrays.
Theoretical solid state physics
Haug, Albert
2013-01-01
Theoretical Solid State Physics, Volume 1 focuses on the study of solid state physics. The volume first takes a look at the basic concepts and structures of solid state physics, including potential energies of solids, concept and classification of solids, and crystal structure. The book then explains single-electron approximation wherein the methods for calculating energy bands; electron in the field of crystal atoms; laws of motion of the electrons in solids; and electron statistics are discussed. The text describes general forms of solutions and relationships, including collective electron i
Irwin, E. L.; Farnsworth, D. L.
1972-01-01
A long term investigation of thin film sensors, monolithic photo-field effect transistors, and epitaxially diffused phototransistors and photodiodes to meet requirements to produce acceptable all solid state, electronically scanned imaging system, led to the production of an advanced engineering model camera which employs a 200,000 element phototransistor array (organized in a matrix of 400 rows by 500 columns) to secure resolution comparable to commercial television. The full investigation is described for the period July 1962 through July 1972, and covers the following broad topics in detail: (1) sensor monoliths; (2) fabrication technology; (3) functional theory; (4) system methodology; and (5) deployment profile. A summary of the work and conclusions are given, along with extensive schematic diagrams of the final solid state imaging system product.
International Nuclear Information System (INIS)
Sankaran, A.
2008-01-01
The transition of radiological imaging from analog to digital was closely followed by the development of the Picture Archiving and Communication (PACS) system. Concomitantly, multidimensional imaging ( 4D and 5D, for motion and functional studies on 3D images) have presented new challenges, particularly in handling gigabyte size images from CT, MRI and PET scanners, which generate thousands of images. The storage and analysis of these images necessitate expensive image workstations. This paper highlights the recent innovations in mass storage, display and transfer of images, using miniature/pocket size solid state FLASH and iPOD drives
Solid state radiation dosimetry
International Nuclear Information System (INIS)
Moran, P.R.
1976-01-01
Important recent developments provide accurate, sensitive, and reliable radiation measurements by using solid state radiation dosimetry methods. A review of the basic phenomena, devices, practical limitations, and categories of solid state methods is presented. The primary focus is upon the general physics underlying radiation measurements with solid state devices
Solid state optical microscope
Young, Ian T.
1983-01-01
A solid state optical microscope wherein wide-field and high-resolution images of an object are produced at a rapid rate by utilizing conventional optics with a charge-coupled photodiode array. A galvanometer scanning mirror, for scanning in one of two orthogonal directions is provided, while the charge-coupled photodiode array scans in the other orthogonal direction. Illumination light from the object is incident upon the photodiodes, creating packets of electrons (signals) which are representative of the illuminated object. The signals are then processed, stored in a memory, and finally displayed as a video signal.
Luminescence and the solid state
Ropp, Richard C
2013-01-01
Since the discovery of the transistor in 1948, the study of the solid state has been burgeoning. Recently, cold fusion and the ceramic superconductor have given cause for excitement. There are two approaches possible to this area of science, namely, that of solid state physics and solid state chemistry, although both overlap extensively. The former is more concerned with electronic states in solids (including electromagnetics) whereas the latter is more concerned with interactions of atoms in solids. The area of solid state physics is well documented, however, there are very few texts which de
Influence of different boundary conditions on analysis of SSI
International Nuclear Information System (INIS)
Wang Jiachun
2005-01-01
In the discussions of structural response to earthquakes, it has been assumed that the foundation medium is very stiff and that the seismic motions applied at the structure support points are the same as the free-field earthquake motions at those locations; in other words, the effects of soil structure interaction (SSI) have been neglected. However, its effects can be significant when the structure supported on a soft soil. Structures on the ground are affected by ground motion when there is seismic loading. The inability of the foundation to resist to deformation of soil would cause huge damages on the structures. The different codes and boundary conditions affect on analysis results of SSI. A comparison of the reactor buildings response as predicted by CLASSI and FLUSH shows substantial differences. To absorb, rather than reflect, the outwardly radiated energy, transmitting boundary conditions and soil structure interface should be taken into consideration in analysis of SSI. The paper discusses influence of several different boundary conditions on analysis of SSI. (author)
Image transmission in mid-IR using a solid state laser pumped optical parametric oscillator
Prasad, Narasimha S.; Kratovil, Pat; Magee, James R.
2002-04-01
In this paper, image transmission using a mid-wave IR (MWIR) optical transceiver based free-space data link under low visibility conditions is presented. The all-solid-state MWIR transceiver primarily consisted of a passively Q-switched, short-pulsed Nd:YAG laser pumping a periodically poled lithium niobate (PPLN) based optical parametric oscillator and a Dember effect detector. The MILES transceiver generates pulse position waveforms. The optical data link consisting of transmitter drive electronics, pulse conditioning electronics and a computer generating pulses compatible with the 2400-baud rate RS232 receiver was utilized. Data formatting and RS232 transmission and reception were achieved using a computer. Data formatting transformed an arbitrary image file format compatible with the basic operation of pump laser. Images were transmitted at a date rate of 2400 kbits/sec with 16 bits/pixel. Test images consisting of 50X40 pixels and 100X80 pixels were transmitted through free-space filled with light fog up to 120 ft. Besides optical parametric oscillators, the proposed concept can be extended to optical parametric amplifiers, Raman lasers and other nonlinear optical devices to achieve multi-functionality.
Solid state insurrection how the science of substance made American physics matter
Martin, Joseph D
2018-01-01
Solid state physics—the study of the physical properties of solid matter—was far and away the most populous subfield of Cold War American physics. But despite prolific contributions to consumer and medical technology, such as the transistor and magnetic resonance imaging, it garnered much less professional prestige and public attention than nuclear and particle physics. Solid State Insurrection argues that solid state physics was nonetheless essential to securing the vast social, political, and financial capital Cold War physics enjoyed. Solid state’s technological bent, and its challenge to the “pure science” ideal many physicists cherished, helped physics as a whole respond more readily to Cold War social, political, and economic pressures. Solid state research kept physics economically and technologically relevant, sustaining its lofty cultural standing and policy influence long after the sheen of the Manhattan Project had faded. By placing solid state at the center of the story of twentieth cent...
Effective Strategies To Improve the Employment of SSI/SSDI Participants.
Radtke, Jean, Ed.
This document is for administrators, rehabilitation counselors, and other professionals who support the employment of Social Security Disability Insurance (SSDI) beneficiaries and Supplemental Security Income (SSI) recipients with disabilities. It contains strategies for vocational rehabilitation (VR) programs to improve an SSI or SSDI…
31P NMR imaging of solid bone with solid echoes combined with refocused gradients
International Nuclear Information System (INIS)
Li, L.; Utah Univ., Salt Lake City, UT; Kruger, R.A.
1990-01-01
This note on 31 p NMR imaging presents some observations of the solid echoes acquired from solid bone and how the proposed solid echo imaging method can be employed to obtain the 31 images of solid bone. (UK)
Impact of a surgical site infection (SSI) surveillance program in orthopedics and traumatology.
Mabit, C; Marcheix, P S; Mounier, M; Dijoux, P; Pestourie, N; Bonnevialle, P; Bonnomet, F
2012-10-01
Surveillance of surgical site infections (SSI) is a priority. One of the fundamental principles for the surveillance of SSI is based on receiving effective field feedback (retro-information). The aim of this study was to report the results of a program of SSI surveillance and validate the hypothesis that there is a correlation between creating a SSI surveillance program and a reduction in SSI. The protocol was based on the weekly collection of surveillance data obtained directly from the different information systems in different departments. A delay of 3 months was established before extraction and analysis of data and information from the surgical teams. The NNIS index (National Nosocomial Infections Surveillance System) developed by the American surveillance system and the reduction of length of hospital stay index Journées d'hospitalisation évitées (JHE). Since the end of 2009, 7156 surgical procedures were evaluated (rate of inclusion 97.3%), and 84 SSI were registered with a significant decrease over time from 1.86% to 0.66%. A total of 418 days of hospitalization have been saved since the beginning of the surveillance system. Our surveillance system has three strong points: follow-up is continuous, specifically adapted to orthopedic traumatology and nearly exhaustive. The extraction of data directly from hospital information systems effectively improves the collection of data on surgical procedures. The implementation of a SSI surveillance protocol reduces SSI. Level III. Prospective study. Copyright © 2012 Elsevier Masson SAS. All rights reserved.
Psychometric properties and clinical utility of the Scale for Suicidal Ideation (SSI in adolescents
Directory of Open Access Journals (Sweden)
Ruuttu Titta
2005-02-01
Full Text Available Abstract Background Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. Methods 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Results Cronbach's α for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. Conclusions SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.
Holi, Matti M; Pelkonen, Mirjami; Karlsson, Linnea; Kiviruusu, Olli; Ruuttu, Titta; Heilä, Hannele; Tuisku, Virpi; Marttunen, Mauri
2005-02-03
Accurate assessment of suicidality is of major importance in both clinical and research settings. The Scale for Suicidal Ideation (SSI) is a well-established clinician-rating scale but its suitability to adolescents has not been studied. The aim of this study was to evaluate the reliability and validity, and to test an appropriate cutoff threshold for the SSI in a depressed adolescent outpatient population and controls. 218 adolescent psychiatric outpatient clinic patients suffering from depressive disorders and 200 age- and sex-matched school-attending controls were evaluated by the SSI for presence and severity of suicidal ideation. Internal consistency, discriminative-, concurrent-, and construct validity as well as the screening properties of the SSI were evaluated. Cronbach's alpha for the whole SSI was 0.95. The SSI total score differentiated patients and controls, and increased statistically significantly in classes with increasing severity of suicidality derived from the suicidality items of the K-SADS-PL diagnostic interview. Varimax-rotated principal component analysis of the SSI items yielded three theoretically coherent factors suggesting construct validity. Area under the receiver operating characteristic (ROC) curve was 0.84 for the whole sample and 0.80 for the patient sample. The optimal cutoff threshold for the SSI total score was 3/4 yielding sensitivity of 75% and specificity of 88.9% in this population. SSI appears to be a reliable and a valid measure of suicidal ideation for depressed adolescents.
Directory of Open Access Journals (Sweden)
Patricia Maria Sens
2011-10-01
Full Text Available The Synthetic Sentence Identification (SSI test assesses central auditory pathways by measuring auditory and visual sensitivity and testing selective attention. Cerebellum activation in auditory attention and sensorial activity modulation have already been described. Assessing patients with cerebellar lesions alone using the SSI test can confirm the role of the cerebellum in auditory processing. AIM: To evaluate the role of the cerebellum in auditory processing in individuals with normal hearing and in those with chronic cerebellum lesions, using the SSI test. MATERIALS AND METHODS: Cross-sectional cohort study. A study group comprising 18 patients with chronic cerebellar lesion and a control group of 20 healthy individuals were assessed. The SSI test was applied in an Ipsilateral Competitive Message (ICM and Contralateral Competitive Message (CCM modes. To compare the results between groups, we used the chi-square test for qualitative variables. RESULTS: A statistically significant difference was found between the study and control groups using the ICM mode of the SSI test (p=0.035, but not in the CCM mode (p=0.083. CONCLUSION: The results on the SSI confirmed cerebellar participation in auditory processing in individuals with chronic cerebellar lesions and in those with normal hearing assessed in this study.O teste de Identificação de Sentenças Sintéticas (SSI avalia as vias centrais da audição utilizando a sensibilidade auditiva e visual e testando a atenção seletiva. A ativação do cerebelo na atenção auditiva, assim como na modulação da atividade sensorial, já é descrita. Avaliar pacientes com lesão exclusiva do cerebelo por meio do teste SSI pode confirmar ou refutar a hipótese da participação do cerebelo no processamento auditivo. OBJETIVO: Avaliar pelo teste SSI a participação do cerebelo no processamento auditivo, em indivíduos com lesão crônica do cerebelo e audição normal. MATERIAL E MÉTODOS: Estudo coorte
DoSSiER: Database of Scientific Simulation and Experimental Results
Wenzel, Hans; Genser, Krzysztof; Elvira, Daniel; Pokorski, Witold; Carminati, Federico; Konstantinov, Dmitri; Ribon, Alberto; Folger, Gunter; Dotti, Andrea
2017-01-01
The Geant4, GeantV and GENIE collaborations regularly perform validation and regression tests for simulation results. DoSSiER (Database of Scientific Simulation and Experimental Results) is being developed as a central repository to store the simulation results as well as the experimental data used for validation. DoSSiER can be easily accessed via a web application. In addition, a web service allows for programmatic access to the repository to extract records in json or xml exchange formats. In this article, we describe the functionality and the current status of various components of DoSSiER as well as the technology choices we made.
Energy Technology Data Exchange (ETDEWEB)
Oehlen, Elisabeth
2006-09-15
The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect.
Preliminary field evaluation of solid state cameras for security applications
International Nuclear Information System (INIS)
1987-01-01
Recent developments in solid state imager technology have resulted in a series of compact, lightweight, all-solid-state closed circuit television (CCTV) cameras. Although it is widely known that the various solid state cameras have less light sensitivity and lower resolution than their vacuum tube counterparts, the potential for having a much longer Mean Time Between Failure (MTBF) for the all-solid-state cameras is generating considerable interest within the security community. Questions have been raised as to whether the newest and best of the solid state cameras are a viable alternative to the high maintenance vacuum tube cameras in exterior security applications. To help answer these questions, a series of tests were performed by Sandia National Laboratories at various test sites and under several lighting conditions. In general, all-solid-state cameras need to be improved in four areas before they can be used as wholesale replacements for tube cameras in exterior security applications: resolution, sensitivity, contrast, and smear. However, with careful design some of the higher performance cameras can be used for perimeter security systems, and all of the cameras have applications where they are uniquely qualified. Many of the cameras are well suited for interior assessment and surveillance uses, and several of the cameras are well designed as robotics and machine vision devices
Koechner, Walter
1999-01-01
Solid-State Laser Engineering, written from an industrial perspective, discusses in detail the characteristics, design, construction, and performance of solid-state lasers. Emphasis is placed on engineering and practical considerations; phenomenological aspects using models are preferred to abstract mathematical derivations. This new edition has extensively been updated to account for recent developments in the areas of diode-laser pumping, laser materials, and nonlinear crystals. Walter Koechner received a doctorate in Electrical Engineering from the University of Technology in Vienna, Austria, in 1965. He has published numerous papers in the fields of solid-state physics, optics, and lasers. Dr. Koechner is founder and president of Fibertek, Inc., a research firm specializing in the design, development, and production of advanced solid-state lasers, optical radars, and remote-sensing systems.
Koechner, Walter
1996-01-01
Solid-State Laser Engineering, written from an industrial perspective, discusses in detail the characteristics, design, construction, and performance of solid-state lasers. Emphasis is placed on engineering and practical considerations; phenomenological aspects using models are preferred to abstract mathematical derivations. This new edition has extensively been updated to account for recent developments in the areas of diode-laser pumping, mode locking, ultrashort-pulse generation etc. Walter Koechner received a doctorate in Electrical Engineering from the University of Technology in Vienna, Austria, in 1965. He has published numerous papers in the fields of solid-state physics, optics, and lasers. Dr. Koechner is founder and president of Fibertek, Inc., a research firm specializing in the design, development, and production of advanced solid-state lasers, optical radars, and remote-sensing systems.
20 CFR 416.1816 - Information we need concerning marriage when you apply for SSI.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Information we need concerning marriage when you apply for SSI. 416.1816 Section 416.1816 Employees' Benefits SOCIAL SECURITY ADMINISTRATION....1816 Information we need concerning marriage when you apply for SSI. When you apply for SSI benefits...
Solid state chemistry an introduction
Smart, Lesley E
2012-01-01
""Smart and Moore are engaging writers, providing clear explanations for concepts in solid-state chemistry from the atomic/molecular perspective. The fourth edition is a welcome addition to my bookshelves. … What I like most about Solid State Chemistry is that it gives simple clear descriptions for a large number of interesting materials and correspondingly clear explanations of their applications. Solid State Chemistry could be used for a solid state textbook at the third or fourth year undergraduate level, especially for chemistry programs. It is also a useful resource for beginning graduate
Orton, J W; Walling, J C; Ter Haar, D
1970-01-01
The Solid State Maser presents readings related to solid state maser amplifier from the first tentative theoretical proposals that appeared in the early 1950s to the successful realization of practical devices and their application to satellite communications and radio astronomy almost exactly 10 years later. The book discusses a historical account of the early developments (including that of the ammonia maser) of solid state maser; the properties of paramagnetic ions in crystals; the development of practical low noise amplifiers; and the characteristics of maser devices designed for communica
Hyper- and hyporesponsive mutant forms of the Saccharomyces cerevisiae Ssy1 amino acid sensor
DEFF Research Database (Denmark)
Poulsen, Peter; Gaber, Richard F.; Kielland-Brandt, Morten
2008-01-01
The Saccharomyces cerevisiae integral membrane protein Ssy1p functions with Ssy5p and Ptr3p to sense extracellular amino acids. Signal transduction leads to processing and nuclear localization of Stp1p and Stp2p, transcriptional activators of many amino acid transporter genes. Ssy1p is structural...
Solid state chemistry and its applications
West, Anthony R
2013-01-01
Solid State Chemistry and its Applications, 2nd Edition: Student Edition is an extensive update and sequel to the bestselling textbook Basic Solid State Chemistry, the classic text for undergraduate teaching in solid state chemistry worldwide. Solid state chemistry lies at the heart of many significant scientific advances from recent decades, including the discovery of high-temperature superconductors, new forms of carbon and countless other developments in the synthesis, characterisation and applications of inorganic materials. Looking forward, solid state chemistry will be crucial for the
Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility, December 2010
Social Security Administration — The Supplemental Security Income (SSI) Recipients by Geographic Area, Sex and Eligibility (December 2010) is produced using the data found in Table 10 from the SSI...
NMR imaging of solids with multiple-pulse line narrowing and radiofrequency gradients
International Nuclear Information System (INIS)
Werner, M.H.
1993-01-01
The usual methods of magnetic resonance imaging fail in rigid solids due to the line-shape contributions of dipolar coupling, chemical shift dispersion and anisotropy, and bulk magnetic susceptibility. This dissertation presents a new method of solid-stage imaging by nuclear magnetic resonance which averages away these contributions with multiple-pulse line-narrowing and encodes spatial information with pulsed radiofrequency field gradients. This method is closely related to simultaneously developed methods utilizing pulsed DC gradients, and offers similar improvements in sensitivity and resolution. The advantage of rf gradients is that they can be rapidly switched without inducing eddy currents in the probe or the magnet. In addition, the phases and amplitudes of the rf gradients can be switched by equipment which is already part of an NMR spectrometer capable of solid-state spectroscopy. The line-narrowing and gradient pulses originate in separate rf circuits tuned to the same frequency. Interactions between the circuits have been minimized by a method of active Q-switching which employs PIN diodes in the matching networks of these circuits. Both one- and two-dimensional images are presented. The latter are obtained by a novel method in which the two dimensions of imaging transverse to the static magnetic field are encoded by two orthogonal components of a single rf gradient. A π/2 phase shift of the rf phase relative to that of the line-narrowing pulses selects one component or the other. This arrangement allows the solid-state analogs of versatile imaging sequences based on Fourier imaging and eliminates the need for sample rotation and back-projection methods. Coherent averaging theory is used to analyze this imaging technique and exact numerical simulations on several coupled spins are discussed. These lend insight to the residual linewidth and its dependence on pixel position as well as to the range of applicability of this technique
Einstein and solid-state physics
International Nuclear Information System (INIS)
Aut, I.
1982-01-01
A connection between the development of solid-state physics and the works and activity of Albert Einstein is traced. A tremendous Einstein contribution to solid state physics is marked. A strict establishment of particle-wave dualism; a conclusion about the applicability of the Plank radiation law not only to black body radiation; finding out particles indistinguishability - all three discoveries have a principle significance for solid state physics too
Experience with dedicated ultra fast solid state cardiac gamma camera: technologist perspective
International Nuclear Information System (INIS)
Parab, Anil; Gaikar, Anil; Patil, Kashinath; Lele, V.
2010-01-01
Full text: To describe technologist perspective of working with ultra fast solid state gamma camera and comparison with conventional dual head gamma camera. Material and Methods: 900 Myocardial Perfusion scan were carried out on dedicated solid state detector cardiac camera between 1st February 2010 till 29th August 2010. 27 studies were done back to back on a conventional dual head gamma camera. In 2 cases dual head isotope imaging was done (Thallium+ 99m Tc-tetrofosmin). Rest stress protocol was used in 600 patients and stress - rest protocol was used in 300. 1:3 ratio of injected activity was maintained for both protocols (5 mCi for 1st study and 15 mCi for second study). For Rest - Stress protocol, 5 mCi of 99m Tc - Tetrofosmin was injected at rest, 40 minutes later, 5 min image was acquired on the solid state detector. Patient was then stressed. 15 mCi 99m Tc - Tetrofosmin was injected at peak stress. Images were acquired 20 minutes later for 3 minutes (total duration of study 90-100 min). For stress rest protocol, 5 mCi 99m Tc - Tetrofosmin was injected at peak stress. 5 mCi images were acquired 20 minutes later. Rest injection of 15 mCi was given 1 hour post stress injection. Rest images were acquired 40 minutes after rest injection (total duration of study 110-120 min). Results: We observed even with lesser amount activity and acquisition time of 5 min/cardiac scan it showed high sensitivity count rate over 2.2-4.7 kcps (10 times more counts than standard gamma camera). System gives better energy resolution < 7%. Better image contrast. Dual isotope imaging can be possible. Spatial resolution 4.3-4.9 mm. Excellent quality images were obtained using low activities (5 mCi/15 mCi) using 1/3rd the acquisition time compared to conventional dual head gamma camera Even in obese patients 7 mCi/21 mCi activity yielded excellent images at 1/3 rd acquisition time Quick acquisition resulted in greater patient comfort and no motion artifact also due to non rotation of
Pridham, G J
2013-01-01
Solid-State Circuits provides an introduction to the theory and practice underlying solid-state circuits, laying particular emphasis on field effect transistors and integrated circuits. Topics range from construction and characteristics of semiconductor devices to rectification and power supplies, low-frequency amplifiers, sine- and square-wave oscillators, and high-frequency effects and circuits. Black-box equivalent circuits of bipolar transistors, physical equivalent circuits of bipolar transistors, and equivalent circuits of field effect transistors are also covered. This volume is divided
Alayed, Mrwan; Deen, M Jamal
2017-09-14
Diffuse optical spectroscopy (DOS) and diffuse optical imaging (DOI) are emerging non-invasive imaging modalities that have wide spread potential applications in many fields, particularly for structural and functional imaging in medicine. In this article, we review time-resolved diffuse optical imaging (TR-DOI) systems using solid-state detectors with a special focus on Single-Photon Avalanche Diodes (SPADs) and Silicon Photomultipliers (SiPMs). These TR-DOI systems can be categorized into two types based on the operation mode of the detector (free-running or time-gated). For the TR-DOI prototypes, the physical concepts, main components, figures-of-merit of detectors, and evaluation parameters are described. The performance of TR-DOI prototypes is evaluated according to the parameters used in common protocols to test DOI systems particularly basic instrumental performance (BIP). In addition, the potential features of SPADs and SiPMs to improve TR-DOI systems and expand their applications in the foreseeable future are discussed. Lastly, research challenges and future developments for TR-DOI are discussed for each component in the prototype separately and also for the entire system.
New materials for solid state electrochemistry
International Nuclear Information System (INIS)
Ferloni, P.; Consiglio Nazionale delle Ricerche, Pavia; Magistris, A.; Consiglio Nazionale delle Ricerche, Pavia
1994-01-01
Solid state electrochemistry is an interdisciplinary area, undergoing nowadays a fast development. It is related on the one hand to chemistry, and on the other hand to crystallography, solid state physics and materials science. In this paper structural and electrical properties of some families of new materials interesting for solid state electrochemistry are reviewed. Attention is focused essentially on ceramic and crystalline materials, glasses and polymers, displaying high ionic conductivity and potentially suitable for various applications in solid state electrochemical devices. (orig.)
Theoretical solid state physics
International Nuclear Information System (INIS)
Anon.
1977-01-01
Research activities at ORNL in theoretical solid state physics are described. Topics covered include: surface studies; particle-solid interactions; electronic and magnetic properties; and lattice dynamics
Solid-State Physics Introduction to the Theory
Patterson, James
2010-01-01
Learning Solid State Physics involves a certain degree of maturity, since it involves tying together diverse concepts from many areas of physics. The objective is to understand, in a basic way, how solid materials behave. To do this one needs both a good physical and mathematical background. One definition of Solid State Physics is it is the study of the physical (e.g. the electrical, dielectric, magnetic, elastic, and thermal) properties of solids in terms of basic physical laws. In one sense, Solid State Physics is more like chemistry than some other branches of physics because it focuses on common properties of large classes of materials. It is typical that Solid State Physics emphasizes how physics properties link to electronic structure. We have retained the term Solid Modern solid state physics came of age in the late thirties and forties and is now is part of condensed matter physics which includes liquids, soft materials, and non-crystalline solids. This solid state/condensed matter physics book begin...
Spin imaging in solids using synchronously rotating field gradients and samples
International Nuclear Information System (INIS)
Wind, R.A.; Yannoni, C.S.
1983-01-01
A method for spin-imaging in solids using nuclear magnetic resonance (NMR) spectroscopy is described. With this method, the spin density distribution of a two- or three-dimensional object such as a solid can be constructed resulting in an image of the sample. This method lends itself to computer control to map out an image of the object. This spin-imaging method involves the steps of placing a solid sample in the rf coil field and the external magnetic field of an NMR spectrometer. A magnetic field gradient is superimposed across the sample to provide a field gradient which results in a varying DC field that has different values over different parts of the sample. As a result, nuclei in different parts of the sample have different resonant NMR frequencies. The sample is rotated about an axis which makes a particular angle of 54.7 degrees with the static external magnetic field. The magnetic field gradient which has a spatial distribution related to the sample spinning axis is then rotated synchronously with the sample. Data is then collected while performing a solid state NMR line narrowing procedure. The next step is to change the phase relation between the sample rotation and the field gradient rotation. The data is again collected as before while the sample and field gradient are synchronously rotated. The phase relation is changed a number of times and data collected each time. The spin image of the solid sample is then reconstructed from the collected data
Quantum Computing in Solid State Systems
Ruggiero, B; Granata, C
2006-01-01
The aim of Quantum Computation in Solid State Systems is to report on recent theoretical and experimental results on the macroscopic quantum coherence of mesoscopic systems, as well as on solid state realization of qubits and quantum gates. Particular attention has been given to coherence effects in Josephson devices. Other solid state systems, including quantum dots, optical, ion, and spin devices which exhibit macroscopic quantum coherence are also discussed. Quantum Computation in Solid State Systems discusses experimental implementation of quantum computing and information processing devices, and in particular observations of quantum behavior in several solid state systems. On the theoretical side, the complementary expertise of the contributors provides models of the various structures in connection with the problem of minimizing decoherence.
Harrison, Walter A
2011-01-01
""A well-written text . . . should find a wide readership, especially among graduate students."" - Dr. J. I. Pankove, RCA.The field of solid state theory, including crystallography, semi-conductor physics, and various applications in chemistry and electrical engineering, is highly relevant to many areas of modern science and industry. Professor Harrison's well-known text offers an excellent one-year graduate course in this active and important area of research. While presenting a broad overview of the fundamental concepts and methods of solid state physics, including the basic quantum theory o
Directory of Open Access Journals (Sweden)
Zhishan Yuan
2018-02-01
Full Text Available Abstract Solid-state nanopore has captured the attention of many researchers due to its characteristic of nanoscale. Now, different fabrication methods have been reported, which can be summarized into two broad categories: “top-down” etching technology and “bottom-up” shrinkage technology. Ion track etching method, mask etching method chemical solution etching method, and high-energy particle etching and shrinkage method are exhibited in this report. Besides, we also discussed applications of solid-state nanopore fabrication technology in DNA sequencing, protein detection, and energy conversion.
Solid State Physics Introduction to the Theory
Patterson, James D
2007-01-01
Learning Solid State Physics involves a certain degree of maturity, since it involves tying together diverse concepts from many areas of physics. The objective is to understand, in a basic way, how solid materials behave. To do this one needs both a good physical and mathematical background. One definition of Solid State Physics is it is the study of the physical (e.g. the electrical, dielectric, magnetic, elastic, and thermal) properties of solids in terms of basic physical laws. In one sense, Solid State Physics is more like chemistry than some other branches of physics because it focuses on common properties of large classes of materials. It is typical that Solid State Physics emphasizes how physics properties link to electronic structure. We have retained the term Solid State Physics, even though Condensed Matter Physics is more commonly used. Condensed Matter Physics includes liquids and non-crystalline solids such as glass, which we shall not discuss in detail. Modern Solid State Physics came of age in ...
Solid-state devices and applications
Lewis, Rhys
1971-01-01
Solid-State Devices and Applications is an introduction to the solid-state theory and its devices and applications. The book also presents a summary of all major solid-state devices available, their theory, manufacture, and main applications. The text is divided into three sections. The first part deals with the semiconductor theory and discusses the fundamentals of semiconductors; the kinds of diodes and techniques in their manufacture; the types and modes of operation of bipolar transistors; and the basic principles of unipolar transistors and their difference with bipolar transistors. The s
Solid-state polymeric dye lasers
Singh, S; Sridhar, G; Muthuswamy, V; Raja, K
2003-01-01
This paper presents a review of the organic solid-state polymer materials, which have become established as a new laser media. The photostability of these materials is discussed. Different types of solid-state lasers built around these materials are also reviewed.
49 CFR 1520.15 - SSI disclosed by TSA or the Coast Guard.
2010-10-01
... 49 Transportation 9 2010-10-01 2010-10-01 false SSI disclosed by TSA or the Coast Guard. 1520.15... PROTECTION OF SENSITIVE SECURITY INFORMATION § 1520.15 SSI disclosed by TSA or the Coast Guard. (a) In... available for public inspection or copying, nor does TSA or the Coast Guard release such records to persons...
Dutra, Julio C. V.; da Terzi, Selma C.; Bevilaqua, Juliana Vaz; Damaso, Mônica C. T.; Couri, Sônia; Langone, Marta A. P.; Senna, Lilian F.
The aim of this study was to monitor the biomass growth of Aspergillus niger in solid-state fermentation (SSF) for lipase production using digital image processing technique. The strain A. niger 11T53A14 was cultivated in SSF using wheat bran as support, which was enriched with 0.91% (m/v) of ammonium sulfate. The addition of several vegetable oils (castor, soybean, olive, corn, and palm oils) was investigated to enhance lipase production. The maximum lipase activity was obtained using 2% (m/m) castor oil. In these conditions, the growth was evaluated each 24 h for 5 days by the glycosamine content analysis and digital image processing. Lipase activity was also determined. The results indicated that the digital image process technique can be used to monitor biomass growth in a SSF process and to correlate biomass growth and enzyme activity. In addition, the immobilized esterification lipase activity was determined for the butyl oleate synthesis, with and without 50% v/v hexane, resulting in 650 and 120 U/g, respectively. The enzyme was also used for transesterification of soybean oil and ethanol with maximum yield of 2.4%, after 30 min of reaction.
Dutra, Júlio C V; da C Terzi, Selma; Bevilaqua, Juliana Vaz; Damaso, Mônica C T; Couri, Sônia; Langone, Marta A P; Senna, Lilian F
2008-03-01
The aim of this study was to monitor the biomass growth of Aspergillus niger in solid-state fermentation (SSF) for lipase production using digital image processing technique. The strain A. niger 11T53A14 was cultivated in SSF using wheat bran as support, which was enriched with 0.91% (m/v) of ammonium sulfate. The addition of several vegetable oils (castor, soybean, olive, corn, and palm oils) was investigated to enhance lipase production. The maximum lipase activity was obtained using 2% (m/m) castor oil. In these conditions, the growth was evaluated each 24 h for 5 days by the glycosamine content analysis and digital image processing. Lipase activity was also determined. The results indicated that the digital image process technique can be used to monitor biomass growth in a SSF process and to correlate biomass growth and enzyme activity. In addition, the immobilized esterification lipase activity was determined for the butyl oleate synthesis, with and without 50% v/v hexane, resulting in 650 and 120 U/g, respectively. The enzyme was also used for transesterification of soybean oil and ethanol with maximum yield of 2.4%, after 30 min of reaction.
Forget, Sébastien
2013-01-01
Organic lasers are broadly tunable coherent sources, potentially compact, convenient and manufactured at low-costs. Appeared in the mid 60’s as solid-state alternatives for liquid dye lasers, they recently gained a new dimension after the demonstration of organic semiconductor lasers in the 90's. More recently, new perspectives appeared at the nanoscale, with organic polariton and surface plasmon lasers. After a brief reminder to laser physics, a first chapter exposes what makes organic solid-state organic lasers specific. The laser architectures used in organic lasers are then reviewed, with a state-of-the-art review of the performances of devices with regard to output power, threshold, lifetime, beam quality etc. A survey of the recent trends in the field is given, highlighting the latest developments with a special focus on the challenges remaining for achieving direct electrical pumping of organic semiconductor lasers. A last chapter covers the applications of organic solid-state lasers.
Confidence interval of intrinsic optimum temperature estimated using thermodynamic SSI model
Institute of Scientific and Technical Information of China (English)
Takaya Ikemoto; Issei Kurahashi; Pei-Jian Shi
2013-01-01
The intrinsic optimum temperature for the development of ectotherms is one of the most important factors not only for their physiological processes but also for ecological and evolutional processes.The Sharpe-Schoolfield-Ikemoto (SSI) model succeeded in defining the temperature that can thermodynamically meet the condition that at a particular temperature the probability of an active enzyme reaching its maximum activity is realized.Previously,an algorithm was developed by Ikemoto (Tropical malaria does not mean hot environments.Journal of Medical Entomology,45,963-969) to estimate model parameters,but that program was computationally very time consuming.Now,investigators can use the SSI model more easily because a full automatic computer program was designed by Shi et al.(A modified program for estimating the parameters of the SSI model.Environmental Entomology,40,462-469).However,the statistical significance of the point estimate of the intrinsic optimum temperature for each ectotherm has not yet been determined.Here,we provided a new method for calculating the confidence interval of the estimated intrinsic optimum temperature by modifying the approximate bootstrap confidence intervals method.For this purpose,it was necessary to develop a new program for a faster estimation of the parameters in the SSI model,which we have also done.
High speed real-time wavefront processing system for a solid-state laser system
Liu, Yuan; Yang, Ping; Chen, Shanqiu; Ma, Lifang; Xu, Bing
2008-03-01
A high speed real-time wavefront processing system for a solid-state laser beam cleanup system has been built. This system consists of a core2 Industrial PC (IPC) using Linux and real-time Linux (RT-Linux) operation system (OS), a PCI image grabber, a D/A card. More often than not, the phase aberrations of the output beam from solid-state lasers vary fast with intracavity thermal effects and environmental influence. To compensate the phase aberrations of solid-state lasers successfully, a high speed real-time wavefront processing system is presented. Compared to former systems, this system can improve the speed efficiently. In the new system, the acquisition of image data, the output of control voltage data and the implementation of reconstructor control algorithm are treated as real-time tasks in kernel-space, the display of wavefront information and man-machine conversation are treated as non real-time tasks in user-space. The parallel processing of real-time tasks in Symmetric Multi Processors (SMP) mode is the main strategy of improving the speed. In this paper, the performance and efficiency of this wavefront processing system are analyzed. The opened-loop experimental results show that the sampling frequency of this system is up to 3300Hz, and this system can well deal with phase aberrations from solid-state lasers.
International Nuclear Information System (INIS)
Oehlen, Elisabeth
2006-09-01
The report outlines some fundamental prerequisites concerning SSI:s review of SKB coming applications for an encapsulation facility (according to the act on nuclear activities) and for the complete final disposal system (according to the act on nuclear activities and the environmental code). The report summarize how the SSI look at the decision making process considering radiation protection requirements according to SSI:s regulations and general advices and earlier standpoints regarding SKB:s RandD-programme. The report also describe the present reviewing capacity of SSI and constitute therefore the basis for the planning of SSI:s review organisation in the prospect of coming applications on nuclear waste facilities (encapsulation facility and a deep disposal repository). It should be noted that the report reflects the present situation. Due to a number of factors as for example changes in SKB:s coming RandD-programme, future governmental decisions, adjustments of SSI:s financial resources or new facts in the case, will of course have an effect on how SSI finally will organise the review work. SSI:s home page will continuously be updated with the latest information in this respect
2010-10-01
... SECURITY INFORMATION § 1520.13 Marking SSI. (a) Marking of paper records. In the case of paper records... back cover, including a binder cover or folder, if the document has a front and back cover; (2) Any.... 552 and 49 CFR parts 15 and 1520. (d) Other types of records. In the case of non-paper records that...
Solid-State NMR Study of New Copolymers as Solid Polymer Electrolytes
Directory of Open Access Journals (Sweden)
Jean-Christophe Daigle
2018-01-01
Full Text Available We report the analysis of comb-like polymers by solid-state NMR. The polymers were previously evaluated as solid-polymer-electrolytes (SPE for lithium-polymer-metal batteries that have suitable ionic conductivity at 60 °C. We propose to develop a correlation between 13C solid-state NMR measurements and phase segregation. 13C solid-state NMR is a perfect tool for differentiating polymer phases with fast or slow motions. 7Li was used to monitor the motion of lithium ions in the polymer, and activation energies were calculated.
SSI's review of SKB's RD and D programme 2001
Energy Technology Data Exchange (ETDEWEB)
Hedberg, Bjoern; Larsson, Carl-Magnus; Wiebert, Anders [and others
2002-08-01
In the report SSI's review of SKB's RD and D programme 2001 is presented. In the review SSI comments, among other things, the decision making process, the need for a strategy document, SKB's safety and system analysis and SKB's biosphere studies.
Ben-Haim, Simona; Kacperski, Krzysztof; Hain, Sharon; Van Gramberg, Dean; Hutton, Brian F; Erlandsson, Kjell; Sharir, Tali; Roth, Nathaniel; Waddington, Wendy A; Berman, Daniel S; Ell, Peter J
2010-08-01
We compared simultaneous dual-radionuclide (DR) stress and rest myocardial perfusion imaging (MPI) with a novel solid-state cardiac camera and a conventional SPECT camera with separate stress and rest acquisitions. Of 27 consecutive patients recruited, 24 (64.5+/-11.8 years of age, 16 men) were injected with 74 MBq of (201)Tl (rest) and 250 MBq (99m)Tc-MIBI (stress). Conventional MPI acquisition times for stress and rest are 21 min and 16 min, respectively. Rest (201)Tl for 6 min and simultaneous DR 15-min list mode gated scans were performed on a D-SPECT cardiac scanner. In 11 patients DR D-SPECT was performed first and in 13 patients conventional stress (99m)Tc-MIBI SPECT imaging was performed followed by DR D-SPECT. The DR D-SPECT data were processed using a spill-over and scatter correction method. DR D-SPECT images were compared with rest (201)Tl D-SPECT and with conventional SPECT images by visual analysis employing the 17-segment model and a five-point scale (0 normal, 4 absent) to calculate the summed stress and rest scores. Image quality was assessed on a four-point scale (1 poor, 4 very good) and gut activity was assessed on a four-point scale (0 none, 3 high). Conventional MPI studies were abnormal at stress in 17 patients and at rest in 9 patients. In the 17 abnormal stress studies DR D-SPECT MPI showed 113 abnormal segments and conventional MPI showed 93 abnormal segments. In the nine abnormal rest studies DR D-SPECT showed 45 abnormal segments and conventional MPI showed 48 abnormal segments. The summed stress and rest scores on conventional SPECT and DR D-SPECT were highly correlated (r=0.9790 and 0.9694, respectively). The summed scores of rest (201)Tl D-SPECT and DR-DSPECT were also highly correlated (r=0.9968, pstress perfusion defects were significantly larger on stress DR D-SPECT images, and five of these patients were imaged earlier by D-SPECT than by conventional SPECT. Fast and high-quality simultaneous DR MPI is feasible with D-SPECT in a
International Nuclear Information System (INIS)
Ben-Haim, Simona; Kacperski, Krzysztof; Hain, Sharon; Van Gramberg, Dean; Hutton, Brian F.; Erlandsson, Kjell; Waddington, Wendy A.; Ell, Peter J.; Sharir, Tali; Roth, Nathaniel; Berman, Daniel S.
2010-01-01
We compared simultaneous dual-radionuclide (DR) stress and rest myocardial perfusion imaging (MPI) with a novel solid-state cardiac camera and a conventional SPECT camera with separate stress and rest acquisitions. Of 27 consecutive patients recruited, 24 (64.5±11.8 years of age, 16 men) were injected with 74 MBq of 201 Tl (rest) and 250 MBq 99m Tc-MIBI (stress). Conventional MPI acquisition times for stress and rest are 21 min and 16 min, respectively. Rest 201 Tl for 6 min and simultaneous DR 15-min list mode gated scans were performed on a D-SPECT cardiac scanner. In 11 patients DR D-SPECT was performed first and in 13 patients conventional stress 99m Tc-MIBI SPECT imaging was performed followed by DR D-SPECT. The DR D-SPECT data were processed using a spill-over and scatter correction method. DR D-SPECT images were compared with rest 201 Tl D-SPECT and with conventional SPECT images by visual analysis employing the 17-segment model and a five-point scale (0 normal, 4 absent) to calculate the summed stress and rest scores. Image quality was assessed on a four-point scale (1 poor, 4 very good) and gut activity was assessed on a four-point scale (0 none, 3 high). Conventional MPI studies were abnormal at stress in 17 patients and at rest in 9 patients. In the 17 abnormal stress studies DR D-SPECT MPI showed 113 abnormal segments and conventional MPI showed 93 abnormal segments. In the nine abnormal rest studies DR D-SPECT showed 45 abnormal segments and conventional MPI showed 48 abnormal segments. The summed stress and rest scores on conventional SPECT and DR D-SPECT were highly correlated (r=0.9790 and 0.9694, respectively). The summed scores of rest 201 Tl D-SPECT and DR-DSPECT were also highly correlated (r=0.9968, p 201 Tl D-SPECT acquisition. (orig.)
Solid Lithium Ion Conductors (SLIC) for Lithium Solid State Batteries
National Aeronautics and Space Administration — To identify the most lithium-ion conducting solid electrolytes for lithium solid state batteries from the emerging types of solid electrolytes, based on a...
Crangle, John
1991-01-01
Solid state magnetism is important and attempts to understand magnetic properties have led to an increasingly deep insight into the fundamental make up of solids. Both experimental and theoretical research into magnetism continue to be very active, yet there is still much ground to cover before there can be a full understanding. There is a strong interplay between the developments of materials science and of magnetism. Hundreds of new materials have been dis covered, often with previously unobserved and puzzling magnetic prop erties. A large and growing technology exists that is based on the magnetic properties of materials. Very many devices used in everyday life involve magnetism and new applications are being invented all the time. Under standing the fundamental background to the applications is vital to using and developing them. The aim of this book is to provide a simple, up-to-date introduction to the study of solid state magnetism, both intrinsic and technical. It is designed to meet the needs a...
Preoperative antiseptic skin preparations and reducing SSI.
Al Maqbali, Mohammed Abdullah
Surgical site infection (SSI) can affect the quality of care and increase the morbidity and mortality rate in after-surgical procedure. The use of an antiseptic skin preparation agent before the procedure can reduce the pathogens in the skin surface around the incision. Indicating the type of skin antiseptic preparation could prevent the infection and contamination of the wound. The most commonly used types of skin preparations are chlorhexidine and povidone iodine. However, the antiseptic solutions of both agents are strengthened with alcohol to prevent postoperative wound infection. The aim of this paper is to identify the best antiseptic agent in terms of skin preparation by evaluating the evidence in the literature. The factors associated with choosing the antiseptic skin agent, such as patients' allergies, skin condition and environmental risk, are also taken into account. This review suggests that cholorhexdine with alcohol may be the most effective in terms of reducing SSI.
High-powered, solid-state rf systems
International Nuclear Information System (INIS)
Reid, D.W.
1987-01-01
Over the past two years, the requirement to supply megawatts of rf power for space-based applications at uhf and L-band frequencies has caused dramatic increases in silicon solid-state power capabilities in the frequency range from 10 to 3000 MHz. Radar and communications requirements have caused similar increases in gallium arsenide solid-state power capabilities in the frequency ranges from 3000 to 10,000 MHz. This paper reviews the present state of the art for solid-state rf amplifiers for frequencies from 10 to 10,000 MHz. Information regarding power levels, size, weight, and cost will be given. Technical specifications regarding phase and amplitude stability, efficiency, and system architecture will be discussed. Solid-stage rf amplifier susceptibility to radiation damage will also be examined
Ihlefeld, Jon; Clem, Paul G; Edney, Cynthia; Ingersoll, David; Nagasubramanian, Ganesan; Fenton, Kyle Ross
2014-11-04
The present invention is directed to a higher power, thin film lithium-ion electrolyte on a metallic substrate, enabling mass-produced solid-state lithium batteries. High-temperature thermodynamic equilibrium processing enables co-firing of oxides and base metals, providing a means to integrate the crystalline, lithium-stable, fast lithium-ion conductor lanthanum lithium tantalate (La.sub.1/3-xLi.sub.3xTaO.sub.3) directly with a thin metal foil current collector appropriate for a lithium-free solid-state battery.
Fluidized Bed Reactor as Solid State Fermenter
Directory of Open Access Journals (Sweden)
Krishnaiah, K.
2005-01-01
Full Text Available Various reactors such as tray, packed bed, rotating drum can be used for solid-state fermentation. In this paper the possibility of fluidized bed reactor as solid-state fermenter is considered. The design parameters, which affect the performances are identified and discussed. This information, in general can be used in the design and the development of an efficient fluidized bed solid-state fermenter. However, the objective here is to develop fluidized bed solid-state fermenter for palm kernel cake conversion into enriched animal and poultry feed.
Solid state physics for metallurgists
Weiss, Richard J
2013-01-01
Metal Physics and Physical Metallurgy, Volume 6: Solid State Physics for Metallurgists provides an introduction to the basic understanding of the properties that make materials useful to mankind. This book discusses the electronic structure of matter, which is the domain of solid state physics.Organized into 12 chapters, this volume begins with an overview of the electronic structure of free atoms and the electronic structure of solids. This text then examines the basis of the Bloch theorem, which is the exact periodicity of the potential. Other chapters consider the fundamental assumption in
Solid-State Powered X-band Accelerator
Energy Technology Data Exchange (ETDEWEB)
Othman, Mohamed A.K. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Nann, Emilio A. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Dolgashev, Valery A. [SLAC National Accelerator Lab., Menlo Park, CA (United States); Tantawi, Sami [SLAC National Accelerator Lab., Menlo Park, CA (United States); Neilson, Jeff [SLAC National Accelerator Lab., Menlo Park, CA (United States)
2017-03-06
In this report we disseminate the hot test results of an X-band 100-W solid state amplifier chain for linear accelerator (linac) applications. Solid state power amplifiers have become increasingly attractive solutions for achieving high power in radar and maritime applications. Here the performance of solid state amplifiers when driving an RF cavity is investigated. Commercially available, matched and fully-packaged GaN on SiC HEMTs are utilized, comprising a wideband driver stage and two power stages. The amplifier chain has a high poweradded- efficiency and is able to supply up to ~1.2 MV/m field gradient at 9.2 GHz in a simple test cavity, with a peak power exceeding 100 W. These findings set forth the enabling technology for solid-state powered linacs.
SSI's review of ASAR Oskarshamn 1
International Nuclear Information System (INIS)
Godaas, T.
1995-11-01
Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Oskarshamn 1. The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs
Energy Technology Data Exchange (ETDEWEB)
Larsson, Carl-Magnus; Hedberg, Bjoern; Wiebert, Anders [and others
2005-06-01
In this report the Swedish Radiation Protection Authority's (SSI) review of the Swedish Nuclear Fuel and Waste Management Company's (SKB) RDandD programme 2004 is presented. In the review SSI comments, among other things, SKB's plan of action and future direction of SKB's RDandD programme, need for different types of consultations, plans for demonstration of canister deposition and long term experiments, and strategies for dismantling of nuclear facilities.
Kolstein, M.; De Lorenzo, G.; Mikhaylova, E.; Chmeissani, M.; Ariño, G.; Calderón, Y.; Ozsahin, I.; Uzun, D.
2013-04-01
The Voxel Imaging PET (VIP) Pathfinder project intends to show the advantages of using pixelated solid-state technology for nuclear medicine applications. It proposes designs for Positron Emission Tomography (PET), Positron Emission Mammography (PEM) and Compton gamma camera detectors with a large number of signal channels (of the order of 106). For PET scanners, conventional algorithms like Filtered Back-Projection (FBP) and Ordered Subset Expectation Maximization (OSEM) are straightforward to use and give good results. However, FBP presents difficulties for detectors with limited angular coverage like PEM and Compton gamma cameras, whereas OSEM has an impractically large time and memory consumption for a Compton gamma camera with a large number of channels. In this article, the Origin Ensemble (OE) algorithm is evaluated as an alternative algorithm for image reconstruction. Monte Carlo simulations of the PET design are used to compare the performance of OE, FBP and OSEM in terms of the bias, variance and average mean squared error (MSE) image quality metrics. For the PEM and Compton camera designs, results obtained with OE are presented.
Hirave, Vivek; Kalyanshetti, Mahesh
2018-02-01
Conventional fixed-base analysis ignoring the effect of soil-flexibility may result in unsafe design. Therefore, to evaluate the realistic behavior of structure the soil structure interaction (SSI) effect shall be incorporated in the analysis. In seismic analysis, provision of bracing system is one of the important option for the structure to have sufficient strength with adequate stiffness to resist lateral forces. The different configuration of these bracing systems alters the response of buildings, and therefore, it is important to evaluate the most effective bracing systems in view point of stability against SSI effect. In present study, three RC building frames, G+3, G+5 and G+7 and their respective scaled down steel model with two types of steel bracing system incorporating the effect of soil flexibility is considered for experimental and analytical study. The analytical study is carried out using Elastic continuum approach and the experimental study is carried out using Shake Table. The influence of SSI on various seismic parameters is presented. The study reveals that, steel bracing system is beneficial to control SSI effect and it is observed that V bracing is more effective, in resisting seismic load considering SSI.
Püssi plaat saab 30aastaseks / Gerli Romanovitsh
Romanovitš, Gerli, 1977-
2004-01-01
Ilmunud ka: Severnoje Poberezhje, 22. dets. 2004, lk. 4. Aasta aega Šveitsi investeerimisfirmale Sorbes AG kuulunud Püssi Repo Vabrikud tähistab puitlaastvabrikute kombinaadi 30. sünnipäeva. Praegu toodetakse 170 000 m3 puitlaastplaati aastas
Directory of Open Access Journals (Sweden)
A. Arifi
2016-07-01
Full Text Available Surgical site infection (SSI, is a preventable and devastating complication with significant morbidity after cardiac surgery. The reported SSI rate at our center, ranging from 3.4% to 11.2% (2007–2013. This rate is considered to be above the standardized rate recommended by the NHSN. Quality improvement project team to address the issue of SSI, (SCIP, where formed by the medical administration late 2014. The aim of the study was to identify SSI risk factors at our cardiac surgical unit, using evidence based practices while taking a local approach to problem solving. We performed Root Cause Analysis (RCA, and we applied other quality improvement tools to identify the area for potential improvement. Data include a Process Map of the pre-operative, intra-operative and post-operative factors that might contribute to SSI risk. We prospectively used the RCA form to investigate all the stages of the patient process map (pre, intra op, and post operatively. The data included the Patient related factors, the sterilization and the hygiene practice in the operating room, and the operating room traffic, and the compliance to the bundle of care. Figure represent the “Fishbone” diagram of the possible causes of SSI after cardiac surgery in our unit. Demographic features of patients with SSI were as follows: mean age-65 years; female 83%; time to infection (mean 101 days; range 1–36 days;. The root cause analysis identified a significant weakness in the compliance to the bundle of care to prevent SSI. Furthermore, the patient flow, the operating theatre cleaning and traffic was also identified as a contributing factor to SSI. Surgical site infection after cardiac surgery is a preventable complication. The application of the evidence based practice and structured way of thinking in problem solving, will help identify the potential risk factors. Focusing on solving the right patient process and visually represents the problem will help identifying the
FT4 Data Analysis Summary (SSI-ARC)
Isaacson, Douglas R.; Gong, Chester; Reardon, Scott Edward; Santiago, Confesor
2016-01-01
Standards for Unmanned Aircraft System (UAS) Detect-and-Avoid (DAA) systems are currently being developed under the auspices of the RTCA Special Committee 228 (SC-228). To support the development of these standards, a series of flight tests has been conducted at NASAs Armstrong Flight Research Center (NASA-AFRC). The fourth in this series of flight test activities (Flight Test 4, or simply FT4) was conducted during the Spring and Summer of 2016. FT4 supported the objectives of numerous organizations working toward UAS DAA Minimum Operational Performance Standards (MOPS) and UAS DAA Radar MOPS. The summary provided herein is limited to the objectives, analysis and conclusions of the NASA Ames Research Center (NASA-ARC) SSI team toward the refinement of UAS DAA MOPS. This document provides a high-level overview of FT4 and the SSI-ARC objectives, a summary of the data analysis methodology and recommendations for UAS DAA MOPS refinements based on the data analysis results. A total of 72 encounters were flown to support SSI-ARC objectives. Test results were generally consistent with acceptable UAS DAA system performance and will be considered in broader SC-228 requirements validation efforts. Observed alert lead times indicated acceptable UAS DAA alerting performance. Effective interoperability between the UAS DAA system and the Traffic Alert and Collision Avoidance System (TCAS) was observed with one notable exception: TCAS Resolutions Advisories (RA) were observed in the absence of any DAA alert on two occasions, indicating the need for alert parameter refinement. Findings further indicated the need for continued work in the areas of DAA Well Clear Recovery logic and alert stability for Mode-C-only intruders. Finally, results demonstrated a high level of compliance with a set of evaluation criteria designed to provide anecdotal evidence of acceptable UAS DAA system performance.
International Nuclear Information System (INIS)
Ferrini, Gabriele; Giannetti, Claudio; Pagliara, Stefania; Banfi, Francesco; Galimberti, Gianluca; Parmigiani, Fulvio
2005-01-01
Image potential states are populated through indirect, scattering-mediated multiphoton absorption induced by femtosecond laser pulses and revealed by single-photon photoemission. The measured effective mass is significantly different from that obtained with direct, resonant population. These features reveal a strong coupling of the electrons residing in the image potential state, outside the solid, with the underlying hot electron population created by the laser pulse. The coupling is mediated by a many-body scattering interaction between the image potential state electrons and bulk electrons in highly excited states
Sensitivity Study of Poisson's Ratio Used in Soil Structure Interaction (SSI) Analyses
International Nuclear Information System (INIS)
Han, Seung-ju; You, Dong-Hyun; Jang, Jung-bum; Yun, Kwan-hee
2016-01-01
The preliminary review for Design Certification (DC) of APR1400 was accepted by NRC on March 4, 2015. After the acceptance of the application for standard DC of APR1400, KHNP has responded the Request for Additional Information (RAI) raised by NRC to undertake a full design certification review. Design certification is achieved through the NRC's rulemaking process, and is founded on the staff's review of the application, which addresses the various safety issues associated with the proposed nuclear power plant design, independent of a specific site. The USNRC issued RAIs pertain to Design Control Document (DCD) Ch.3.7 'Seismic Design' is DCD Tables 3.7A-1 and 3.7A-2 show Poisson’s ratios in the S1 and S2 soil profiles used for SSI analysis as great as 0.47 and 0.48 respectively. Based on staff experience, use of Poisson's ratio approaching these values may result in numerical instability of the SSI analysis results. Sensitivity study is performed using the ACS SASSI NI model of APR1400 with S1 and S2 soil profiles to demonstrate that the Poisson’s ratio values used in the SSI analyses of S1 and S2 soil profile cases do not produce numerical instabilities in the SSI analysis results. No abrupt changes or spurious peaks, which tend to indicate existence of numerical sensitivities in the SASSI solutions, appear in the computed transfer functions of the original SSI analyses that have the maximum dynamic Poisson’s ratio values of 0.47 and 0.48 as well as in the re-computed transfer functions that have the maximum dynamic Poisson’s ratio values limited to 0.42 and 0.45
Solid-state lighting-a benevolent technology
International Nuclear Information System (INIS)
Schubert, E Fred; Kim, Jong Kyu; Luo Hong; Xi, J-Q
2006-01-01
Solid-state light sources are in the process of profoundly changing the way humans generate light for general lighting applications. Solid-state light sources possess two highly desirable features, which set them apart from most other light sources: (i) they have the potential to create light with essentially unit power efficiency and (ii) the properties of light, such as spectral composition and temporal modulation, can be controlled to a degree that is not possible with conventional light sources such as incandescent and fluorescent lamps. The implications are enormous and, as a consequence, many positive developments are to be expected including a reduction in global energy consumption, reduction of global-warming-gas and pollutant emissions and a multitude of new functionalities benefiting numerous applications. This review will assess the impact of solid-state lighting technology on energy consumption, the environment and on emerging application fields that make use of the controllability afforded by solid-state sources. The review will also discuss technical areas that fuel continued progress in solid-state lighting. Specifically, we will review the use of novel phosphor distributions in white light-emitting diodes (LEDs) and show the strong influence of phosphor distribution on efficiency. We will also review the use of reflectors in LEDs with emphasis on 'perfect' reflectors, i.e. reflectors with highly reflective omni-directional characteristics. Finally, we will discuss a new class of thin-film materials with an unprecedented low refractive index. Such low-n materials may strongly contribute to the continuous progress in solid-state lighting
Two dimensional solid state NMR
International Nuclear Information System (INIS)
Kentgens, A.P.M.
1987-01-01
This thesis illustrates, by discussing some existing and newly developed 2D solid state experiments, that two-dimensional NMR of solids is a useful and important extension of NMR techniques. Chapter 1 gives an overview of spin interactions and averaging techniques important in solid state NMR. As 2D NMR is already an established technique in solutions, only the basics of two dimensional NMR are presented in chapter 2, with an emphasis on the aspects important for solid spectra. The following chapters discuss the theoretical background and applications of specific 2D solid state experiments. An application of 2D-J resolved NMR, analogous to J-resolved spectroscopy in solutions, to natural rubber is given in chapter 3. In chapter 4 the anisotropic chemical shift is mapped out against the heteronuclear dipolar interaction to obtain information about the orientation of the shielding tensor in poly-(oxymethylene). Chapter 5 concentrates on the study of super-slow molecular motions in polymers using a variant of the 2D exchange experiment developed by us. Finally chapter 6 discusses a new experiment, 2D nutation NMR, which makes it possible to study the quadrupole interaction of half-integer spins. 230 refs.; 48 figs.; 8 tabs
Macroscopic modelling of solid-state fermentation
Hoogschagen, M.J.
2007-01-01
Solid-state fermentation is different from the more well known process of liquid fermentation because no free flowing water is present. The technique is primarily used in Asia. Well-known products are the foods tempe, soy sauce and saké. In industrial solid-state fermentation, the substrate usually
The Implement of a Multi-layer Frozen Soil Scheme into SSiB3 and its Evaluation over Cold Regions
Li, Q.
2016-12-01
The SSiB3 is a biophysics-based model of land-atmosphere interactions and is designed for global and regional studies. It has three soil layers, three snow layers, as well as one vegetation layer. Soil moisture of the three soil layers, interception water store for the canopy, subsurface soil temperature, ground temperature, canopy temperature and snow water equivalent are all predicted based on the water and energy balance at canopy, soil and snow. SSiB3 substantially enhances the model's capability for cold season studies and produces reasonable results compared with observations. However, frozen soil processes are ignored in the SSiB3 and may have effects on the interannual variability of soil temperature and deep soil memory. A multi-layer comprehensive frozen soil scheme (FSM), which is developed for climate study has been implemented into the SSiB3 to describe soil heat transfer and water flow affected by frozen processed in soil. In the coupled SSiB3-FSM, both liquid water and ice content have been taken into account in the frozen soil hydrologic and thermal property parameterization. The maximum soil layer depth could reach 10 meters thick depending on land conditions. To better evaluate the models' performance, the coupled offline SSiB3-FSM and SSiB3 have been driven from 1948 to 1958 by the Princeton global meteorological data set, respectively. For the 10yrs run, the coupled SSiB3-FSM almost captures the features over different regions, especially cold regions. In order to analysis and compare the differences of SSIB3-FSM and SSIB3 in detail, monthly mean surface temperature for different regions are compared with CAMS data. The statistical results of surface skin temperature show that high latitude regions, Africa, Eastern Australia, and North American monsoon regions have been greatly improved in SSIB3-FSM. For the global statistics, the RMSE of the surface temperature simulated by SSiB3-FSM can be improved about 0.6K compared to SSiB3. In this study
SU-D-209-01: Can Fluoroscopic Air-Kerma Rates Be Reliably Measured with Solid-State Meters?
International Nuclear Information System (INIS)
Feng, C; Thai, L; Wagner, L; Ozus, B
2016-01-01
Purpose: Ionization chambers remain the standard for calibration of air-kerma rate measuring devices. Despite their strong energy-dependent response, solid state radiation detectors are increasingly used, primarily due to their efficiency in making standardized measurements. To test the reliability of these devices in measuring air-kerma rates, we compared ion chambers measurements with solid-state measurements for various mobile fluoroscopes operated at different beam qualities and air-kerma rates. Methods: Six mobile fluoroscopes (GE OEC models 9800 and 9900) were used to generate test beams. Using various field sizes and dose rate controls, copper attenuators and a lead attenuator were placed at the image receptor in varying combinations to generate a range of air-kerma rates. Air-kerma rates at 30 centimeters from the image receptors were measured using two 6-cm"3 ion chambers with electrometers (Radcal, models 1015 and 9015) and two with solid state detectors (Unfors Xi and Raysafe X2). No error messages occurred during measurements. However, about two months later, one solid-state device stopped working and was replaced by the manufacturer. Two out of six mobile fluoroscopic units were retested with the replacement unit. Results: Generally, solid state and ionization chambers agreed favorably well, with two exceptions. Before replacement of the detector, the Xi meter when set in the “RF High” mode deviated from ion chamber readings by factors of 2 and 10 with no message indicating error in measurement. When set in the “RF Low” mode, readings were within −4% to +3%. The replacement Xi detector displayed messages alerting the user when settings were not compatible with air-kerma rates. Conclusion: Air-kerma rates can be measured favorably well using solid-state devices, but users must be aware of the possibility that readings can be grossly in error with no discernible indication for the deviation.
SU-D-209-01: Can Fluoroscopic Air-Kerma Rates Be Reliably Measured with Solid-State Meters?
Energy Technology Data Exchange (ETDEWEB)
Feng, C; Thai, L; Wagner, L [The University of Texas Health Science Center at Houston, Houston, TX (United States); Ozus, B [CHI St Luke’s Health, Baylor St Luke’s Medical Center, Houston, TX (United States)
2016-06-15
Purpose: Ionization chambers remain the standard for calibration of air-kerma rate measuring devices. Despite their strong energy-dependent response, solid state radiation detectors are increasingly used, primarily due to their efficiency in making standardized measurements. To test the reliability of these devices in measuring air-kerma rates, we compared ion chambers measurements with solid-state measurements for various mobile fluoroscopes operated at different beam qualities and air-kerma rates. Methods: Six mobile fluoroscopes (GE OEC models 9800 and 9900) were used to generate test beams. Using various field sizes and dose rate controls, copper attenuators and a lead attenuator were placed at the image receptor in varying combinations to generate a range of air-kerma rates. Air-kerma rates at 30 centimeters from the image receptors were measured using two 6-cm{sup 3} ion chambers with electrometers (Radcal, models 1015 and 9015) and two with solid state detectors (Unfors Xi and Raysafe X2). No error messages occurred during measurements. However, about two months later, one solid-state device stopped working and was replaced by the manufacturer. Two out of six mobile fluoroscopic units were retested with the replacement unit. Results: Generally, solid state and ionization chambers agreed favorably well, with two exceptions. Before replacement of the detector, the Xi meter when set in the “RF High” mode deviated from ion chamber readings by factors of 2 and 10 with no message indicating error in measurement. When set in the “RF Low” mode, readings were within −4% to +3%. The replacement Xi detector displayed messages alerting the user when settings were not compatible with air-kerma rates. Conclusion: Air-kerma rates can be measured favorably well using solid-state devices, but users must be aware of the possibility that readings can be grossly in error with no discernible indication for the deviation.
ANTIMICROBIAL SUSCEPTIBILITY PATTERN OF ORGANISMS CAUSING SURGICAL SITE INFECTIONS (SSI
Directory of Open Access Journals (Sweden)
Rohini Murlidhar Gajbhiye
2017-02-01
Full Text Available BACKGROUND CDC defines surgical site infection as ‘Infections related to operative procedure that occurs at or near surgical incision within 30 days of operative procedure or within one year if the implant is left in situ’. Surgical site infection (SSI is 3 rd most frequently reported nosocomial infection (12%-16% as per National Nosocomial Infection Surveillance (NNIS. The aim of this study was to investigate the antimicrobial susceptibility pattern of organisms causing SSI. MATERIALS AND METHODS During a two year study period in a tertiary care hospital, 19,127 patients underwent surgeries in various surgical departments. Of these 517 (2.7% developed surgical site infection. The surgical wounds were classified by CDC & NNIS criteria into 4 classes. Two wound swabs were taken and processed by standard microbiological techniques. Antimicrobial susceptibility along with testing of ESBLs, MBLs, AmpCβ lactamases was done for all isolates causing SSI. RESULTS Among 19,127 patients, 517 (2.7% developed SSI. It was highest in patients of perforation peritonitis (11.99%.Among 517 specimens, 340 (65.76% showed growth and 177 (34.23% were culture negative. E.coli (23.33% was the commonest organism isolated followed by Acinetobacter spp. (16%, Klebsiella spp. (15.66%, Pseudomonas spp. (15.33%, S. aureus (10.33%, S. epidermidis(7.3%, Proteus spp. (6.00% and Citrobacter spp. (2.66%.Staphylococcus spp. were 100 % sensitive to Vancomycin & Linezolid. (27.5% S. aureus were MRSA and (17.5% were Inducible Clindamycin resistant (ICR. Enterobacteriaceae isolates showed maximum sensitivity towards Imipenem, Piperacillin-Tazobactam and Amikacin. Klebsiella spp. (40.62%, E.coli (35.89%, Citrobacter spp. (33.33%, Proteus spp. (26.08% were ESBL producers. Klebsiella spp. (17.18%, E.coli (10.25%, Proteus spp. (11.11% and Citrobacter spp. (8.69% were AmpC producers. Acinetobacter spp. (28.57% was commonest MBL producer followed by Klebsiella spp. (20
Solid State Photovoltaic Research Branch
Energy Technology Data Exchange (ETDEWEB)
1990-09-01
This report summarizes the progress of the Solid State Photovoltaic Research Branch of the Solar Energy Research Institute (SERI) from October 1, 1988, through September 30,l 1989. Six technical sections of the report cover these main areas of SERIs in-house research: Semiconductor Crystal Growth, Amorphous Silicon Research, Polycrystalline Thin Films, III-V High-Efficiency Photovoltaic Cells, Solid-State Theory, and Laser Raman and Luminescence Spectroscopy. Sections have been indexed separately for inclusion on the data base.
Environmental performance evaluation of an advanced-design solid-state television camera
1979-01-01
The development of an advanced-design black-and-white solid-state television camera which can survive exposure to space environmental conditions was undertaken. A 380 x 488 element buried-channel CCD is utilized as the image sensor to ensure compatibility with 525-line transmission and display equipment. Specific camera design approaches selected for study and analysis included: (1) component and circuit sensitivity to temperature; (2) circuit board thermal and mechanical design; and (3) CCD temperature control. Preferred approaches were determined and integrated into the final design for two deliverable solid-state TV cameras. One of these cameras was subjected to environmental tests to determine stress limits for exposure to vibration, shock, acceleration, and temperature-vacuum conditions. These tests indicate performance at the design goal limits can be achieved for most of the specified conditions.
Glendening, Zachary S; McCauley, Erin; Shinn, Marybeth; Brown, Scott R
2018-04-01
Though disability and housing instability are discussed separately in public health literature, few studies address families at their intersection. As a result, little is known about families who experience both homelessness and disability, how many receive disability benefits like SSI and SSDI, or the influence of those benefits on health-promoting outcomes like housing stability and self-sufficiency. Moreover, no previous research compares the ability of different housing and service interventions to increase disability benefit access. We examine relationships between disabilities and SSI/SSDI income reported when families enter emergency shelters and later health-promoting outcomes (housing stability and self-sufficiency) and how housing interventions affect SSI/SSDI receipt. Families in the (name removed) Study (N = 1857) were interviewed in emergency shelters, randomly offered of one of three housing interventions or usual care (i.e., no immediate referral to any intervention beyond shelter), and re-interviewed 20 months later. A third of families reported a disability at shelter entry. SSI/SSDI coverage of these families increased nearly 10% points over 20 months but never exceeded 40%. Disabilities predicted greater housing instability, food insecurity, and economic stress and less work and income. Among families reporting disabilities, SSI/SSDI receipt predicted fewer returns to emergency shelter, and more income despite less work. Offers of long-term housing subsidies increased SSI/SSDI receipt. Many families experiencing homelessness have disabilities; those receiving SSI/SSDI benefits have better housing and income outcomes. Providing families experiencing homelessness with long-term housing subsidies and SSI/SSDI could improve public health. Copyright © 2017 Elsevier Inc. All rights reserved.
The SSI reviews of the SKB research programs 1992
International Nuclear Information System (INIS)
Jensen, Mikael.
1993-02-01
The Swedish Radiation Protection Institute (SSI) has scrutinized the research programs 1992 of the Swedish Nuclear Fuel and Waste Management Co (SKB). The judgement is that SKB has both the competence and resources to perform the presented research programs
2011-01-05
... also were concerned that paying SSI in installments could distress SSI recipients. These commenters... increase an installment payment. Congress itemized certain outstanding debts relating to food, clothing... authority to make exceptions of this type. We can only approve impairment-related expenses. Comment: Several...
Solid-state NMR basic principles and practice
Apperley, David C; Hodgkinson, Paul
2014-01-01
Nuclear Magnetic Resonance (NMR) has proved to be a uniquely powerful and versatile tool for analyzing and characterizing chemicals and materials of all kinds. This book focuses on the latest developments and applications for "solid-state" NMR, which has found new uses from archaeology to crystallography to biomaterials and pharmaceutical science research. The book will provide materials engineers, analytical chemists, and physicists, in and out of lab, a survey of the techniques and the essential tools of solid-state NMR, together with a practical guide on applications. In this concise introduction to the growing field of solid-state nuclear magnetic resonance spectroscopy The reader will find: * Basic NMR concepts for solids, including guidance on the spin-1/2 nuclei concept * Coverage of the quantum mechanics aspects of solid state NMR and an introduction to the concept of quadrupolar nuclei * An understanding relaxation, exchange and quantitation in NMR * An analysis and interpretation of NMR data, with e...
Photoemission from solids: the transition from solid-state to atomic physics
International Nuclear Information System (INIS)
Shirley, D.A.
1980-08-01
As the photon energy is increased, photoemission from solids undergoes a slow transition from solid-state to atomic behavior. However, throughout the energy range hν = 10 to 1000 eV or higher both types of phenomena are present. Thus angle-resolved photoemission can only be understood quantitatively if each experimenter recognizes the presence of band-structure, photoelectron diffraction, and photoelectron asymmetry effects. The quest for this understanding will build some interesting bridges between solid-state and atomic physics and should also yield important new insights about the phenomena associated with photoemission
Lithium-ion transport in inorganic solid state electrolyte
International Nuclear Information System (INIS)
Gao Jian; Li Hong; Zhao Yu-Sheng; Shi Si-Qi
2016-01-01
An overview of ion transport in lithium-ion inorganic solid state electrolytes is presented, aimed at exploring and designing better electrolyte materials. Ionic conductivity is one of the most important indices of the performance of inorganic solid state electrolytes. The general definition of solid state electrolytes is presented in terms of their role in a working cell (to convey ions while isolate electrons), and the history of solid electrolyte development is briefly summarized. Ways of using the available theoretical models and experimental methods to characterize lithium-ion transport in solid state electrolytes are systematically introduced. Then the various factors that affect ionic conductivity are itemized, including mainly structural disorder, composite materials and interface effects between a solid electrolyte and an electrode. Finally, strategies for future material systems, for synthesis and characterization methods, and for theory and calculation are proposed, aiming to help accelerate the design and development of new solid electrolytes. (topical review)
SSI's review of ASAR Ringhals 2, 1994
International Nuclear Information System (INIS)
Hofvander, P.
1995-11-01
Swedish nuclear power reactors are subject to periodic safety reviews, ASAR. Parts of ASAR deal with questions concerning radiation protection and are therefore submitted to a review performed by the Swedish Radiation Protection Institute. This report consists of SSI's review of ASAR Ringhals 2, 1994 . The following areas have been included in this review: Organisation, education, occupational exposures, effluents and discharges, emergency preparedness. 13 figs
Advances in Solid State Physics
Haug, Rolf
2008-01-01
The present volume 47 of the Advances in Solid State Physics contains the written version of a large number of the invited talks of the 2007 Spring Meeting of the Arbeitskreis Festkörperphysik which was held in Regensburg, Germany, from March 26 to 30, 2007 in conjunction with the 71st Annual Meeting of the Deutsche Physikalische Gesellschaft.It gives an overview of the present status of solid state physics where low-dimensional systems such as quantum dots and quantum wires are dominating. The importance of magnetic materials is reflected by the large number of contributions in the part dealing with ferromagnetic films and particles. One of the most exciting achievements of the last couple of years is the successful application of electrical contacts to and the investigation of single layers of graphene. This exciting physics is covered in Part IV of this book. Terahertz physics is another rapidly moving field which is presented here by five contributions. Achievements in solid state physics are only rarely...
International Nuclear Information System (INIS)
Wang, Biqiong; Liu, Jian; Sun, Qian; Li, Ruying; Sun, Xueliang; Sham, Tsun-Kong
2014-01-01
Atomic layer deposition (ALD) has been shown as a powerful technique to build three-dimensional (3D) all-solid-state microbattery, because of its unique advantages in fabricating uniform and pinhole-free thin films in 3D structures. The development of solid-state electrolyte by ALD is a crucial step to achieve the fabrication of 3D all-solid-state microbattery by ALD. In this work, lithium phosphate solid-state electrolytes were grown by ALD at four different temperatures (250, 275, 300, and 325 °C) using two precursors (lithium tert-butoxide and trimethylphosphate). A linear dependence of film thickness on ALD cycle number was observed and uniform growth was achieved at all four temperatures. The growth rate was 0.57, 0.66, 0.69, and 0.72 Å/cycle at deposition temperatures of 250, 275, 300, and 325 °C, respectively. Furthermore, x-ray photoelectron spectroscopy confirmed the compositions and chemical structures of lithium phosphates deposited by ALD. Moreover, the lithium phosphate thin films deposited at 300 °C presented the highest ionic conductivity of 1.73 × 10 −8 S cm −1 at 323 K with ∼0.51 eV activation energy based on the electrochemical impedance spectroscopy. The ionic conductivity was calculated to be 3.3 × 10 −8 S cm −1 at 26 °C (299 K). (paper)
Gordon, John Howard [Salt Lake City, UT; Taylor, Dale M [Murray, UT
2011-06-07
Solid-state membrane modules comprising at least one membrane unit, where the membrane unit has a dense mixed conducting oxide layer, and at least one conduit or manifold wherein the conduit or manifold comprises a dense layer and at least one of a porous layer and a slotted layer contiguous with the dense layer. The solid-state membrane modules may be used to carry out a variety of processes including the separating of any ionizable component from a feedstream wherein such ionizable component is capable of being transported through a dense mixed conducting oxide layer of the membrane units making up the membrane modules. For ease of construction, the membrane units may be planar.
Energy Technology Data Exchange (ETDEWEB)
Dverstorp, Bjorrn
2007-09-15
This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009.
Oriented solid-state NMR spectrosocpy
DEFF Research Database (Denmark)
Bertelsen, Kresten
This thesis is concerned with driving forward oriented solid-state NMR spectroscopy as a viable technique for studying peptides in membrane bilayers. I will show that structural heterogeneity is an intrinsic part of the peptide/lipid system and that NMR can be used to characterize static...... and dynamic structural features of the peptides and its local surroundings. In fact one need to take into account the dynamical features of the system in order to correctly predict the structure from oriented solid-state NMR spectra. ...
An X-ray computed tomography demonstrator using a CZT solid-state detector
International Nuclear Information System (INIS)
Claesson, Th.; Kerek, A.; Molnar, J.; Novak, D.
2002-01-01
A demonstrator of Computed Tomography (CT) has been designed and built for educational purposes. The system is based on a solid-state CdZnTe detector and a standard PC. The mechanics of the system is controlled and data is acquired by programs written in LabVIEW. CT images are reconstructed using MATLAB programs
Solid State Lighting Reliability Components to Systems
Fan, XJ
2013-01-01
Solid State Lighting Reliability: Components to Systems begins with an explanation of the major benefits of solid state lighting (SSL) when compared to conventional lighting systems including but not limited to long useful lifetimes of 50,000 (or more) hours and high efficacy. When designing effective devices that take advantage of SSL capabilities the reliability of internal components (optics, drive electronics, controls, thermal design) take on critical importance. As such a detailed discussion of reliability from performance at the device level to sub components is included as well as the integrated systems of SSL modules, lamps and luminaires including various failure modes, reliability testing and reliability performance. This book also: Covers the essential reliability theories and practices for current and future development of Solid State Lighting components and systems Provides a systematic overview for not only the state-of-the-art, but also future roadmap and perspectives of Solid State Lighting r...
Incoherent SSI Analysis of Reactor Building using 2007 Hard-Rock Coherency Model
International Nuclear Information System (INIS)
Kang, Joo-Hyung; Lee, Sang-Hoon
2008-01-01
Many strong earthquake recordings show the response motions at building foundations to be less intense than the corresponding free-field motions. To account for these phenomena, the concept of spatial variation, or wave incoherence was introduced. Several approaches for its application to practical analysis and design as part of soil-structure interaction (SSI) effect have been developed. However, conventional wave incoherency models didn't reflect the characteristics of earthquake data from hard-rock site, and their application to the practical nuclear structures on the hard-rock sites was not justified sufficiently. This paper is focused on the response impact of hard-rock coherency model proposed in 2007 on the incoherent SSI analysis results of nuclear power plant (NPP) structure. A typical reactor building of pressurized water reactor (PWR) type NPP is modeled classified into surface and embedded foundations. The model is also assumed to be located on medium-hard rock and hard-rock sites. The SSI analysis results are obtained and compared in case of coherent and incoherent input motions. The structural responses considering rocking and torsion effects are also investigated
Solid state multinuclear NMR. A versatile tool for studying the reactivity of solid systems
Energy Technology Data Exchange (ETDEWEB)
MacKenzie, Kenneth J.D. [MacDiarmid Institute for Advanced Materials and Nanotechnology, Victoria University of Wellington, P.O. Box 600, Wellington (New Zealand)
2004-08-31
Traditionally, X-ray powder diffraction has been a favoured method for studying chemical reactions in the solid state, but the increasing importance of energy-efficient synthesis methods for solids (e.g. sol-gel synthesis, mechanochemical synthesis) has led to the need for an analytical method not dependent on long-range structural periodicity. Multinuclear solid state nuclear magnetic resonance (NMR) represents a technique which is equally applicable to amorphous or crystalline solids, and is now used in increasing numbers of solid state studies.This paper briefly outlines the principles and practical details of this powerful technique and gives examples of its use in solid-state chemistry, particularly in very recent studies of mechanochemical synthesis of advanced sialon ceramics. The temperature at which these technically important silicon aluminium oxynitride compounds are formed can be significantly lowered by high-energy grinding of their components to produce X-ray amorphous precursors. Solid-state NMR has been used to provide detailed information which could not have been obtained by any other means about the chemical environment of the Si and Al atoms in these amorphous precursors, and the various atomic movements undergone as they crystallise to the final product.
Solid state ionics: a Japan perspective
Yamamoto, Osamu
2017-12-01
The 70-year history of scientific endeavor of solid state ionics research in Japan is reviewed to show the contribution of Japanese scientists to the basic science of solid state ionics and its applications. The term 'solid state ionics' was defined by Takehiko Takahashi of Nagoya University, Japan: it refers to ions in solids, especially solids that exhibit high ionic conductivity at a fairly low temperature below their melting points. During the last few decades of exploration, many ion conducting solids have been discovered in Japan such as the copper-ion conductor Rb4Cu16I7Cl13, proton conductor SrCe1-xYxO3, oxide-ion conductor La0.9Sr0.9Ga0.9Mg0.1O3, and lithium-ion conductor Li10GeP2S12. Rb4Cu16I7Cl13 has a conductivity of 0.33 S cm-1 at 25 °C, which is the highest of all room temperature ion conductive solid electrolytes reported to date, and Li10GeP2S12 has a conductivity of 0.012 S cm-1 at 25 °C, which is the highest among lithium-ion conductors reported to date. Research on high-temperature proton conducting ceramics began in Japan. The history, the discovery of novel ionic conductors and the story behind them are summarized along with basic science and technology.
Directory of Open Access Journals (Sweden)
Myoung Seok Lee
Full Text Available The diagnostic performance of supersonic shear imaging (SSI in comparison with those of transient elastography (TE and acoustic radiation force impulse imaging (ARFI for staging fibrosis in nonalcoholic fatty liver disease (NAFLD patients has not been fully assessed, especially in Asian populations with relatively lean NAFLD compared to white populations. Thus, we focused on comparing the diagnostic performances of TE, ARFI, and SSI for staging fibrosis in a head-to-head manner, and identifying the clinical, anthropometric, biochemical, and histological features which might affect liver stiffness measurement (LSM in our prospective biopsy-proven NAFLD cohort. In this study, ninety-four patients with biopsy-proven NAFLD were included prospectively. Liver stiffness was measured using TE, SSI, and ARFI within 1 month of liver biopsy. The diagnostic performance for staging fibrosis was assessed using receiver operating characteristic (ROC analysis. Anthropometric data were evaluated as covariates influencing LSM by regression analyses. Liver stiffness correlated with fibrosis stage (p < 0.05; the area under the ROC curve of TE (kPa, SSI (kPa, and ARFI (m/s were as follows: 0.757, 0.759, and 0.657 for significant fibrosis and 0.870, 0.809, and 0.873 for advanced fibrosis. Anthropometric traits were significant confounders affecting SSI, while serum liver injury markers significantly confounded TE and ARFI. In conclusion, the LSM methods had similar diagnostic performance for staging fibrosis in patients with NAFLD. Pre-LSM anthropometric evaluation may help predict the reliability of SSI.
Introduction to solid state electronics
Wang, FFY
1989-01-01
This textbook is specifically tailored for undergraduate engineering courses offered in the junior year, providing a thorough understanding of solid state electronics without relying on the prerequisites of quantum mechanics. In contrast to most solid state electronics texts currently available, with their generalized treatments of the same topics, this is the first text to focus exclusively and in meaningful detail on introductory material. The original text has already been in use for 10 years. In this new edition, additional problems have been added at the end of most chapters. These proble
Solid state physics an introduction
Hofmann, Philip
2015-01-01
A must-have textbook for any undergraduate studying solid state physics. This successful brief course in solid state physics is now in its second edition. The clear and concise introduction not only describes all the basic phenomena and concepts, but also such advanced issues as magnetism and superconductivity. Each section starts with a gentle introduction, covering basic principles, progressing to a more advanced level in order to present a comprehensive overview of the subject. The book is providing qualitative discussions that help undergraduates understand concepts even if they can?t foll
Ultrasonic methods in solid state physics
Truell, John; Elbaum, Charles
1969-01-01
Ultrasonic Methods in Solid State Physics is devoted to studies of energy loss and velocity of ultrasonic waves which have a bearing on present-day problems in solid-state physics. The discussion is particularly concerned with the type of investigation that can be carried out in the megacycle range of frequencies from a few megacycles to kilomegacycles; it deals almost entirely with short-duration pulse methods rather than with standing-wave methods. The book opens with a chapter on a classical treatment of wave propagation in solids. This is followed by separate chapters on methods and techni
Silicon solid state devices and radiation detection
Leroy, Claude
2012-01-01
This book addresses the fundamental principles of interaction between radiation and matter, the principles of working and the operation of particle detectors based on silicon solid state devices. It covers a broad scope with respect to the fields of application of radiation detectors based on silicon solid state devices from low to high energy physics experiments including in outer space and in the medical environment. This book covers stateof- the-art detection techniques in the use of radiation detectors based on silicon solid state devices and their readout electronics, including the latest developments on pixelated silicon radiation detector and their application.
Development of generic soil profiles and soil data development for SSI analyses
Energy Technology Data Exchange (ETDEWEB)
Parker, Josh, E-mail: jparker@nuscalepower.com [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States); Khan, Mohsin; Rajagopal, Raj [ARES Corporation, 1990N California Boulevard, Suite 500, Walnut Creek, CA 94596 (United States); Groome, John [NuScale Power, 1000 NE Circle Boulevard, Suite 10310, Corvallis, OR 97330 (United States)
2014-04-01
This paper presents the approach to developing generic soil profiles for the design of reactor building for small modular reactor (SMR) nuclear power plant developed by NuScale Power. The reactor building is a deeply embedded structure. In order to perform soil structure interaction (SSI) analyses, generic soil profiles are required to be defined for the standardized Nuclear Power Plant (NPP) designs for the United States Nuclear Regulatory Commission (NRC) in a design control document (DCD). The development of generic soil profiles is based on utilization of information on generic soil profiles from the new standardized nuclear power plant designs already submitted to the NRC for license certification. Eleven generic soil profiles have been recommended, and those profiles cover a wide range of parameters such as soil depth, shear wave velocity, unit weight, Poisson's ratio, water table, and depth to rock strata. The soil profiles are developed for a range of shear wave velocities between bounds of 1000 fps and 8000 fps as inferred from NRC Standard Review Plan (NUREG 0800) Sections 3.7.1 and 3.7.2. To account for the soil degradation due to seismic events, the strain compatible soil properties are based on the EPRI generic soil degradation curves. In addition, one dimensional soil dynamic response analyses were performed to study the soil layer input motions for performing the SSI analyses.
Solid state laser technology - A NASA perspective
Allario, F.
1985-01-01
NASA's program for developing solid-state laser technology and applying it to the Space Shuttle and Space Platform is discussed. Solid-state lasers are required to fulfill the Earth Observation System's requirements. The role of the Office of Aeronautics and Space Technology in developing a NASA tunable solid-state laser program is described. The major goals of the program involve developing a solid-state pump laser in the green, using AlGaAs array technology, pumping a Nd:YAG/SLAB crystal or glass, and fabricating a lidar system, with either a CO2 laser at 10.6 microns or a Nd:YAG laser at 1.06 microns, to measure tropospheric winds to an accuracy of + or - 1 m/s and a vertical resolution of 1 km. The procedures to be followed in order to visualize this technology plan include: (1) material development and characterization, (2) laser development, and (3) implementation of the lasers.
International Nuclear Information System (INIS)
Reuther, H.
1976-11-01
This paper gives a survey of the present state of the development and the application of solid state track detectors. The fundamentals of the physical and chemical processes of the track formation and development are explained, the different detector materials and their registration characteristics are mentioned, the possibilities of the experimental practice and the most variable applications are discussed. (author)
Digital image processing based mass flow rate measurement of gas/solid two-phase flow
Energy Technology Data Exchange (ETDEWEB)
Song Ding; Peng Lihui; Lu Geng; Yang Shiyuan [Tsinghua National Laboratory for Information Science and Technology, Department of Automation, Tsinghua University, Beijing, 100084 (China); Yan Yong, E-mail: lihuipeng@tsinghua.edu.c [University of Kent, Canterbury, Kent CT2 7NT (United Kingdom)
2009-02-01
With the rapid growth of the process industry, pneumatic conveying as a tool for the transportation of a wide variety of pulverized and granular materials has become widespread. In order to improve plant control and operational efficiency, it is essential to know the parameters of the particle flow. This paper presents a digital imaging based method which is capable of measuring multiple flow parameters, including volumetric concentration, velocity and mass flow rate of particles in the gas/solid two phase flow. The measurement system consists of a solid state laser for illumination, a low-cost CCD camera for particle image acquisition and a microcomputer with bespoke software for particle image processing. The measurements of particle velocity and volumetric concentration share the same sensing hardware but use different exposure time and different image processing methods. By controlling the exposure time of the camera a clear image and a motion blurred image are obtained respectively. The clear image is thresholded by OTSU method to identify the particles from the dark background so that the volumetric concentration is determined by calculating the ratio between the particle area and the total area. Particle velocity is derived from the motion blur length, which is estimated from the motion blurred images by using the travelling wave equation method. The mass flow rate of particles is calculated by combining the particle velocity and volumetric concentration. Simulation and experiment results indicate that the proposed method is promising for the measurement of multiple parameters of gas/solid two-phase flow.
Digital image processing based mass flow rate measurement of gas/solid two-phase flow
International Nuclear Information System (INIS)
Song Ding; Peng Lihui; Lu Geng; Yang Shiyuan; Yan Yong
2009-01-01
With the rapid growth of the process industry, pneumatic conveying as a tool for the transportation of a wide variety of pulverized and granular materials has become widespread. In order to improve plant control and operational efficiency, it is essential to know the parameters of the particle flow. This paper presents a digital imaging based method which is capable of measuring multiple flow parameters, including volumetric concentration, velocity and mass flow rate of particles in the gas/solid two phase flow. The measurement system consists of a solid state laser for illumination, a low-cost CCD camera for particle image acquisition and a microcomputer with bespoke software for particle image processing. The measurements of particle velocity and volumetric concentration share the same sensing hardware but use different exposure time and different image processing methods. By controlling the exposure time of the camera a clear image and a motion blurred image are obtained respectively. The clear image is thresholded by OTSU method to identify the particles from the dark background so that the volumetric concentration is determined by calculating the ratio between the particle area and the total area. Particle velocity is derived from the motion blur length, which is estimated from the motion blurred images by using the travelling wave equation method. The mass flow rate of particles is calculated by combining the particle velocity and volumetric concentration. Simulation and experiment results indicate that the proposed method is promising for the measurement of multiple parameters of gas/solid two-phase flow.
Monolithic solid-state lasers for spaceflight
Krainak, Michael A.; Yu, Anthony W.; Stephen, Mark A.; Merritt, Scott; Glebov, Leonid; Glebova, Larissa; Ryasnyanskiy, Aleksandr; Smirnov, Vadim; Mu, Xiaodong; Meissner, Stephanie; Meissner, Helmuth
2015-02-01
A new solution for building high power, solid state lasers for space flight is to fabricate the whole laser resonator in a single (monolithic) structure or alternatively to build a contiguous diffusion bonded or welded structure. Monolithic lasers provide numerous advantages for space flight solid-state lasers by minimizing misalignment concerns. The closed cavity is immune to contamination. The number of components is minimized thus increasing reliability. Bragg mirrors serve as the high reflector and output coupler thus minimizing optical coatings and coating damage. The Bragg mirrors also provide spectral and spatial mode selection for high fidelity. The monolithic structure allows short cavities resulting in short pulses. Passive saturable absorber Q-switches provide a soft aperture for spatial mode filtering and improved pointing stability. We will review our recent commercial and in-house developments toward fully monolithic solid-state lasers.
International Nuclear Information System (INIS)
Saint Martin, Gisela; Bernaola, Omar A.; Pozzi, Emiliano; Thorp, Silvia; Cabrini, Romulo L.; Tomasi, V.H.
2007-01-01
The autoradiography images produced in solid state nuclear track detectors by heavy ions originated in tissue provide relevant information about the spatial biodistribution of heavy particle emitters. Some preliminary aspects of the autoradiography technique are evaluated by two experiments which are in progress, using Lexan and CR 39 foils as solid state nuclear track detectors. In the first case, a tissue sample from rat kidney intoxicated with UO 2 (NO 3 ) 2 was embedded in paraffin and put in contact with a 1 mm thick CR 39 foil. After a two months exposure the foil was chemically developed resulting in scarce tracks. A satisfactory image cannot be obtained in these conditions. More prolonged exposure time is needed to obtain better images of such samples. The second experience consisted in the irradiation of fresh kidney tissue slices from healthy rats in contact with 250 μm thick Lexan foils, in a thermal neutrons flux. The irradiation was performed at the RA-3 facility of the Ezeiza Atomic Center (CAE). The contribution to image produced by tracks of particles due to reactions between neutrons and tissue elements (i.e. 14 N) was evaluated. The etching conditions should be modified in order to desensitize the detector material. (author) [es
Grosso, Giuseppe
2013-01-01
Solid State Physics is a textbook for students of physics, material science, chemistry, and engineering. It is the state-of-the-art presentation of the theoretical foundations and application of the quantum structure of matter and materials. This second edition provides timely coverage of the most important scientific breakthroughs of the last decade (especially in low-dimensional systems and quantum transport). It helps build readers' understanding of the newest advances in condensed matter physics with rigorous yet clear mathematics. Examples are an integral part of the text, carefully de
SOLID-STATE STORAGE DEVICE FLASH TRANSLATION LAYER
DEFF Research Database (Denmark)
2017-01-01
Embodiments of the present invention include a method for storing a data page d on a solid-state storage device, wherein the solid-state storage device is configured to maintain a mapping table in a Log-Structure Merge (LSM) tree having a C0 component which is a random access memory (RAM) device...
Energy Technology Data Exchange (ETDEWEB)
Wu, Tony C.; Congreve, Daniel N.; Baldo, Marc A., E-mail: baldo@mit.edu [Department of Electrical Engineering and Computer Science, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139 (United States)
2015-07-20
The ability to upconvert light is useful for a range of applications, from biological imaging to solar cells. But modern technologies have struggled to upconvert incoherent incident light at low intensities. Here, we report solid state photon upconversion employing triplet-triplet exciton annihilation in an organic semiconductor, sensitized by a thermally activated-delayed fluorescence (TADF) dye. Compared to conventional phosphorescent sensitizers, the TADF dye maximizes the wavelength shift in upconversion due to its small singlet-triplet splitting. The efficiency of energy transfer from the TADF dye is 9.1%, and the conversion yield of sensitizer exciton pairs to singlet excitons in the annihilator is 1.1%. Our results demonstrate upconversion in solid state geometries and with non-heavy metal-based sensitizer materials.
Kolstein, M.; De Lorenzo, G.; Chmeissani, M.
2014-04-01
The Voxel Imaging PET (VIP) Pathfinder project intends to show the advantages of using pixelated solid-state technology for nuclear medicine applications. It proposes designs for Positron Emission Tomography (PET), Positron Emission Mammography (PEM) and Compton gamma camera detectors with a large number of signal channels (of the order of 106). For Compton camera, especially with a large number of readout channels, image reconstruction presents a big challenge. In this work, results are presented for the List-Mode Ordered Subset Expectation Maximization (LM-OSEM) image reconstruction algorithm on simulated data with the VIP Compton camera design. For the simulation, all realistic contributions to the spatial resolution are taken into account, including the Doppler broadening effect. The results show that even with a straightforward implementation of LM-OSEM, good images can be obtained for the proposed Compton camera design. Results are shown for various phantoms, including extended sources and with a distance between the field of view and the first detector plane equal to 100 mm which corresponds to a realistic nuclear medicine environment.
optimisation of solid optimisation of solid state fermentation
African Journals Online (AJOL)
eobe
from banana peels via solid state fermentation using Aspergillus niger. ermentation ... [7,8], apple pomace [9], banana peels [4], date palm. [10], carob ... powder, jams, juice, bar, biscuits, wine etc results in ... Yeast extract was taken as nitrogen.
Lindgren, Line M; Tingskov, Pernille N; Justesen, Annette H; Nedergaard, Bettina S; Olsen, Klaus J; Andreasen, Lars V; Kromann, Ingrid; Sørensen, Charlotte; Dietrich, Jes; Thierry-Carstensen, Birgit
2017-01-23
There is a demand of affordable IPV in the World. Statens Serum Institut (SSI) has developed three reduced dose IPV formulations adsorbed to aluminium hydroxide; 1/3 IPV-Al, 1/5 IPV-Al and 1/10 IPV-Al SSI, and now report the results of the first investigations in humans. 240 Danish adolescents, aged 10-15years, and childhood vaccinated with IPV were booster vaccinated with 1/3 IPV-Al, 1/5 IPV-Al, 1/10 IPV-Al or IPV Vaccine SSI. The booster effects (GMTRs) of the three IPV-Al SSI were compared to IPV Vaccine SSI, and evaluated for non-inferiority. The pre-vaccination GMTs were similar across the groups; 926 (type 1), 969 (type 2) and 846 (type 3) in the total trial population. The GMTRs by poliovirus type and IPV formulation were: Type 1: 17.0 (1/3 IPV-Al), 13.0 (1/5 IPV-Al), 7.1 (1/10 IPV-Al) and 42.2 (IPV Vaccine SSI). Type 2: 12.5 (1/3 IPV-Al), 13.1 (1/5 IPV-Al), 7.6 (1/10 IPV-Al) and 47.8 (IPV Vaccine SSI). Type 3: 14.5 (1/3 IPV-Al), 16.2 (1/5 IPV-Al), 8.9 (1/10 IPV-Al) and 62.4 (IPV Vaccine SSI) Thus, the three IPV-Al formulations were highly immunogenic, but inferior to IPV Vaccine SSI, in this booster vaccination trial. No SAE and no AE of severe intensity occurred. 59.2% of the subjects reported at least one AE. Injection site pain was the most frequent AE in all groups; from 24.6% to 43.3%. Injection site redness and swelling frequencies were<5% in most and<10% in all groups. The most frequent systemic AEs were fatigue (from 8.2% to 15.0%) and headache (from 15.0% to 28.3%). Most AEs were of mild intensity. In conclusion, the three IPV-Al SSI were safe in adolescents and the booster effects were satisfactory. ClinicalTrials.gov registration number: NCT02280447. Copyright © 2016. Published by Elsevier Ltd.
Liu, Qiunan; Yang, Tingting; Du, Congcong; Tang, Yongfu; Sun, Yong; Jia, Peng; Chen, Jingzhao; Ye, Hongjun; Shen, Tongde; Peng, Qiuming; Zhang, Liqiang; Huang, Jianyu
2018-05-14
We report real time imaging of the oxygen reduction reactions (ORRs) in all solid state sodium oxygen batteries (SOBs) with CuO nanowires (NWs) as the air cathode in an aberration-corrected environmental transmission electron microscope under an oxygen environment. The ORR occurred in a distinct two-step reaction, namely, a first conversion reaction followed by a second multiple ORR. In the former, CuO was first converted to Cu 2 O and then to Cu; in the latter, NaO 2 formed first, followed by its disproportionation to Na 2 O 2 and O 2 . Concurrent with the two distinct electrochemical reactions, the CuO NWs experienced multiple consecutive large volume expansions. It is evident that the freshly formed ultrafine-grained Cu in the conversion reaction catalyzed the latter one-electron-transfer ORR, leading to the formation of NaO 2 . Remarkably, no carbonate formation was detected in the oxygen cathode after cycling due to the absence of carbon source in the whole battery setup. These results provide fundamental understanding into the oxygen chemistry in the carbonless air cathode in all solid state Na-O 2 batteries.
Solid state electrolytes for all-solid-state 3D lithium-ion batteries
Kokal, I.
2012-01-01
The focus of this Ph.D. thesis is to understand the lithium ion motion and to enhance the Li-ionic conductivities in commonly known solid state lithium ion conductors by changing the structural properties and preparation methods. In addition, the feasibility for practical utilization of several
Imaging quasiperiodic electronic states in a synthetic Penrose tiling
Collins, Laura C.; Witte, Thomas G.; Silverman, Rochelle; Green, David B.; Gomes, Kenjiro K.
2017-06-01
Quasicrystals possess long-range order but lack the translational symmetry of crystalline solids. In solid state physics, periodicity is one of the fundamental properties that prescribes the electronic band structure in crystals. In the absence of periodicity and the presence of quasicrystalline order, the ways that electronic states change remain a mystery. Scanning tunnelling microscopy and atomic manipulation can be used to assemble a two-dimensional quasicrystalline structure mapped upon the Penrose tiling. Here, carbon monoxide molecules are arranged on the surface of Cu(111) one at a time to form the potential landscape that mimics the ionic potential of atoms in natural materials by constraining the electrons in the two-dimensional surface state of Cu(111). The real-space images reveal the presence of the quasiperiodic order in the electronic wave functions and the Fourier analysis of our results links the energy of the resonant states to the local vertex structure of the quasicrystal.
Solar Pumped High Power Solid State Laser for Space Applications
Fork, Richard L.; Laycock, Rustin L.; Green, Jason J. A.; Walker, Wesley W.; Cole, Spencer T.; Frederick, Kevin B.; Phillips, Dane J.
2004-01-01
Highly coherent laser light provides a nearly optimal means of transmitting power in space. The simplest most direct means of converting sunlight to coherent laser light is a solar pumped laser oscillator. A key need for broadly useful space solar power is a robust solid state laser oscillator capable of operating efficiently in near Earth space at output powers in the multi hundred kilowatt range. The principal challenges in realizing such solar pumped laser oscillators are: (1) the need to remove heat from the solid state laser material without introducing unacceptable thermal shock, thermal lensing, or thermal stress induced birefringence to a degree that improves on current removal rates by several orders of magnitude and (2) to introduce sunlight at an effective concentration (kW/sq cm of laser cross sectional area) that is several orders of magnitude higher than currently available while tolerating a pointing error of the spacecraft of several degrees. We discuss strategies for addressing these challenges. The need to remove the high densities of heat, e.g., 30 kW/cu cm, while keeping the thermal shock, thermal lensing and thermal stress induced birefringence loss sufficiently low is addressed in terms of a novel use of diamond integrated with the laser material, such as Ti:sapphire in a manner such that the waste heat is removed from the laser medium in an axial direction and in the diamond in a radial direction. We discuss means for concentrating sunlight to an effective areal density of the order of 30 kW/sq cm. The method integrates conventional imaging optics, non-imaging optics and nonlinear optics. In effect we use a method that combines some of the methods of optical pumping solid state materials and optical fiber, but also address laser media having areas sufficiently large, e.g., 1 cm diameter to handle the multi-hundred kilowatt level powers needed for space solar power.
Tahmasebi, Neda; Shafie, Bijan; Karimi, Hamid; Mazaheri, Masood
2018-01-01
Purpose: The fourth version of the Stuttering Severity Instrument (SSI-4) has been available since 2009. It has some modifications and new features which make it more appropriate at least for clinical practice, although further documentation is needed. The objective of the current research was to
Passivation-free solid state battery
Abraham, Kuzhikalail M.; Peramunage, Dharmasena
1998-01-01
This invention pertains to passivation-free solid-state rechargeable batteries composed of Li.sub.4 Ti.sub.5 O.sub.12 anode, a solid polymer electrolyte and a high voltage cathode. The solid polymer electrolyte comprises a polymer host, such as polyacrylonitrile, poly(vinyl chloride), poly(vinyl sulfone), and poly(vinylidene fluoride), plasticized by a solution of a Li salt in an organic solvent. The high voltage cathode includes LiMn.sub.2 O.sub.4, LiCoO.sub.2, LiNiO.sub.2 and LiV.sub.2 O.sub.5 and their derivatives.
Simon, Steven H
2013-01-01
The study of solids is one of the richest, most exciting, and most successful branches of physics. While the subject of solid state physics is often viewed as dry and tedious this new book presents the topic instead as an exciting exposition of fundamental principles and great intellectual breakthroughs. Beginning with a discussion of how the study of heat capacity of solids ushered in the quantum revolution, the author presents the key ideas of the field while emphasizing the deepunderlying concepts. The book begins with a discussion of the Einstein/Debye model of specific heat, and the Drude
Pitiporntapin, Sasithep; Lankford, Deanna Marie
2015-01-01
This paper addresses using social media to promote pre-service science teachers' practices of Socio-Scientific Issue (SSI) based teaching in a science classroom setting. We designed our research in two phases. The first phase examined pre-service science teachers' perceptions about using social media to promote their SSI-based teaching. The…
Solid-state ring laser gyroscope
Schwartz, S.
The ring laser gyroscope is a rotation sensor used in most kinds of inertial navigation units. It usually consists in a ring cavity filled with a mixture of helium and neon, together with high-voltage pumping electrodes. The use of a gaseous gain medium, while resulting naturally in a stable bidirectional regime enabling rotation sensing, is however the main industrially limiting factor for the ring laser gyroscopes in terms of cost, reliability and lifetime. We study in this book the possibility of substituting for the gaseous gain medium a solid-state medium (diode-pumped Nd-YAG). For this, a theoretical and experimental overview of the lasing regimes of the solid-state ring laser is reported. We show that the bidirectional emission can be obtained thanks to a feedback loop acting on the states of polarization and inducing differential losses proportional to the difference of intensity between the counterpropagating modes. This leads to the achievement of a solid-state ring laser gyroscope, whose frequency response is modified by mode coupling effects. Several configurations, either mechanically or optically based, are then successively studied, with a view to improving the quality of this frequency response. In particular, vibration of the gain crystal along the longitudinal axis appears to be a very promising technique for reaching high inertial performances with a solid-state ring laser gyroscope. Gyrolaser à état solide. Le gyrolaser est un capteur de rotation utilisé dans la plupart des centrales de navigation inertielle. Dans sa forme usuelle, il est constitué d'une cavité laser en anneau remplie d'un mélange d'hélium et de néon pompé par des électrodes à haute tension. L'utilisation d'un milieu amplificateur gazeux, si elle permet de garantir naturellement le fonctionnement bidirectionnel stable nécessaire à la mesure des rotations, constitue en revanche la principale limitation industrielle des gyrolasers actuels en termes de coût, fiabilit
Achievement of solid-state plasma fusion ('Cold-Fusion')
International Nuclear Information System (INIS)
Arata, Yoshiaki; Zhang, Yue-Chang
1995-01-01
Using a 'QMS' (Quadrupole Mass Spectrometer), the authors detected a significantly large amount (10 20 -10 21 [cm -3 ]) of helium ( 2 4 He), which was concluded to have been produced by a deuterium nuclear reaction within a host solid. These results were found to be fully repeatable and supported the authors' proposition that solid state plasma fusion ('Cold Fusion') can be generated in energetic deuterium Strongly Coupled Plasma ('SC-plasma'). This fusion reaction is thought to be sustained by localized 'Latticequake' in a solid-state media with the deuterium density equivalent to that of the host solid. While exploring this basic proposition, the characteristic differences when compared with ultra high temperature-state plasma fusion ('Hot Fusion') are clarified. In general, the most essential reaction product in both types of the deuterium plasma fusion is considered to be helium, irrespective of the 'well-known and/or unknown reactions', which is stored within the solid-state medium in abundance as a 'Residual Product', but which generally can not enter into nor be released from host-solid at a room temperature. Even measuring instruments with relatively poor sensitivity should be able to easily detect such residual helium. An absence of residual helium means that no nuclear fusion reaction has occurred, whereas its presence provides crucial evidence that nuclear fusion has, in fact, occurred in the solid. (author)
Solid state nuclear track detection principles, methods and applications
Durrani, S A; ter Haar, D
1987-01-01
Solid State Nuclear Track Detection: Principles, Methods and Applications is the second book written by the authors after Nuclear Tracks in Solids: Principles and Applications. The book is meant as an introduction to the subject solid state of nuclear track detection. The text covers the interactions of charged particles with matter; the nature of the charged-particle track; the methodology and geometry of track etching; thermal fading of latent damage trails on tracks; the use of dielectric track recorders in particle identification; radiation dossimetry; and solid state nuclear track detecti
An introduction to solid state diffusion
Borg, Richard J
2012-01-01
The energetics and mechanisms of diffusion control the kinetics of such diverse phenomena as the fabrication of semiconductors and superconductors, the tempering of steel, geological metamorphism, the precipitation hardening of nonferrous alloys and corrosion of metals and alloys. This work explains the fundamentals of diffusion in the solid state at a level suitable for upper-level undergraduate and beginning graduate students in materials science, metallurgy, mineralogy, and solid state physics and chemistry. A knowledge of physical chemistry such as is generally provided by a one-year under
3D-Printing Electrolytes for Solid-State Batteries.
McOwen, Dennis W; Xu, Shaomao; Gong, Yunhui; Wen, Yang; Godbey, Griffin L; Gritton, Jack E; Hamann, Tanner R; Dai, Jiaqi; Hitz, Gregory T; Hu, Liangbing; Wachsman, Eric D
2018-05-01
Solid-state batteries have many enticing advantages in terms of safety and stability, but the solid electrolytes upon which these batteries are based typically lead to high cell resistance. Both components of the resistance (interfacial, due to poor contact with electrolytes, and bulk, due to a thick electrolyte) are a result of the rudimentary manufacturing capabilities that exist for solid-state electrolytes. In general, solid electrolytes are studied as flat pellets with planar interfaces, which minimizes interfacial contact area. Here, multiple ink formulations are developed that enable 3D printing of unique solid electrolyte microstructures with varying properties. These inks are used to 3D-print a variety of patterns, which are then sintered to reveal thin, nonplanar, intricate architectures composed only of Li 7 La 3 Zr 2 O 12 solid electrolyte. Using these 3D-printing ink formulations to further study and optimize electrolyte structure could lead to solid-state batteries with dramatically lower full cell resistance and higher energy and power density. In addition, the reported ink compositions could be used as a model recipe for other solid electrolyte or ceramic inks, perhaps enabling 3D printing in related fields. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
A zwitterionic gel electrolyte for efficient solid-state supercapacitors
Peng, Xu; Liu, Huili; Yin, Qin; Wu, Junchi; Chen, Pengzuo; Zhang, Guangzhao; Liu, Guangming; Wu, Changzheng; Xie, Yi
2016-01-01
Gel electrolytes have attracted increasing attention for solid-state supercapacitors. An ideal gel electrolyte usually requires a combination of advantages of high ion migration rate, reasonable mechanical strength and robust water retention ability at the solid state for ensuring excellent work durability. Here we report a zwitterionic gel electrolyte that successfully brings the synergic advantages of robust water retention ability and ion migration channels, manifesting in superior electrochemical performance. When applying the zwitterionic gel electrolyte, our graphene-based solid-state supercapacitor reaches a volume capacitance of 300.8 F cm−3 at 0.8 A cm−3 with a rate capacity of only 14.9% capacitance loss as the current density increases from 0.8 to 20 A cm−3, representing the best value among the previously reported graphene-based solid-state supercapacitors, to the best of our knowledge. We anticipate that zwitterionic gel electrolyte may be developed as a gel electrolyte in solid-state supercapacitors. PMID:27225484
Solid State Theory An Introduction
Rössler, Ulrich
2009-01-01
Solid-State Theory - An Introduction is a textbook for graduate students of physics and material sciences. It stands in the tradition of older textbooks on this subject but takes up new developments in theoretical concepts and materials which are connected with such path breaking discoveries as the Quantum-Hall Effects, the high-Tc superconductors, and the low-dimensional systems realized in solids. Thus besides providing the fundamental concepts to describe the physics of electrons and ions of which the solid consists, including their interactions and the interaction with light, the book casts a bridge to the experimental facts and opens the view into current research fields.
Self-healing liquid/solid state battery
Burke, Paul J.; Chung, Brice H.V.; Phadke, Satyajit R.; Ning, Xiaohui; Sadoway, Donald R.
2018-02-27
A battery system that exchanges energy with an external device is provided. The battery system includes a positive electrode having a first metal or alloy, a negative electrode having a second metal or alloy, and an electrolyte including a salt of the second metal or alloy. The positive electrode, the negative electrode, and the electrolyte are in a liquid phase at an operating temperature during at least one portion of operation. The positive electrode is entirely in a liquid phase in one charged state and includes a solid phase in another charged state. The solid phase of the positive electrode includes a solid intermetallic formed by the first and the second metals or alloys. Methods of storing electrical energy from an external circuit using such a battery system are also provided.
Harwell's atomic, molecular and solid state computer programs
International Nuclear Information System (INIS)
Harker, A.H.
1976-02-01
This document is intended to introduce the computational facilities available in the fields of atomic, molecular the solid state theory on the IBM370/165 at Harwell. The programs have all been implemented and thoroughly tested by the Theory of Solid State Materials Group. (author)
Cross-relaxation solid state lasers
International Nuclear Information System (INIS)
Antipenko, B.M.
1989-01-01
Cross-relaxation functional diagrams provide a high quantum efficiency for pumping bands of solid state laser media and a low waste heat. A large number of the cross-relaxation mechanisms for decay rare earth excited states in crystals have been investigated. These investigations have been a starting-point for development of the cross-relaxation solid state lasers. For example, the cross-relaxation interactions, have been used for the laser action development of LiYF 4 :Gd-Tb. These interactions are important elements of the functional diagrams of the 2 μm Ho-doped media sensitized with Er and Tm and the 3 μm Er-doped media. Recently, new efficient 2 μm laser media with cross-relaxation pumping diagrams have been developed. Physical aspects of these media are the subject of this paper. A new concept of the Er-doped medium, sensitized with Yb, is illustrated
Energy-saving approaches to solid state street lighting
Vitta, Pranciškus; Stanikūnas, Rytis; Tuzikas, Arūnas; Reklaitis, Ignas; Stonkus, Andrius; Petrulis, Andrius; Vaitkevičius, Henrikas; Žukauskas, Artūras
2011-10-01
We consider the energy-saving potential of solid-state street lighting due to improved visual performance, weather sensitive luminance control and tracking of pedestrians and vehicles. A psychophysical experiment on the measurement of reaction time with a decision making task was performed under mesopic levels of illumination provided by a highpressure sodium (HPS) lamp and different solid-state light sources, such as daylight and warm-white phosphor converted light-emitting diodes (LEDs) and red-green-blue LED clusters. The results of the experiment imply that photopic luminances of road surface provided by solid-state light sources with an optimized spectral power distribution might be up to twice as low as those provided by the HPS lamp. Dynamical correction of road luminance against road surface conditions typical of Lithuanian climate was estimated to save about 20% of energy in comparison with constant-level illumination. The estimated energy savings due to the tracking of pedestrians and vehicles amount at least 25% with the cumulative effect of intelligent control of at least 40%. A solid-state street lighting system with intelligent control was demonstrated using a 300 m long test ground consisting of 10 solid-state street luminaires, a meteorological station and microwave motion sensor network operated via power line communication.
Solid-state characterization of the HIV protease inhibitor
Kim, Y A
2002-01-01
The LB71350, (3S, 4R)-Epoxy-(5S)-[[N-(1-methylethoxy) carbonyl]-3-(methylsulfonyl)-L-valinyl]amin= o]-N-[2-methyl-(1R)-[(phenyl)carbonyl]propyl-6-phenylhexanamide, is a novel HIV protease inhibitor. Its equilibrium solubility at room temperature was less than 40 mu g/mL. It was speculated that the low aqueous solubility might be due to the high crystalline lattice energy resulting from intermolecular hydrogen bonds. The present study was carried out to learn the solid-state characteristics of LB71350 using analytical methods such as NMR, FT-IR and XRD. sup 1 sup 3 C Solid-state NMR, solution NMR, and FT-IR spectra of the various solid forms of LB71350 were used to identify the conformation and structure of the solid forms. The chemical shifts of sup 1 sup 3 C solid-state NMR spectra suggest that the crystalline form might have 3 intermolecular hydrogen bondings between monomers.
SSI analysis of a massive concrete structure based on a novel ...
Indian Academy of Sciences (India)
1Structural Engineering Research Centre, CSIR Campus, Taramani,. Chennai ... In the numerical analysis of an SSI problem, the main difficulty is in representation of the ... validated software tools to execute the task is considered as the main ...
Integrated Interface Strategy toward Room Temperature Solid-State Lithium Batteries.
Ju, Jiangwei; Wang, Yantao; Chen, Bingbing; Ma, Jun; Dong, Shanmu; Chai, Jingchao; Qu, Hongtao; Cui, Longfei; Wu, Xiuxiu; Cui, Guanglei
2018-04-25
Solid-state lithium batteries have drawn wide attention to address the safety issues of power batteries. However, the development of solid-state lithium batteries is substantially limited by the poor electrochemical performances originating from the rigid interface between solid electrodes and solid-state electrolytes. In this work, a composite of poly(vinyl carbonate) and Li 10 SnP 2 S 12 solid-state electrolyte is fabricated successfully via in situ polymerization to improve the rigid interface issues. The composite electrolyte presents a considerable room temperature conductivity of 0.2 mS cm -1 , an electrochemical window exceeding 4.5 V, and a Li + transport number of 0.6. It is demonstrated that solid-state lithium metal battery of LiFe 0.2 Mn 0.8 PO 4 (LFMP)/composite electrolyte/Li can deliver a high capacity of 130 mA h g -1 with considerable capacity retention of 88% and Coulombic efficiency of exceeding 99% after 140 cycles at the rate of 0.5 C at room temperature. The superior electrochemical performance can be ascribed to the good compatibility of the composite electrolyte with Li metal and the integrated compatible interface between solid electrodes and the composite electrolyte engineered by in situ polymerization, which leads to a significant interfacial impedance decrease from 1292 to 213 Ω cm 2 in solid-state Li-Li symmetrical cells. This work provides vital reference for improving the interface compatibility for room temperature solid-state lithium batteries.
Directory of Open Access Journals (Sweden)
Kelly Mônica Marinho e Lima
2018-01-01
Full Text Available This review aimed to describe the state of the art in muscle-tendon unit (MTU assessment by supersonic shear wave imaging (SSI elastography in states of muscle contraction and stretching, during aging, and in response to injury and therapeutic interventions. A consensus exists that MTU elasticity increases during passive stretching or contraction, and decreases after static stretching, electrostimulation, massage, and dry needling. There is currently no agreement regarding changes in the MTU due to aging and injury. Currently, the application of SSI for the purpose of diagnosis, rehabilitation, and physical training remains limited by a number of issues, including the lack of normative value ranges, the lack of consensus regarding the appropriate terminology, and an inadequate understanding of the main technical limitations of this novel technology.
Titanium dioxide@polypyrrole core-shell nanowires for all solid-state flexible supercapacitors
Yu, Minghao; Zeng, Yinxiang; Zhang, Chong; Lu, Xihong; Zeng, Chenghui; Yao, Chenzhong; Yang, Yangyi; Tong, Yexiang
2013-10-01
Herein, we developed a facile two-step process to synthesize TiO2@PPy core-shell nanowires (NWs) on carbon cloth and reported their improved electrochemical performance for flexible supercapacitors (SCs). The fabricated solid-state SC device based on TiO2@PPy core-shell NWs not only has excellent flexibility, but also exhibits remarkable electrochemical performance.Herein, we developed a facile two-step process to synthesize TiO2@PPy core-shell nanowires (NWs) on carbon cloth and reported their improved electrochemical performance for flexible supercapacitors (SCs). The fabricated solid-state SC device based on TiO2@PPy core-shell NWs not only has excellent flexibility, but also exhibits remarkable electrochemical performance. Electronic supplementary information (ESI) available: Experimental details, XRD pattern, FT-IR absorption spectrum and CV curves of TiO2@PPy NWs, and SEM images of the PPy. See DOI: 10.1039/c3nr03578f
Koechner, Walter
1992-01-01
This book is written from an industrial perspective and provides a detailed discussion of solid-state lasers, their characteristics, design and construction. Emphasis is placed on engineering and practical considerations. The book is aimed mainly at the practicing scientist or engineer who is interested in the design or use of solid-state lasers, but the comprehensive treatment of the subject will make the work useful also to students of laser physics who seek to supplement their theoretical knowledge with engineering information. In order to present the subject as clearly as possible, phenomenological descriptions using models have been used rather than abstract mathematical descriptions. This results in a simplified presentation. The descriptions are enhanced by the inclusion of numerical and technical data, tables and graphs. This new edition has been updated and revised to take account of important new developments, concepts, and technologies that have emerged since the publication of the first and second...
Solid state nuclear magnetic resonance of fossil fuels
International Nuclear Information System (INIS)
Axelson, D.E.
1985-01-01
This book contains the following chapters: Principles of solid state NMR; Relaxation processes: Introduction to pulse sequences; Quantitative analysis; Removal of artifacts from CPMAS FT experiments; Line broadening mechanisms; Resolution enhancement of solid state NMR spectra; and /sup 13/C CPMAS NMR of fossil fuels--general applications
Advances in Solid State Physics
Haug, Rolf
2007-01-01
The present volume 46 of Advances in Solid State Physics contains the written versions of selected invited lectures from the spring meeting of the Arbeitskreis Festkörperphysik of the Deutsche Physikalische Gesellschaft which was held from 27 to 31 March 2006 in Dresden, Germany. Many topical talks given at the numerous symposia are included. Most of these were organized collaboratively by several of the divisions of the Arbeitskreis. The topis range from zero-dimensional physics in quantum dots, molecules and nanoparticles over one-dimensional physics in nanowires and 1d systems to more applied subjects like optoelectronics and materials science in thin films. The contributions span the whole width of solid-state physics from truly basic science to applications.
Laser solid sampling for a solid-state-detector ICP emission spectrometer
International Nuclear Information System (INIS)
Noelte, J.; Moenke-Blankenburg, L.; Schumann, T.
1994-01-01
Solid sampling with laser vaporization has been coupled to an ICP emission spectrometer with an Echelle optical system and a solid-state-detector for the analysis of steel and soil samples. Pulsation of the vaporized material flow was compensated by real-time background correction and internal standardization, resulting in good accuracy and precision. (orig.)
An extrapolation scheme for solid-state NMR chemical shift calculations
Nakajima, Takahito
2017-06-01
Conventional quantum chemical and solid-state physical approaches include several problems to accurately calculate solid-state nuclear magnetic resonance (NMR) properties. We propose a reliable computational scheme for solid-state NMR chemical shifts using an extrapolation scheme that retains the advantages of these approaches but reduces their disadvantages. Our scheme can satisfactorily yield solid-state NMR magnetic shielding constants. The estimated values have only a small dependence on the low-level density functional theory calculation with the extrapolation scheme. Thus, our approach is efficient because the rough calculation can be performed in the extrapolation scheme.
Phosphate phosphors for solid-state lighting
Energy Technology Data Exchange (ETDEWEB)
Shinde, Kartik N. [N.S. Science and Arts College, Bhadrawati (India). Dept. of Physics; Swart, H.C. [University of the Orange Free State, Bloemfontein (South Africa). Dept. of Physics; Dhoble, S.J. [R.T.M. Nagpur Univ. (India). Dept. of Physics; Park, Kyeongsoon [Sejong Univ., Seoul (Korea, Republic of). Faculty of Nanotechnology and Advanced Materials Engineering
2012-07-01
Essential information for students in researchers working towards new and more efficient solid-state lighting. Comprehensive survey based on the authors' long experience. Useful both for teaching and reference. The idea for this book arose out of the realization that, although excellent surveys and a phosphor handbook are available, there is no single source covering the area of phosphate based phosphors especially for lamp industry. Moreover, as this field gets only limited attention in most general books on luminescence, there is a clear need for a book in which attention is specifically directed toward this rapidly growing field of solid state lighting and its many applications. This book is aimed at providing a sound introduction to the synthesis and optical characterization of phosphate phosphor for undergraduate and graduate students as well as teachers and researchers. The book provides guidance through the multidisciplinary field of solid state lighting specially phosphate phosphors for beginners, scientists and engineers from universities, research organizations, and especially industry. In order to make it useful for a wide audience, both fundamentals and applications are discussed, together.
A software framework for analysing solid-state MAS NMR data
International Nuclear Information System (INIS)
Stevens, Tim J.; Fogh, Rasmus H.; Boucher, Wayne; Higman, Victoria A.; Eisenmenger, Frank; Bardiaux, Benjamin; Rossum, Barth-Jan van; Oschkinat, Hartmut; Laue, Ernest D.
2011-01-01
Solid-state magic-angle-spinning (MAS) NMR of proteins has undergone many rapid methodological developments in recent years, enabling detailed studies of protein structure, function and dynamics. Software development, however, has not kept pace with these advances and data analysis is mostly performed using tools developed for solution NMR which do not directly address solid-state specific issues. Here we present additions to the CcpNmr Analysis software package which enable easier identification of spinning side bands, straightforward analysis of double quantum spectra, automatic consideration of non-uniform labelling schemes, as well as extension of other existing features to the needs of solid-state MAS data. To underpin this, we have updated and extended the CCPN data model and experiment descriptions to include transfer types and nomenclature appropriate for solid-state NMR experiments, as well as a set of experiment prototypes covering the experiments commonly employed by solid-sate MAS protein NMR spectroscopists. This work not only improves solid-state MAS NMR data analysis but provides a platform for anyone who uses the CCPN data model for programming, data transfer, or data archival involving solid-state MAS NMR data.
Review on solid electrolytes for all-solid-state lithium-ion batteries
Zheng, Feng; Kotobuki, Masashi; Song, Shufeng; Lai, Man On; Lu, Li
2018-06-01
All-solid-state (ASS) lithium-ion battery has attracted great attention due to its high safety and increased energy density. One of key components in the ASS battery (ASSB) is solid electrolyte that determines performance of the ASSB. Many types of solid electrolytes have been investigated in great detail in the past years, including NASICON-type, garnet-type, perovskite-type, LISICON-type, LiPON-type, Li3N-type, sulfide-type, argyrodite-type, anti-perovskite-type and many more. This paper aims to provide comprehensive reviews on some typical types of key solid electrolytes and some ASSBs, and on gaps that should be resolved.
Design and Characterisation of Solid Electrolytes for All-Solid-State Lithium Batteries
DEFF Research Database (Denmark)
Sveinbjörnsson, Dadi Þorsteinn
The development of all-solid-state lithium batteries, in which the currently used liquid electrolytes are substituted for solid electrolyte materials, could lead to safer batteries offering higher energy densities and longer cycle lifetimes. Designing suitable solid electrolytes with sufficient...... chemical and electrochemical stability, high lithium ion conduction and negligible electronic conduction remains a challenge. The highly lithium ion conducting LiBH4-LiI solid solution is a promising solid electrolyte material. Solid solutions with a LiI content of 6.25%-50% were synthesised by planetary......-rich microstructures during ball milling is found to significantly influence the conductivity of the samples. The long-range diffusion of lithium ions was measured using quasi-elastic neutron scattering. The solid solutions are found to exhibit two-dimensional conduction in the hexagonal plane of the crystal structure...
High power diode pumped solid state lasers
International Nuclear Information System (INIS)
Solarz, R.; Albrecht, G.; Beach, R.; Comaskey, B.
1992-01-01
Although operational for over twenty years, diode pumped solid state lasers have, for most of their existence, been limited to individual diodes pumping a tiny volume of active medium in an end pumped configuration. More recent years have witnessed the appearance of diode bars, packing around 100 diodes in a 1 cm bar which have enabled end and side pumped small solid state lasers at the few Watt level of output. This paper describes the subsequent development of how proper cooling and stacking of bars enables the fabrication of multi kill average power diode pump arrays with irradiances of 1 kw/cm peak and 250 W/cm 2 average pump power. Since typical conversion efficiencies from the diode light to the pumped laser output light are of order 30% or more, kW average power diode pumped solid state lasers now are possible
Solid state physics principles and modern applications
Quinn, John J
2018-01-01
This book provides the basis for a two-semester graduate course on solid-state physics. The first half presents all the knowledge necessary for a one-semester survey of solid-state physics, but in greater depth than most introductory solid state physics courses. The second half includes most of the important research over the past half-century, covering both the fundamental principles and most recent advances. This new edition includes the latest developments in the treatment of strongly interacting two-dimensional electrons and discusses the generalization from small to larger systems. The book provides explanations in a class-tested tutorial style, and each chapter includes problems reviewing key concepts and calculations. The updated exercises and solutions enable students to become familiar with contemporary research activities, such as the electronic properties of massless fermions in graphene and topological insulators.
Solid-state resistor for pulsed power machines
Stoltzfus, Brian; Savage, Mark E.; Hutsel, Brian Thomas; Fowler, William E.; MacRunnels, Keven Alan; Justus, David; Stygar, William A.
2016-12-06
A flexible solid-state resistor comprises a string of ceramic resistors that can be used to charge the capacitors of a linear transformer driver (LTD) used in a pulsed power machine. The solid-state resistor is able to absorb the energy of a switch prefire, thereby limiting LTD cavity damage, yet has a sufficiently low RC charge time to allow the capacitor to be recharged without disrupting the operation of the pulsed power machine.
Solid-state dependent dissolution and oral bioavailability of piroxicam in rats.
Lust, Andres; Laidmäe, Ivo; Palo, Mirja; Meos, Andres; Aaltonen, Jaakko; Veski, Peep; Heinämäki, Jyrki; Kogermann, Karin
2013-01-23
The aim of this study was to gain understanding about the effects of different solid-state forms of a poorly water-soluble piroxicam on drug dissolution and oral bioavailability in rats. Three different solid-state forms of piroxicam were studied: anhydrate I (AH), monohydrate (MH), and amorphous form in solid dispersion (SD). In addition, the effect of a new polymeric excipient Soluplus® (polyvinyl caprolactam-polyvinyl acetate-polyethylene glycol graft copolymer) on oral bioavailability of piroxicam was investigated. Significant differences in the dissolution and oral bioavailability were found between the solid-state forms of piroxicam. Amorphous piroxicam in SD showed the fastest dissolution in vitro and a solid-state transformation to MH in the dissolution medium. Despite the presence of solid-state transformation, SD exhibited the highest rate and extent of oral absorption in rats. Oral bioavailability of other two solid-state forms decreased in the order AH and MH. The use of Soluplus® was found to enhance the dissolution and oral bioavailability of piroxicam in rats. The present study shows the importance of solid-state form selection for oral bioavailability of a poorly water-soluble drug. Copyright © 2012 Elsevier B.V. All rights reserved.
Development of diode-pumped medical solid-state lasers
International Nuclear Information System (INIS)
Kim, Cheol Jung; Kim, Min Suk
2000-09-01
Two thirds of human body consists of water and the absorption of laser by water is an important factor in medical laser treatment. Er medical lasers have been used in the dermatology, ophthalmology and dental treatments due to its highest absorption by water. However, 2.9 um Er laser can not be transmitted through an optical fiber. On the other hand, Tm laser can be transmitted through an fiber and also has very high absorption by water. Therefore, Tm lasers are used in ophthalmology and heart treatment wherein the fiber delivery is very important for the treatment. Until now, mainly lamp-pumped solid-state lasers have been used in medical treatments, but the lamp-pumped solid-state lasers are being replaced with the diode-pumped solid-state lasers because the diode-pumped solid-state lasers are more compact and much easier to maintain. Following this trend, end-pumped Er and side-pumped Tm lasers have been developed and the output power of 1 W was obtained for Er and Tm respectively
Development of diode-pumped medical solid-state lasers
Energy Technology Data Exchange (ETDEWEB)
Kim, Cheol Jung; Kim, Min Suk
2000-09-01
Two thirds of human body consists of water and the absorption of laser by water is an important factor in medical laser treatment. Er medical lasers have been used in the dermatology, ophthalmology and dental treatments due to its highest absorption by water. However, 2.9 um Er laser can not be transmitted through an optical fiber. On the other hand, Tm laser can be transmitted through an fiber and also has very high absorption by water. Therefore, Tm lasers are used in ophthalmology and heart treatment wherein the fiber delivery is very important for the treatment. Until now, mainly lamp-pumped solid-state lasers have been used in medical treatments, but the lamp-pumped solid-state lasers are being replaced with the diode-pumped solid-state lasers because the diode-pumped solid-state lasers are more compact and much easier to maintain. Following this trend, end-pumped Er and side-pumped Tm lasers have been developed and the output power of 1 W was obtained for Er and Tm respectively.
All solid-state SBS phase conjugate mirror
Dane, C.B.; Hackel, L.A.
1999-03-09
A stimulated Brillouin scattering (SBS) phase conjugate laser mirror uses a solid-state nonlinear gain medium instead of the conventional liquid or high pressure gas medium. The concept has been effectively demonstrated using common optical-grade fused silica. An energy threshold of 2.5 mJ and a slope efficiency of over 90% were achieved, resulting in an overall energy reflectivity of >80% for 15 ns, 1 um laser pulses. The use of solid-state materials is enabled by a multi-pass resonant architecture which suppresses transient fluctuations that would otherwise result in damage to the SBS medium. This all solid state phase conjugator is safer, more reliable, and more easily manufactured than prior art designs. It allows nonlinear wavefront correction to be implemented in industrial and defense laser systems whose operating environments would preclude the introduction of potentially hazardous liquids or high pressure gases. 8 figs.
Solid state fermentation studies of citric acid production
African Journals Online (AJOL)
SERVER
2008-03-04
Mar 4, 2008 ... solid waste management, biomass energy conservation, production of high value products and little risk ... The carrier, sugarcane bagasse for solid state fermentation was procured from National Sugar Institute ... constant weight and designated as dry solid residue (DSR). The filtrate (consisting of biomass, ...
Automatic measurement for solid state track detectors
International Nuclear Information System (INIS)
Ogura, Koichi
1982-01-01
Since in solid state track detectors, their tracks are measured with a microscope, observers are forced to do hard works that consume time and labour. This causes to obtain poor statistic accuracy or to produce personal error. Therefore, many researches have been done to aim at simplifying and automating track measurement. There are two categories in automating the measurement: simple counting of the number of tracks and the requirements to know geometrical elements such as the size of tracks or their coordinates as well as the number of tracks. The former is called automatic counting and the latter automatic analysis. The method to generally evaluate the number of tracks in automatic counting is the estimation of the total number of tracks in the total detector area or in a field of view of a microscope. It is suitable for counting when the track density is higher. The method to count tracks one by one includes the spark counting and the scanning microdensitometer. Automatic analysis includes video image analysis in which the high quality images obtained with a high resolution video camera are processed with a micro-computer, and the tracks are automatically recognized and measured by feature extraction. This method is described in detail. In many kinds of automatic measurements reported so far, frequently used ones are ''spark counting'' and ''video image analysis''. (Wakatsuki, Y.)
Nanocrystalline spinel ferrites by solid state reaction route
Indian Academy of Sciences (India)
Wintec
Nanocrystalline spinel ferrites by solid state reaction route. T K KUNDU* and S MISHRA. Department of Physics, Visva-Bharati, Santiniketan 731 235, India. Abstract. Nanostructured NiFe2O4, MnFe2O4 and (NiZn)Fe2O4 were synthesized by aliovalent ion doping using conventional solid-state reaction route. With the ...
Application of solid state track detector to neutron dosimetry
International Nuclear Information System (INIS)
Tsuruta, Takao
1979-01-01
Though solid state track detectors (SSTD) are radiation measuring instrument for heavy charged particles by itself, it can be used as radiation measuring instrument for neutrons, if nuclear reactions such as (n, f) or (n, α) reaction are utilized. Since the means was found, which permits to observe the tracks of heavy charged particles in a solid with an optical microscope by chemically etching the tracks to enlarge them to etch pits, various types of detectors have been developed for the purpose of measuring neutron dose. The paper is described on the materials and construction of the SSTDs for neutron dosimetry, and the sensitivity is explained with mathematical equations. The features of neutron dosimetry with SSTDs are as follows: They are compact, and scarcely disturb neutron field, thus delicate dose distribution can be known; integration measurement is possible regardless of dose rate values because of integrating type detectors; it is not influenced by β-ray or γ-ray except the case when there is high energy radiation such as causing photonuclear reactions or high dose such as degrading solids, it has pretty high sensitivity; track fading is negligible during the normal measuring time around room temperature; and the etching images of tracks are relatively clear, and various automatic counting systems can be employed. (Wakatsuki, Y.)
Research on IGBT solid state switch
Gan Kong Yin; Wang Xiao Feng; Wang Lang Ping; Wang Song Yan; Chu, P K; Wu Hong Chen
2002-01-01
The experiments on the IGBT solid state switch for induction accelerator was carried out with two series 1.2 kV, 75 A IGBT (GA75TS120U). The static and dynamic balancing modules were carried out with metal oxide varistors, capacities and diodes in order to suppress the over-voltage during IGBT on and off. Experimental results show that IGBT solid state switch works very stable under the different conditions. It can output peak voltage 1.8 kV, rise time 300 ns, fall time 1.64 mu s waveforms on the loads. The simulation data using OrCAD are in accord with experimental results except the rise time
Research on IGBT solid state switch
International Nuclear Information System (INIS)
Gan Kongyin; Tang Baoyin; Wang Xiaofeng; Wang Langping; Wang Songyan; Wu Hongchen
2002-01-01
The experiments on the IGBT solid state switch for induction accelerator was carried out with two series 1.2 kV, 75 A IGBT (GA75TS120U). The static and dynamic balancing modules were carried out with metal oxide varistors, capacities and diodes in order to suppress the over-voltage during IGBT on and off. Experimental results show that IGBT solid state switch works very stable under the different conditions. It can output peak voltage 1.8 kV, rise time 300 ns, fall time 1.64 μs waveforms on the loads. The simulation data using OrCAD are in accord with experimental results except the rise time
Handbook of Applied Solid State Spectroscopy
Vij, D. R
2006-01-01
Solid-State spectroscopy is a burgeoning field with applications in many branches of science, including physics, chemistry, biosciences, surface science, and materials science. Handbook of Applied Solid-State Spectroscopy brings together in one volume information about various spectroscopic techniques that is currently scattered in the literature of these disciplines. This concise yet comprehensive volume covers theory and applications of a broad range of spectroscopies, including NMR, NQR, EPR/ESR, ENDOR, scanning tunneling, acoustic resonance, FTIR, auger electron emission, x-ray photoelectron emission, luminescence, and optical polarization, and more. Emphasis is placed on fundamentals and current methods and procedures, together with the latest applications and developments in the field.
Physical Acoustics in the Solid State
Lüthi, B
2006-01-01
Suitable for researchers and graduate students in physics and material science, "Physical Acoustics in the Solid State" reviews the modern aspects in the field, including many experimental results, especially those involving ultrasonics. Practically all fields of solid-state physics are covered: metals, semiconductors, magnetism, superconductivity, different kinds of phase transitions, low-dimensional systems, and the quantum Hall effect. After a review of the relevant experimental techniques and an introduction to the theory of elasticity, emphasizing the symmetry aspects, applications in the various fields of condensed matter physics are presented. Also treated are Brillouin-scattering results and results from thermodynamic investigations, such as thermal expansion and specific heat.
Physical Acoustics in the Solid State
Lüthi, Bruno
2007-01-01
Suitable for researchers and graduate students in physics and material science, "Physical Acoustics in the Solid State" reviews the modern aspects in the field, including many experimental results, especially those involving ultrasonics. Practically all fields of solid-state physics are covered: metals, semiconductors, magnetism, superconductivity, different kinds of phase transitions, low-dimensional systems, and the quantum Hall effect. After a review of the relevant experimental techniques and an introduction to the theory of elasticity, emphasizing the symmetry aspects, applications in the various fields of condensed matter physics are presented. Also treated are Brillouin-scattering results and results from thermodynamic investigations, such as thermal expansion and specific heat.
Uses of solid state analogies in elementary particle theory
International Nuclear Information System (INIS)
Anderson, P.W.
1976-01-01
The solid state background of some of the modern ideas of field theory is reviewed, and additional examples of model situations in solid state or many-body theory which may have relevance to fundamental theories of elementary particles are adduced
Transire, a Program for Generating Solid-State Interface Structures
2017-09-14
ARL-TR-8134 ● SEP 2017 US Army Research Laboratory Transire, a Program for Generating Solid-State Interface Structures by...Program for Generating Solid-State Interface Structures by Caleb M Carlin and Berend C Rinderspacher Weapons and Materials Research Directorate, ARL...
IFE Power Plant design principles. Drivers. Solid state laser drivers
International Nuclear Information System (INIS)
Nakai, S.; Andre, M.; Krupke, W.F.; Mak, A.A.; Soures, J.M.; Yamanaka, M.
1995-01-01
The present status of solid state laser drivers for an inertial confinement thermonuclear fusion power plant is discussed. In particular, the feasibility of laser diode pumped solid state laser drivers from both the technical and economic points of view is briefly reviewed. Conceptual design studies showed that they can, in principle, satisfy the design requirements. However, development of new solid state materials with long fluorescence lifetimes and good thermal characteristics is a key issue for laser diode pumped solid state lasers. With the advent of laser diode pumping many materials which were abandoned in the past can presently be reconsidered as viable candidates. It is also concluded that it is important to examine the technical requirements for solid state lasers in relation to target performance criteria. The progress of laser diode pumped lasers in industrial applications should also be closely watched to provide additional information on the economic feasibility of this type of driver. 15 refs, 9 figs, 2 tabs
Potential of solid state fermentation for production of ergot alkaloids
Trejo Hernandez, M.R.; Raimbault, Maurice; Roussos, Sevastianos; Lonsane, B.K.
1992-01-01
Production of total ergot alkaloids by #Claviceps fusiformis$ in solid state fermentation was 3.9 times higher compared to that in submerged fermentation. Production was equal in the case of #Claviceps purpurea$ but the spectra of alkaloids were advantageous with the use of solid state fermentation. The data establish potential of solid state fermentation which was not explored earlier for production of ergot alkaloids. (Résumé d'auteur)
Keszthelyi, L.; McEwen, A.S.; Phillips, C.B.; Milazzo, M.; Geissler, P.; Turtle, E.P.; Radebaugh, J.; Williams, D.A.; Simonelli, D.P.; Breneman, H.H.; Klaasen, K.P.; Levanas, G.; Denk, T.; Alexander, D.D.A.; Capraro, K.; Chang, S.-H.; Chen, A.C.; Clark, J.; Conner, D.L.; Culver, A.; Handley, T.H.; Jensen, D.N.; Knight, D.D.; LaVoie, S.K.; McAuley, M.; Mego, V.; Montoya, O.; Mortensen, H.B.; Noland, S.J.; Patel, R.R.; Pauro, T.M.; Stanley, C.L.; Steinwand, D.J.; Thaller, T.F.; Woncik, P.J.; Yagi, G.M.; Yoshimizu, J.R.; Alvarez, Del; Castillo, E.M.; Belton, M.J.S.; Beyer, R.; Branston, D.; Fishburn, M.B.; Mueller, B.; Ragan, R.; Samarasinha, N.; Anger, C.D.; Cunningham, C.; Little, B.; Arriola, S.; Carr, M.H.; Asphaug, E.; Moore, J.; Morrison, D.; Rages, K.; Banfield, D.; Bell, M.; Burns, J.A.; Carcich, B.; Clark, B.; Currier, N.; Dauber, I.; Gierasch, P.J.; Helfenstein, P.; Mann, M.; Othman, O.; Rossier, L.; Solomon, N.; Sullivan, R.; Thomas, P.C.; Veverka, J.; Becker, T.; Edwards, K.; Gaddis, L.; Kirk, R.; Lee, E.; Rosanova, T.; Sucharski, R.M.; Beebe, R.F.; Simon, A.; Bender, K.; Chuang, F.; Fagents, S.; Figueredo, P.; Greeley, R.; Homan, K.; Kadel, S.; Kerr, J.; Klemaszewski, J.; Lo, E.; Schwarz, W.; Williams, K.; Bierhaus, E.; Brooks, S.; Chapman, C.R.; Merline, B.; Keller, J.; Schenk, P.; Tamblyn, P.; Bouchez, A.; Dyundian, U.; Ingersoll, A.P.; Showman, A.; Spitale, J.; Stewart, S.; Vasavada, A.; Cunningham, W.F.; Johnson, T.V.; Jones, T.J.; Kaufman, J.M.; Magee, K.P.; Meredith, M.K.; Orton, G.S.; Senske, D.A.; West, A.; Winther, D.; Collins, G.; Fripp, W.J.; Head, J. W.; Pappalardo, R.; Pratt, S.; Procter, L.; Spaun, N.; Colvin, T.; Davies, M.; DeJong, E.M.; Hall, J.; Suzuki, S.; Gorjian, Z.; Giese, B.; Koehler, U.; Neukum, G.; Oberst, J.; Roatsch, T.; Tost, W.; Schuster, P.; Wagner, R.; Dieter, N.; Durda, D.; Greenberg, R.J.; Hoppa, G.; Jaeger, W.; Plassman, J.; Tufts, R.; Fanale, F.P.; Gran,
2001-01-01
The Solid-State Imaging (SSI) instrument provided the first high- and medium-resolution views of Io as the Galileo spacecraft closed in on the volcanic body in late 1999 and early 2000. While each volcanic center has many unique features, the majority can be placed into one of two broad categories. The "Promethean" eruptions, typified by the volcanic center Prometheus, are characterized by long-lived steady eruptions producing a compound flow field emplaced in an insulating manner over a period of years to decades. In contrast, "Pillanian" eruptions are characterized by large pyroclastic deposits and short-lived but high effusion rate eruptions from fissures feeding open-channel or open-sheet flows. Both types of eruptions commonly have ???100-km-tall, bright, SO2-rich plumes forming near the flow fronts and smaller deposits of red material that mark the vent for the silicate lavas. Copyright 2001 by the American Geophysical Union.
Energy Technology Data Exchange (ETDEWEB)
Ko, Do Kyeong; Lee, Jong Min; Cha, Byung Heon; Jung, E. C.; Kim, Hyun Su; Lim, Gwon
2001-01-01
we have fabricated solid-state dyes with PMMA and sol-gel materials. We developed single longitudianl mode solid-state dye laser with the linewidth of less than 500MHz. We have constructed a self-seeded laser and observed the increase of the output power because of self-seeding effect. We investigated the operating characteristics of the dualwave laser oscillator and DFDL with solid-state dyes. And we have constructed the 3-color solid-state dye laser oscillator and amplifier system and observed 3-color operation. We also improved the laser oscliiator with disk-type solid-state dye cell which can be translated and rotated with the help of the two stepping motors. With the help of computer control, we could constantly changed the illuminated area of the dye cell and, therefore, were able to achieve long time operation and to use almost the entire region of the solid-state dye cell.
Radiation sensitive solid state devices
International Nuclear Information System (INIS)
Shannon, J.M.; Ralph, J.E.
1975-01-01
A solid state radiation sensitive device is described employing JFETs as the sensitive elements. Two terminal construction is achieved by using a common conductor to capacitively couple to the JFET gate and to one of the source and drain connections. (auth)
Differentiation of Solid Renal Tumors with Multiparametric MR Imaging.
Lopes Vendrami, Camila; Parada Villavicencio, Carolina; DeJulio, Todd J; Chatterjee, Argha; Casalino, David D; Horowitz, Jeanne M; Oberlin, Daniel T; Yang, Guang-Yu; Nikolaidis, Paul; Miller, Frank H
2017-01-01
Characterization of renal tumors is critical to determine the best therapeutic approach and improve overall patient survival. Because of increased use of high-resolution cross-sectional imaging in clinical practice, renal masses are being discovered with increased frequency. As a result, accurate imaging characterization of these lesions is more important than ever. However, because of the wide array of imaging features encountered as well as overlapping characteristics, identifying reliable imaging criteria for differentiating malignant from benign renal masses remains a challenge. Multiparametric magnetic resonance (MR) imaging based on various anatomic and functional parameters has an important role and adds diagnostic value in detection and characterization of renal masses. MR imaging may allow distinction of benign solid renal masses from several renal cell carcinoma (RCC) subtypes, potentially suggest the histologic grade of a neoplasm, and play an important role in ensuring appropriate patient management to avoid unnecessary surgery or other interventions. It is also a useful noninvasive imaging tool for patients who undergo active surveillance of renal masses and for follow-up after treatment of a renal mass. The purpose of this article is to review the characteristic MR imaging features of RCC and common benign renal masses and propose a diagnostic imaging approach to evaluation of solid renal masses using multiparametric MR imaging. © RSNA, 2017.
Atomistic Simulation of Interfaces in Materials of Solid State Ionics
Ivanov-Schitz, A. K.; Mazo, G. N.
2018-01-01
The possibilities of describing correctly interfaces of different types in solids within a computer experiment using molecular statics simulation, molecular dynamics simulation, and quantum chemical calculations are discussed. Heterophase boundaries of various types, including grain boundaries and solid electrolyte‒solid electrolyte and ionic conductor‒electrode material interfaces, are considered. Specific microstructural features and mechanisms of the ion transport in real heterophase structures (cationic conductor‒metal anode and anionic conductor‒cathode) existing in solid state ionics devices (such as solid-state batteries and fuel cells) are discussed.
FIVE YEARS OF SYNTHESIS OF SOLAR SPECTRAL IRRADIANCE FROM SDID/SISA AND SDO /AIA IMAGES
Energy Technology Data Exchange (ETDEWEB)
Fontenla, J. M. [NorthWest Research Associates, Boulder, CO 80301 (United States); Codrescu, M. [Space Weather Prediction Center, National Oceanic and Atmospheric Administration, Boulder, CO 80305 (United States); Fedrizzi, M.; Fuller-Rowell, T. [Cooperative Institute for Research in Environmental Sciences, University of Colorado Boulder, Boulder, CO 80309 (United States); Hill, F. [National Solar Observatory, Boulder, CO 80303 (United States); Landi, E. [Department of Climate and Space Science and Engineering, University of Michigan, Ann Arbor, MI 48109 (United States); Woods, T., E-mail: johnf@digidyna.com [Laboratory for Atmospheric and Space Physics, University of Colorado Boulder, Boulder, CO 80303 (United States)
2017-01-01
In this paper we describe the synthetic solar spectral irradiance (SSI) calculated from 2010 to 2015 using data from the Atmospheric Imaging Assembly (AIA) instrument, on board the Solar Dynamics Observatory spacecraft. We used the algorithms for solar disk image decomposition (SDID) and the spectral irradiance synthesis algorithm (SISA) that we had developed over several years. The SDID algorithm decomposes the images of the solar disk into areas occupied by nine types of chromospheric and 5 types of coronal physical structures. With this decomposition and a set of pre-computed angle-dependent spectra for each of the features, the SISA algorithm is used to calculate the SSI. We discuss the application of the basic SDID/SISA algorithm to a subset of the AIA images and the observed variation occurring in the 2010–2015 period of the relative areas of the solar disk covered by the various solar surface features. Our results consist of the SSI and total solar irradiance variations over the 2010–2015 period. The SSI results include soft X-ray, ultraviolet, visible, infrared, and far-infrared observations and can be used for studies of the solar radiative forcing of the Earth’s atmosphere. These SSI estimates were used to drive a thermosphere–ionosphere physical simulation model. Predictions of neutral mass density at low Earth orbit altitudes in the thermosphere and peak plasma densities at mid-latitudes are in reasonable agreement with the observations. The correlation between the simulation results and the observations was consistently better when fluxes computed by SDID/SISA procedures were used.
Solid state division progress report, period ending February 29, 1980
Energy Technology Data Exchange (ETDEWEB)
1980-09-01
Research is reported concerning theoretical solid state physics; surface and near-surface properties of solids; defects in solids; transport properties of solids; neutron scattering; crystal growth and characterization; and isotope research materials.
Solid state division progress report, period ending February 29, 1980
International Nuclear Information System (INIS)
1980-09-01
Research is reported concerning theoretical solid state physics; surface and near-surface properties of solids; defects in solids; transport properties of solids; neutron scattering; crystal growth and characterization; and isotope research materials
Solid-State Thyratron Replacement. Final Report
Energy Technology Data Exchange (ETDEWEB)
Roth, Ian [Diversified Technologies, Inc., Bedford, MA
2017-12-12
Under this SBIR, DTI developed a solid-state switch as an alternative to legacy thyratron equipment. Our Phase II objective was to make a solid-state thyratron replacement that would provide equivalent or better performance, much higher reliability (at least a 20 year lifetime, compared to a thyratron’s two-year lifetime) and would sell for ~3x the cost of a thyratron, or less than $40k. We were successful in building a solid-state switch which could reliably function as a thyratron replacement. The unit was designed to directly replace the thyratrons currently being used at SLAC’s Linac Coherent Light Source (LCLS), and was built in a tank that was small enough to fit into the existing thyratron cabinet, providing a true form-fit-function replacement path. We tested the switch at the full operating specifications: 48 kV, 6.3 kA, and 1 µs risetime. We also demonstrated a peak-to-peak pulse jitter of 1.5 ns, which is five times shorter than is typical for thyratrons. This lower jitter would improve the performance of the LCLS beam. The predicted reliability is more than 80 years, which is 40 times greater than a thyratron.
Directory of Open Access Journals (Sweden)
A. Cahyarini
2016-11-01
Full Text Available The aim of this study was to investigate the effect of 5E learning cycle instructional model using socioscientific issues (SSI learning context on students’ critical thinking skills of acid-base. This study used quasi-experimental posttest only control group design. The sample consisted of three classes, which were XI MIA-4class (n = 32 that learned using 5E LC model, XI MIA-5 class (n = 33 that learned using 5E LC+SSI, and XI MIA-6 class (n = 32 that learned using conventional method. The samples were choosen by convenience sampling technique. The test instrument consisted of 15 multiple choice items which were valid and reliable (r = 0.806. The data were analyzed using one way ANOVA test and LSD posthoc test. The results of this study indicated that the students who learned using 5E LC+SSI model showed greater levels of critical thinking skills ( = 74,95 than both the student who learned using 5E LC model ( = 74,17 and the student who learned using conventional method ( = 68,96. Based on statistics analysis, there was significant differences on students’ critical thinkings between students taught using conventional method and students taught either using 5E LC+SSI model and 5E LC model. However, there was no significant differences on students’ critical thinking skills between students taught using 5E LC+SSI model and the students taught using 5E LC model.
Space-time complexity in solid state models
International Nuclear Information System (INIS)
Bishop, A.R.
1985-01-01
In this Workshop on symmetry-breaking it is appropriate to include the evolving fields of nonlinear-nonequilibrium systems in which transitions to and between various degrees of ''complexity'' (including ''chaos'') occur in time or space or both. These notions naturally bring together phenomena of pattern formation and chaos and therefore have ramifications for a huge array of natural sciences - astrophysics, plasmas and lasers, hydrodynamics, field theory, materials and solid state theory, optics and electronics, biology, pattern recognition and evolution, etc. Our particular concerns here are with examples from solid state and condensed matter
State of the art of solid state dosimetry
International Nuclear Information System (INIS)
Souza, Susana O.; Yamamoto, Takayoshi; D'Errico, Francesco
2014-01-01
Passive solid-state detectors still dominate the personal dosimetry field. This article provides state of the art in this field and summarizes the most recent works presented on TL, OSL and RPL during the 17th International Conference on Solid State Dosimetry held in Recife in September 2013. The Article contains in particular the techniques Thermoluminescence (TL), Optically Stimulated Luminescence (OSL), radio photoluminescence (RPL). Thermoluminescence has the biggest advantage of the wide availability of commercial materials for dosimetry, and the nature tissue-equivalent of several of these materials. The limitation of the TL dosimetry presents fading luminance signal and the need for high temperatures to obtain the signal. The Optically Stimulated Luminescence has the advantages of high sensitivity, the possibility of multiple reading, while its limit is the need to use response compensating filters in addition to the high cost of equipment and dosimeters still restricted very few options trading . The radio photoluminescence has a reading that is completely non-destructive, but their dosimeters present lack of tissue-equivalent and a high cost. Presents the details of the techniques and the advantages and limitations of each of these will be discussed
Applied solid state science advances in materials and device research
Wolfe, Raymond
2013-01-01
Applied Solid State Science: Advances in Materials and Device Research, Volume 4 covers articles on single crystal compound semiconductors and complex polycrystalline materials. The book discusses narrow gap semiconductors and solid state batteries. The text then describes the advantages of hot-pressed microcrystalline compacts of oxygen-octahedra ferroelectrics over single crystal materials, as well as heterostructure junction lasers. Solid state physicists, materials scientists, electrical engineers, and graduate students studying the subjects being discussed will find the book invaluable.
SOLID STATE BATTERIES WITH CONDUCTING POLYMERS
Bénière , F.; Boils , D.; Cánepa , H.; Franco , J.; Le Corre , A.; Louboutin , J.
1983-01-01
The conducting polymers like (CH)x are very interesting materials for electrodes in electrochemical cells. We have combined such electrodes with solid electrolytes to build "all solid-state" batteries. The first prototypes using a silver anode and a silver conducting electrolyte have been working satisfactorily since two years. The performances have been tested with many batteries to study the electrical properties as well as the thermodynamical parameters. A number of cycles of charge-discha...
DNP-enhanced solid-state NMR spectroscopy of active pharmaceutical ingredients.
Zhao, Li; Pinon, Arthur C; Emsley, Lyndon; Rossini, Aaron J
2017-11-28
Solid-state NMR spectroscopy has become a valuable tool for the characterization of both pure and formulated active pharmaceutical ingredients (APIs). However, NMR generally suffers from poor sensitivity that often restricts NMR experiments to nuclei with favorable properties, concentrated samples, and acquisition of one-dimensional (1D) NMR spectra. Here, we review how dynamic nuclear polarization (DNP) can be applied to routinely enhance the sensitivity of solid-state NMR experiments by one to two orders of magnitude for both pure and formulated APIs. Sample preparation protocols for relayed DNP experiments and experiments on directly doped APIs are detailed. Numerical spin diffusion models illustrate the dependence of relayed DNP enhancements on the relaxation properties and particle size of the solids and can be used for particle size determination when the other factors are known. We then describe the advanced solid-state NMR experiments that have been enabled by DNP and how they provide unique insight into the molecular and macroscopic structure of APIs. For example, with large sensitivity gains provided by DNP, natural isotopic abundance, 13 C- 13 C double-quantum single-quantum homonuclear correlation NMR spectra of pure APIs can be routinely acquired. DNP also enables solid-state NMR experiments with unreceptive quadrupolar nuclei such as 2 H, 14 N, and 35 Cl that are commonly found in APIs. Applications of DNP-enhanced solid-state NMR spectroscopy for the molecular level characterization of low API load formulations such as commercial tablets and amorphous solid dispersions are described. Future perspectives for DNP-enhanced solid-state NMR experiments on APIs are briefly discussed. Copyright © 2017 John Wiley & Sons, Ltd.
Guanidinium nonaflate as a solid-state proton conductor
DEFF Research Database (Denmark)
Chen, Xiaoli; Tang, Haolin; Putzeys, Tristan
2016-01-01
Protic organic ionic plastic crystals (POIPCs) are a type of novel solid-state proton conductors. In this work, guanidinium nonaflate ([Gdm-H][NfO]) is reported to be a model POIPC. Its structure-property relationship has been investigated comprehensively. Infrared analysis of [Gdm-H][NfO] and its....... In addition, POIPC-based solid-state proton conductors are also expected to find applications in sensors and other electrochemical devices....
Dening, Tahnee J; Rao, Shasha; Thomas, Nicky; Prestidge, Clive A
2016-01-01
Lipid-based drug delivery systems (LBDDS) have gained significant attention in recent times, owing to their ability to overcome the challenges limiting the oral delivery of poorly water-soluble drugs. Despite the successful commercialization of several LBDDS products over the years, a large discrepancy exists between the number of poorly water-soluble drugs displaying suboptimal in vivo performances and the application of LBDDS to mitigate their various delivery challenges. Conventional LBDDS, including lipid solutions and suspensions, emulsions, and self-emulsifying formulations, suffer from various drawbacks limiting their widespread use and commercialization. Accordingly, solid-state LBDDS, fabricated by adsorbing LBDDS onto a chemically inert solid carrier material, have attracted substantial interest as a viable means of stabilizing LBDDS whilst eliminating some of the various limitations. This review describes the impact of solid carrier choice on LBDDS performance and highlights the importance of appropriate solid carrier material selection when designing hybrid solid-state LBDDS. Specifically, emphasis is placed on discussing the ability of the specific solid carrier to modulate drug release, control lipase action and lipid digestion, and enhance biopharmaceutical performance above the original liquid-state LBDDS. To encourage the interested reader to consider their solid carrier choice on a higher level, various novel materials with the potential for future use as solid carriers for LBDDS are described. This review is highly significant in guiding future research directions in the solid-state LBDDS field and fostering the translation of these delivery systems to the pharmaceutical marketplace.
Zhu, H; Wang, F; Guo, X Y; Li, L Q; Duan, D B; Liu, Z B; Yang, Z
2018-04-18
To provide useful information for the further production and application of this novel radio-nuclide for potential clinical application. 124 Te (p,n) 124 I nuclide reaction was used for the 124 I production. Firstly, the target material, 124 TeO 2 (200 mg) and Al2O3 (30 mg) mixture, were compressed into the round platinum based solid target by tablet device. HM-20 medical cyclotron was applied to irradiate the solid target slice for 6-10 h with helium and water cooling. Then, the radiated solid target was placed for 12 h (overnight) to decay the radioactive impurity; finally, 124 I was be purified by dry distillation using 1 mL/min nitrogen for about 6 hours and radiochemical separation methods. Micro-PET imaging studies were performed to investigate the metabolism properties and thyroid imaging ability of 124 I.After 740 kBq 124 I was injected intravenously into the tail vein of the normal mice, the animals were imaged with micro-PET and infused with CT. The micro-PET/CT infusion imaging revealed actual state 124 I's metabolism in the mice. It was been successfully applied for 200 mg 124 TeO 2 plating by the tablet device on the surface of platinum. It showed smooth, dense surface and without obviously pits and cracks. The enriched 124 Te target was irradiated for 6 to 10 hours at about 12.0 MeV with 20 μA current on HM-20 cyclotron. Then 370-1 110 MBq 124 I could be produced on the solid target after irradiation and 370-740 MBq high specific activity could be collected afterdry distillation separation and radio-chemical purification. 124 I product was finally dissolved in 0.01 mol/L NaOH for the future distribution. The gamma spectrum of the produced 124 I-solution showed that radionuclide purity was over 80.0%. The micro-PET imaging of 124 I in the normal mice exhibited the thyroid and stomach accumulations and kidney metabolism, the bladder could also be clearly visible, which was in accordance with what was previously reported. To the best of our knowledge
The solid state detector technology for picosecond laser ranging
Prochazka, Ivan
1993-01-01
We developed an all solid state laser ranging detector technology, which makes the goal of millimeter accuracy achievable. Our design and construction philosophy is to combine the techniques of single photon ranging, ultrashort laser pulses, and fast fixed threshold discrimination while avoiding any analog signal processing within the laser ranging chain. The all solid state laser ranging detector package consists of the START detector and the STOP solid state photon counting module. Both the detectors are working in an optically triggered avalanche switching regime. The optical signal is triggering an avalanche current buildup which results in the generation of a uniform, fast risetime output pulse.
NOAA Climate Data Record (CDR) of Solar Spectral Irradiance (SSI), NRLSSI Version 2
National Oceanic and Atmospheric Administration, Department of Commerce — This Climate Data Record (CDR) contains solar spectral irradiance (SSI) as a function of time and wavelength created with the Naval Research Laboratory model for...
Burns, Gerald
2013-01-01
The objective of Solid State Physics is to introduce college seniors and first-year graduate students in physics, electrical engineering, materials science, chemistry, and related areas to this diverse and fascinating field. I have attempted to present this complex subject matter in a coherent, integrated manner, emphasizing fundamental scientific ideas to give the student a strong understanding and ""feel"" for the physics and the orders of magnitude involved. The subject is varied, covering many important, sophisticated, and practical areas, which, at first, may appear unrelated but which ar
International Nuclear Information System (INIS)
Habib, P.
1988-01-01
The 1988 progress report of the Solid State Mechanics laboratory (Polytechnic School, France) is presented. The research program domains are the following: investigations concerning the stability and bifurcation of the reversible or irreversible mechanical systems, the problems related to the theoretical and experimental determination of the materials rheological properties, the fatigue crack formation and propagation in multiple-axial stress conditions, the expert systems, and the software applied in the reinforced earth structures dimensioning. Moreover, the published papers, the books, the congress communications, the thesis, and the patents are listed [fr
Facilitated ion transport in all-solid-state flexible supercapacitors.
Choi, Bong Gill; Hong, Jinkee; Hong, Won Hi; Hammond, Paula T; Park, HoSeok
2011-09-27
The realization of highly flexible and all-solid-state energy-storage devices strongly depends on both the electrical properties and mechanical integrity of the constitutive materials and the controlled assembly of electrode and solid electrolyte. Herein we report the preparation of all-solid-state flexible supercapacitors (SCs) through the easy assembly of functionalized reduced graphene oxide (f-RGO) thin films (as electrode) and solvent-cast Nafion electrolyte membranes (as electrolyte and separator). In particular, the f-RGO-based SCs (f-RGO-SCs) showed a 2-fold higher specific capacitance (118.5 F/g at 1 A/g) and rate capability (90% retention at 30 A/g) compared to those of all-solid-state graphene SCs (62.3 F/g at 1A/g and 48% retention at 30 A/g). As proven by the 4-fold faster relaxation of the f-RGO-SCs than that of the RGO-SCs and more capacitive behavior of the former at the low-frequency region, these results were attributed to the facilitated ionic transport at the electrical double layer by means of the interfacial engineering of RGO by Nafion. Moreover, the superiority of all-solid-state flexible f-RGO-SCs was demonstrated by the good performance durability under the 1000 cycles of charging and discharging due to the mechanical integrity as a consequence of the interconnected networking structures. Therefore, this research provides new insight into the rational design and fabrication of all-solid-state flexible energy-storage devices as well as the fundamental understanding of ion and charge transport at the interface. © 2011 American Chemical Society
Entanglement in Solid-State Nanostructures
Bodoky, F.
2009-01-01
The goal of this thesis is to investigate theoretically the generation and behaviour of multipartite entanglement for solid-state nanosystems, in particular electron spin quantum bits (so-called 'qubits') in quantum dots. A quantum dot is a tiny potential well where a single electron can be trapped.
All-optical quantum computing with a hybrid solid-state processing unit
International Nuclear Information System (INIS)
Pei Pei; Zhang Fengyang; Li Chong; Song Heshan
2011-01-01
We develop an architecture of a hybrid quantum solid-state processing unit for universal quantum computing. The architecture allows distant and nonidentical solid-state qubits in distinct physical systems to interact and work collaboratively. All the quantum computing procedures are controlled by optical methods using classical fields and cavity QED. Our methods have a prominent advantage of the insensitivity to dissipation process benefiting from the virtual excitation of subsystems. Moreover, the quantum nondemolition measurements and state transfer for the solid-state qubits are proposed. The architecture opens promising perspectives for implementing scalable quantum computation in a broader sense that different solid-state systems can merge and be integrated into one quantum processor afterward.
International Nuclear Information System (INIS)
Dverstorp, Bjorrn
2007-09-01
This report presents SSI's review of the Swedish Nuclear Fuel and Waste Management Co's (SKB) report (SKB Report 06-64) on large-scale groundwater flow modelling for eastern Smaaland in Sweden. SSI review is supported by two external review documents (included as appendices). SSI's review is part of a government decided consultation process on SKB's site investigations aimed at finding a suitable site for a spent nuclear fuel repository. SSI considers that SKB has presented a comprehensive study that contributes to the scientific understanding of how different factors influence the regional groundwater flow pattern. However, in SSI's opinion, SKB's evaluation of the modelling results is not complete enough to support SKB's conclusion that super regional flow conditions can be dismissed as a siting factor. SSI therefore recommends SKB to supplement their study in that respect and also to discuss the implications of identified differences in radionuclide travel times and migration distances on the overall assessment of the repository's longterm protective capability. SSI also recommends SKB to revisit some of their modelling assumptions to ensure that the model is set up in a way that does not block out large groundwater circulation cells. SSI's recommendations in this review should be regarded as guidance to SKB. SSI will make a formal assessment of how SKB has taken into account different siting factors, in connection with the review of SKB's license application to be submitted in 2009
20 CFR 416.250 - Experimental, pilot, and demonstration projects in the SSI program.
2010-04-01
... administration of the SSI program. These projects will test the advantages of altering certain requirements... demonstration project will have a termination date (up to 10 years from the start of the project). [48 FR 7576...
Structural and dynamic properties of solid state ionics
International Nuclear Information System (INIS)
Sakuma, T.
1995-01-01
The structural and dynamic properties of solid state ionics are reviewed. The low temperature phase transition of the copper halide-chalcogen compounds by specific heat measurements, electrical conductivity measurements and x-ray diffraction measurements are explained. The structures of solid state ionics investigated by the usual x-ray diffraction method and the anomalous x-ray scattering (AXS) measurement are discussed. The expression of the diffuse scattering intensity including the correlations among the thermal displacements of atoms has been given and applied to α-AgI type solid state ionics and lithium sulphate. The presence of low-energy excitations in crystalline copper ion conductors and the superionic conducting glass is investigated by neutron inelastic scattering measurements. The relation between the excitation energy and the mass of the cations is discussed. (author). 141 refs., 21 figs., 7 tabs
Advances in Solid State Physics
Haug, Rolf
2009-01-01
The present volume 48 of the Advances in Solid State Physics contains the written version of a large number of the invited talks of the 2008 Spring Meeting of the DPG section Condensed Matter Physics (Sektion kondensierte Materie der DPG) which was held in Berlin, Germany, and gives a nice overview of the present status of condensed matter physics. Low-dimensional systems are dominating the field and especially nanowires and quantum dots. In recent years one learned how to produce nanowires directly during a growth process. Therefore, a number of articles is related to such nanowires. In nanoparticles and quantum dots, the dimensionality is further reduced and we learn more and more how to produce such systems in a defined way and what effects result from the confinement in all three dimensions. Spin effects and magnetism is another important field of present-day research in solid state physics. The third chapter covers this physics. The growing interest into organic materials and biological systems is reflec...
Theory of the l-state population of Rydberg states formed in ion-solid collisions
International Nuclear Information System (INIS)
Kemmler, J.; Burgdoerfer, J.; Reinhold, C.O.
1991-01-01
The experimentally observed high-l-state population of ions excited in ion-solid interactions differs sharply from l-state populations produced in ion-atom collisions. We have studied the population dynamics of electronic excitation and transport within the framework of a classical transport theory for O 2+ (2-MeV/u) ions traversing C foils. The resulting delayed-photon-emission intensities are found to be in very good agreement with experiment. Initial phase-space conditions have been obtained from both classical-trajectory Monte Carlo calculations and random initial distributions. We find evidence that the very-high-l-state populations produced in ion-solid collisions are the result of a diffusion to high-l states under the influence of multiple scattering in the bulk of the solid
International Nuclear Information System (INIS)
Ermutlu, H.E.
1993-01-01
In order to fulfill the seismic safety requirements, in the frame of seismic requalification activities for NPP Muehleberg, Switzerland, detailed seismic analysis performed on the Reactor Building and the results are presented previously. The primary objective of the present investigation is to assess the seismic safety of the reinforced concrete structures of reactor building. To achieve this objective requires a rather detailed 3-D finite element modeling for the outer shell structures, the drywell, the reactor pools, the floor decks and finally, the basemat. This already is a complicated task, which enforces need for simplifications in modelling the reactor internals and the foundation soil. Accordingly, all internal parts are modelled by vertical sticks and the Soil Structure Interaction (SSI) effects are represented by sets of transitional and higher order rotational WINKLER springs, i.e. avoiding complicated finite element SSI analysis. As a matter of fact, the availability of the results of recent investigations carried out on the reactor building using diversive finite element SSI analysis methods allow to calibrate the WINKLER springs, ensuring that the overall SSI behaviour of the reactor building is maintained
International Nuclear Information System (INIS)
Llambias, J.M.
1993-01-01
The seismic loading information for use in the seismic design of equipment and minor structures within a nuclear power plant is determined from a dynamic response analysis of the building in which they are located. This dynamic response analysis needs to capture the global response of both the building structure and adjacent soil and is commonly referred to as a soil structure interaction (SSI) analysis. NNC have developed a simple and cost effective methodology for the seismic SSI analysis of buildings in a PWR nuclear power station at a UK soft site. This paper outlines the NNC methodology and describes the approach adopted for its validation
Solid state NMR studies for a new carbonization process with high temperature preheating
Saito, Koji; Hatakeyama, Moriaki; Komaki, Ikuo; Katoh, Kenji
2002-01-01
A new carbonization process with rapid preheating and coke discharging at medium temperature has been developed in Japan. The result of this process shows that even when no or slightly coking coal is by 50 wt% the coking property is improved and a coking coke with cold strength usable at blast furnace can be manufactured with the new carbonization process. The mechanism of the coking property improvement was examined by coal properties using mainly solid state NMR ( 1H CRAMPS and 13C SPE/MAS, CP/MAS) and NMR imaging (single point imaging, in-situ imaging). It has been clarified that the molecular structure of coal is relaxed by the rapid heating treatment and, in addition, there is a close relation between hydrogen bonding and relaxation of the molecular structure of coal.
Solid State Inflation Balloon Active Deorbiter
National Aeronautics and Space Administration — The Solid State Inflation Balloon (SSIB) is a simple, reliable, low-cost, non-propulsive system for deliberate deorbit and control of downrange point-of-impact that...
Directory of Open Access Journals (Sweden)
Tanushree Ghosh
2017-11-01
Full Text Available Conventional ion-selective electrodes with a liquid junction have the disadvantage of potential drift. All-solid-state ion-selective electrodes with solid contact in between the metal electrode and the ion-selective membrane offer high capacitance or conductance to enhance potential stability. Solution-casted chitosan/Prussian blue nanocomposite (ChPBN was employed as the solid contact layer for an all-solid-state sodium ion-selective electrode in a potentiometric sodium ion sensor. Morphological and chemical analyses confirmed that the ChPBN is a macroporous network of chitosan that contains abundant Prussian blue nanoparticles. Situated between a screen-printed carbon electrode and a sodium-ionophore-filled polyvinylchloride ion-selective membrane, the ChPBN layer exhibited high redox capacitance and fast charge transfer capability, which significantly enhanced the performance of the sodium ion-selective electrode. A good Nernstian response with a slope of 52.4 mV/decade in the linear range from 10−4–1 M of NaCl was observed. The stability of the electrical potential of the new solid contact was tested by chronopotentiometry, and the capacitance of the electrode was 154 ± 4 µF. The response stability in terms of potential drift was excellent (1.3 µV/h for 20 h of continuous measurement. The ChPBN proved to be an efficient solid contact to enhance the potential stability of the all-solid-state ion-selective electrode.
by a solid-state metathesis approach
Indian Academy of Sciences (India)
Wintec
Department of Mechanical Engineering,. † ... A solid-state metathesis approach initiated by microwave energy has been successfully applied for ... and chemical properties of synthesized powders are determined by powder X-ray diffraction, ...
Solid state protein monolayers: Morphological, conformational, and functional properties
Pompa, P. P.; Biasco, A.; Frascerra, V.; Calabi, F.; Cingolani, R.; Rinaldi, R.; Verbeet, M. Ph.; de Waal, E.; Canters, G. W.
2004-12-01
We have studied the morphological, conformational, and electron-transfer (ET) function of the metalloprotein azurin in the solid state, by a combination of physical investigation methods, namely atomic force microscopy, intrinsic fluorescence spectroscopy, and scanning tunneling microscopy. We demonstrate that a "solid state protein film" maintains its nativelike conformation and ET function, even after removal of the aqueous solvent.
Solid State Division progress report, September 30, 1981
Energy Technology Data Exchange (ETDEWEB)
1982-04-01
Progress made during the 19 months from March 1, 1980, through September 30, 1981, is reported in the following areas: theoretical solid state physics (surfaces, electronic and magnetic properties, particle-solid interactions, and laser annealing); surface and near-surface properties of solids (plasma materials interactions, ion-solid interactions, pulsed laser annealing, and semiconductor physics and photovoltaic conversion); defects in solids (radiation effects, fracture, and defects and impurities in insulating crystals); transport properties of solids (fast-ion conductors, superconductivity, and physical properties of insulating materials); neutron scattering (small-angle scattering, lattice dynamics, and magnetic properties); crystal growth and characterization (nuclear waste forms, ferroelectric mateirals, high-temperature materials, and special materials); and isotope research materials. Publications and papers are listed. (WHK)
Solid State Division progress report, September 30, 1981
International Nuclear Information System (INIS)
1982-04-01
Progress made during the 19 months from March 1, 1980, through September 30, 1981, is reported in the following areas: theoretical solid state physics (surfaces, electronic and magnetic properties, particle-solid interactions, and laser annealing); surface and near-surface properties of solids (plasma materials interactions, ion-solid interactions, pulsed laser annealing, and semiconductor physics and photovoltaic conversion); defects in solids (radiation effects, fracture, and defects and impurities in insulating crystals); transport properties of solids (fast-ion conductors, superconductivity, and physical properties of insulating materials); neutron scattering (small-angle scattering, lattice dynamics, and magnetic properties); crystal growth and characterization (nuclear waste forms, ferroelectric mateirals, high-temperature materials, and special materials); and isotope research materials. Publications and papers are listed
Topologically distinct classes of valence-bond solid states with their parent Hamiltonians
International Nuclear Information System (INIS)
Tu Honghao; Zhang Guangming; Xiang Tao; Liu Zhengxin; Ng Taikai
2009-01-01
We present a general method to construct one-dimensional translationally invariant valence-bond solid states with a built-in Lie group G and derive their matrix product representations. The general strategies to find their parent Hamiltonians are provided so that the valence-bond solid states are their unique ground states. For quantum integer-spin-S chains, we discuss two topologically distinct classes of valence-bond solid states: one consists of two virtual SU(2) spin-J variables in each site and another is formed by using two SO(2S+1) spinors. Among them, a spin-1 fermionic valence-bond solid state, its parent Hamiltonian, and its properties are discussed in detail. Moreover, two types of valence-bond solid states with SO(5) symmetries are further generalized and their respective properties are analyzed as well.
Radiation-chemical aspects of solid state hot atom chemistry
International Nuclear Information System (INIS)
Matsuura, T.; Collins, K.E.; Collins, C.H.
1984-01-01
The study of nuclear hot atom chemical (NHAC) processes occurring in solids is seriously limited by the lack of adequate methods for directly studying the chemical species containing hot atoms. In the present review the effects of ionizing radiation on parent and non-parent yields from solid state targets is surveyed and qualitative interpretations are given. After a few general remarks of the relationship of radiation chemistry to solid state NHAC, a detailed description of the radiation effects is given (radiation annealing, neutron activation, changes in separable yield). (Auth.)
Solid State Division: Progress report for period ending September 30, 1987
Energy Technology Data Exchange (ETDEWEB)
Green, P.H.; Watson, D.M. (eds.)
1988-03-01
This paper contains a collection of articles on research done at the Solid State Division of ORNL. General topics covered are: theoretical solid state physics; neutron scattering; physical properties of superconductors and ceramics; synthesis and characterization of solids; ion beam and laser processing; and surface and defect studies. (LSP)
Solid State Division: Progress report for period ending September 30, 1987
International Nuclear Information System (INIS)
Green, P.H.; Watson, D.M.
1988-03-01
This paper contains a collection of articles on research done at the Solid State Division of ORNL. General topics covered are: theoretical solid state physics; neutron scattering; physical properties of superconductors and ceramics; synthesis and characterization of solids; ion beam and laser processing; and surface and defect studies
Yu, C.; Ganapathy, S.; van Eck, Ernst R H; Wang, H.; Basak, S.; Li, Z.; Wagemaker, M.
2017-01-01
Solid-state batteries potentially offer increased lithium-ion battery energy density and safety as required for large-scale production of electrical vehicles. One of the key challenges toward high-performance solid-state batteries is the large impedance posed by the electrode-electrolyte
Solid-State Spectroscopy An Introduction
Kuzmany, Hans
2009-01-01
Spectroscopic methods have opened up a new horizon in our knowledge of solid-state materials. Numerous techniques using electromagnetic radiation or charged and neutral particles have been invented and worked out to a high level in order to provide more detailed information on the solids. The text presented here is an updated description of such methods as they were originally presented in the first edition. It covers linear response of solids to electromagnetic radiation in a frequency range extending from megahertz or gigahertz as used in spin resonance spectroscopy, to infrared spectroscopy and various forms of spectroscopy in the visible and near visible spectral range. It extends to spectroscopy in the UV and x-ray spectral range and eventually several spectroscopic methods are addressed in the frequency range of g radiation. Likewise linear response to irradiation with particles such as electrons, positrons, muons, neutrons, and atoms is discussed. Instrumental and technical background is provided as we...
Solid State Electrochemical DeNOx
DEFF Research Database (Denmark)
Kammer Hansen, Kent
2010-01-01
The literature on direct electrochemical reduction of NOx in a solid state cell has been reviewed. It is shown that that the reduction of nitric oxide either occurs on the electrode or on the electrolyte if F-centers are formed. It is also shown that some oxide based electrodes has a high apparent...
High-power, solid-state rf source for accelerator cavities
International Nuclear Information System (INIS)
Vaughan, D.R.; Mols, G.E.; Reid, D.W.; Potter, J.M.
1985-01-01
During the past few years the Defense and Electronics Center of Westinghouse Electric Corporation has developed a solid-state, 250-kW peak, rf amplifier for use with the SPS-40 radar system. This system has a pulse length of 60 μs and operates across the frequency band from 400 to 450 MHz. Because of the potential use of such a system as an rf source for accelerator applications, a collaborative experiment was initiated between Los Alamos National Laboratory and Westinghouse to simulate the resonant load conditions of an accelerator cavity. This paper describes the positive results of that experiment as well as the solid-state amplifier architecture. It also explores the future of high-power, solid-state amplifiers as rf sources for accelerator structures
SSI's International Development Co-operation (SIUS). Annual report 1998
International Nuclear Information System (INIS)
Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar
1999-04-01
SSI's International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998
High Reversibility of Soft Electrode Materials in All-solid-state Batteries
Directory of Open Access Journals (Sweden)
Atsushi eSakuda
2016-05-01
Full Text Available All-solid-state batteries using inorganic solid electrolytes (SEs are considered to be ideal batteries for electric vehicles (EVs and plug-in hybrid electric vehicles (PHEVs because they are potentially safer than conventional lithium-ion batteries (LIBs. In addition, all-solid-state batteries are expected to have long battery lives owing to the inhibition of chemical side reactions because only lithium ions move through the typically used inorganic SEs. The development of high-energy (more than 300 Wh kg-1 secondary batteries has been eagerly anticipated for years. The application of high-capacity electrode active materials is essential for fabricating such batteries. Recently, we proposed metal polysulfides as new electrode materials. These materials show higher conductivity and density than sulfur, which is advantageous for fabricating batteries with relatively higher energy density. Lithium niobium sulfides, such as Li3NbS4, have relatively high density, conductivity, and rate capability among metal polysulfide materials, and batteries with these materials have capacities high enough to potentially exceed the gravimetric energy density of conventional LIBs.Favorable solid-solid contact between the electrode and electrolyte particles is a key factor for fabricating high performance all-solid-state batteries. Conventional oxide-based positive electrode materials tend to be given rise to cracks during fabrication and/or charge-discharge processes. Here we report all-solid-state cells using lithium niobium sulfide as a positive electrode material, where favorable solid-solid contact was established by using lithium sulfide electrode materials because of their high processability. Cracks were barely observed in the electrode particles in the all-solid-state cells before or after charging and discharging with a high capacity of approx. 400 mAh g-1, suggesting that the lithium niobium sulfide electrode charged and discharged without experiencing
Quantum technologies for solid state physics using cold trapped ions
International Nuclear Information System (INIS)
Ferdinand Schmidt-Kaler
2014-01-01
The quantum states of ions are perfectly controlled, and may be used for fundamental research in quantum physics, as highlighted by the Nobel Prize given to Dave Wineland in 2012. Two directions of quantum technologies, followed by the Mainz group, have high impact on solid state physics: I) The delivery of single cold ions on demand for the deterministic doping of solid state materials with nm spatial precision to generate design-structures optimized for quantum processors. II) The simulation of solid state relevant Hamiltonians with AMO systems of one or two dimensional arrays of trapped ions. I will talk about the recent progress in both fields. http://www.quantenbit.de/#Number Sign#/publications/(author)
Solid-state nanopores for scanning single molecules and mimicking biology
Kowalczyk, S.W.
2011-01-01
Solid-state nanopores, nanometer-size holes in a thin synthetic membrane, are a versatile tool for the detection and manipulation of charged biomolecules. This thesis describes mostly experimental work on DNA translocation through solid-state nanopores, which we study at the single-molecule level.
K. S. Krishnan Memorial Lecture: The role of crystallography in solid state physics
Energy Technology Data Exchange (ETDEWEB)
Guinier, A [Paris-11 Univ., 91 - Orsay (France)
1977-06-01
The role of crystallography in solving problems in solid state physics, is explained. A few domains in solid state physics such as detection of localized defects, structure of metallic solid solutions, mechanism of phase transitions and the intermediate states between crystalline and amorphous states, have been investigated successfully by X-ray and neutron diffraction methods. The studies have helped a deeper understanding of solid state phenomena. Structures of CuBa, AlZn, ..beta..-alumina etc. are discussed.
Emerging applications of spark plasma sintering in all solid-state lithium-ion batteries and beyond
Zhu, Hongzheng; Liu, Jian
2018-07-01
Solid-state batteries have received increasing attention due to their high safety aspect and high energy and power densities. However, the development of solid-state batteries is hindered by inferior solid-solid interfaces between the solid-state electrolyte and electrode, which cause high interfacial resistance, reduced Li-ion and electron transfer rate, and limited battery performance. Recently, spark plasma sintering (SPS) is emerging as a promising technique for fabricating solid-state electrolyte and electrode pellets with clean and intimate solid-solid interfaces. During the SPS process, the unique reaction mechanism through the combination of current, pressure and high heating rate allow the formation of desirable solid-solid interfaces between active material particles. Herein, this work focuses on the overview of the application of SPS for fabricating solid-state electrolyte and electrode in all solid-state Li-ion batteries, and beyond, such as solid-state Li-S and Na-ion batteries. The correlations among SPS parameters, interfacial resistance, and electrochemical properties of solid-state electrolytes and electrodes are discussed for different material systems. In the end, we point out future opportunities and challenges associated with SPS application in the hot area of solid-state batteries. It is expected that this timely review will stimulate more fundamental and applied research in the development of solid-state batteries by SPS.
International Nuclear Information System (INIS)
Azad, N.; Ghanbari Shohany, B.; Hosseini, S. M.; Kompany, A.
2011-01-01
In this research, NTC thermistors with composition of NiMn 2-x Co x O 4 (x = 0.4, 0.8, 1.2, 1.6) prepared by two methods: solid state reaction and sol-gel (gel-combustion). The average particle size was monitored and structure of the calcinated powders have been investigated using x-ray diffraction and tunneling electron microscopy techniques. The average particle size was estimated to be about 65 nm with the cubic and cubic + tetragonal phases for low and high cobalt concentrations, respectively. The grain size of samples verifies with scanning electron microscopy images. Upon increasing the cobalt fraction, the grain size of samples increases from about 2μm to a few μm in size. The electrical properties of these thermistors depend on the grain size. The grain size of samples made from sol-gel is smaller than from solid state reaction under the same condition. For longer sintering time of the samples prepared by gel-combustion method, the grain size was increased then the electrical parameters of nano powder improved and we obtain better results than the samples prepared from solid state reaction.
Fatty acids polymorphism and solid-state miscibility
Energy Technology Data Exchange (ETDEWEB)
Gbabode, Gabin [Centre de Physique Moleculaire Optique et Hertzienne, Universite Bordeaux I, 33405 Talence (France)], E-mail: ggbabode@ulb.ac.be; Negrier, Philippe; Mondieig, Denise [Centre de Physique Moleculaire Optique et Hertzienne, Universite Bordeaux I, 33405 Talence (France); Moreno, Evelyn; Calvet, Teresa; Cuevas-Diarte, Miquel Angel [Departament de Cristallografia, Mineralogia i Diposits Minerals, Universitat de Barcelona, 08028 Barcelona (Spain)
2009-02-05
The pentadecanoic acid-hexadecanoic acid (C{sub 15}H{sub 29}OOH-C{sub 16}H{sub 31}OOH) binary system is dealt with in this article. The polymorphism of 20 mixed materials has been investigated combining calorimetric measurements, isothermal and versus temperature X-ray powder diffraction and also FTIR spectroscopy. In particular, the cell parameters of the stable forms, temperatures and heats of phase changes for the two constituents and a proposal of phase diagram are given in this article. Three solid forms are created by mixing in addition with the four solid forms of the pure components. All these solid forms are stabilized on narrow domains of composition, implying a reduced solid-state miscibility of the pentadecanoic and hexadecanoic acids.
Solid State Division Progress Report for period ending March 31, 1986
International Nuclear Information System (INIS)
Green, P.H.; Watson, D.M.
1986-08-01
This report is divided into: theoretical solid-state physics, surface and near-surface properties of solids, defects in solids, transport properties of solids, neutron scattering, and synthesis and properties of novel materials
Solid-state cultivation of Chaetomium cellulolyticum on alkali-pretreated sawdust
Energy Technology Data Exchange (ETDEWEB)
Pamment, N; Robinson, C W; Hilton, J; Moo-Young, M
1978-11-01
Solid-state fermentations (78% initial moisture content) of alkali-pretreated Eastern Hard Maple sawdust were conducted in tray and tumble fermentors using Chaetomium cellulolyticum. Crude protein content of the solids rose from 0.9 to 11% in the tray fermentor and 8% in the tumble fermentor in 20 days. These levels were almost equal to those achieved in corresponding slurry-state fermentations (1 to 5% (w/v)) of the same substrate. Specific growth rates were two to four times lower in the solid-state fermentors but this was offset by their greater solids-handling capacity: the rate of protein production per unit volume of fermentation mixture was comparable to that of the 5% (w/v) slurry and two to three times higher than that of the 1% (w/v) slurry.
Solid-State Modulators for RF And Fast Kickers
Energy Technology Data Exchange (ETDEWEB)
Cook, E.G.; Akana, G.L.; Gower, E.J.; Hawkins, S.A.; Hickman, B.C.; /LLNL, Livermore; Brooksby, C.A.; /NONE - BECHTEL NEVADA LAS VEGAS; Cassel, R.L.; de Lamare, J.E.; Nguyen, M.N.; Pappas, G.C.; /SLAC
2006-03-14
As the switching capabilities of solid-state devices increase, these devices are being incorporated into modulator designs for high voltage accelerator applications. Solid-state modulators based on inductive adder circuit topology have demonstrated great versatility with regard to pulse width and pulse repetition rate while maintaining fast pulse rise and fall times. Additionally, these modulators are capable of being scaled to higher output voltage and power levels. An explanation of the basic circuit operation will be presented as well as test data of several different hardware systems.
SOLID-STATE MODULATORS FOR RF AND FAST KICKERS
International Nuclear Information System (INIS)
Cook, E G; Akana, G; Gower, E J; Hawkins, S A; Hickman, B C; Brooksby, C A; Cassel, R L; De Lamare, J E; Nguyen, M N; Pappas, G C
2005-01-01
As the switching capabilities of solid-state devices increase, these devices are being incorporated into modulator designs for high voltage accelerator applications. Solid-state modulators based on inductive adder circuit topology have demonstrated great versatility with regard to pulse width and pulse repetition rate while maintaining fast pulse rise and fall times. Additionally, these modulators are capable of being scaled to higher output voltage and power levels. An explanation of the basic circuit operation will be presented as well as test data of several different hardware systems
SOLID-STATE MODULATORS FOR RF AND FAST KICKERS
Energy Technology Data Exchange (ETDEWEB)
Cook, E G; Akana, G; Gower, E J; Hawkins, S A; Hickman, B C; Brooksby, C A; Cassel, R L; De Lamare, J E; Nguyen, M N; Pappas, G C
2005-05-05
As the switching capabilities of solid-state devices increase, these devices are being incorporated into modulator designs for high voltage accelerator applications. Solid-state modulators based on inductive adder circuit topology have demonstrated great versatility with regard to pulse width and pulse repetition rate while maintaining fast pulse rise and fall times. Additionally, these modulators are capable of being scaled to higher output voltage and power levels. An explanation of the basic circuit operation will be presented as well as test data of several different hardware systems.
Solid-State Modulators for RF and Fast Kickers
Cook, Edward; Brooksby, Craig A; Cassel, Richard; De Lamare, Jeffrey E; Gower, Edward J; Hawkins, Steven; Hickman, Bradley C; Nguyen, Minh N; Pappas, Chris
2005-01-01
As the capabilities of solid-state devices increase, these devices are being incorporated into modulator designs for high voltage accelerator applications. Solid-state modulators based on inductive adder circuit topology have demonstrated great versatility with regard to pulse width and pulse repetition rate while maintaining fast pulse rise and fall times. Additionally, these modulators are capable of being scaled to higher output voltage and power levels. An explanation of the basic circuit operation will be presented as well as test data of several different hardware systems.
Challenges and perspectives of garnet solid electrolytes for all solid-state lithium batteries
Liu, Qi; Geng, Zhen; Han, Cuiping; Fu, Yongzhu; Li, Song; He, Yan-bing; Kang, Feiyu; Li, Baohua
2018-06-01
Garnet Li7La3Zr2O12 (LLZO) solid electrolytes recently have attracted tremendous interest as they have the potential to enable all solid-state lithium batteries (ASSLBs) owing to high ionic conductivity (10-3 to 10-4 S cm-1), negligible electronic transport, wide potential window (up to 9 V), and good chemical stability. Here we present the key issues and challenges of LLZO in the aspects of ion conduction property, interfacial compatibility, and stability in air. First, different preparation methods of LLZO are reviewed. Then, recent progress about the improvement of ionic conductivity and interfacial property between LLZO and electrodes are presented. Finally, we list some emerging LLZO-based solid-state batteries and provide perspectives for further research. The aim of this review is to summarize the up-to-date developments of LLZO and lead the direction for future development which could enable LLZO-based ASSLBs.
Sintered Cathodes for All-Solid-State Structural Lithium-Ion Batteries
Huddleston, William; Dynys, Frederick; Sehirlioglu, Alp
2017-01-01
All-solid-state structural lithium ion batteries serve as both structural load-bearing components and as electrical energy storage devices to achieve system level weight savings in aerospace and other transportation applications. This multifunctional design goal is critical for the realization of next generation hybrid or all-electric propulsion systems. Additionally, transitioning to solid state technology improves upon battery safety from previous volatile architectures. This research established baseline solid state processing conditions and performance benchmarks for intercalation-type layered oxide materials for multifunctional application. Under consideration were lithium cobalt oxide and lithium nickel manganese cobalt oxide. Pertinent characteristics such as electrical conductivity, strength, chemical stability, and microstructure were characterized for future application in all-solid-state structural battery cathodes. The study includes characterization by XRD, ICP, SEM, ring-on-ring mechanical testing, and electrical impedance spectroscopy to elucidate optimal processing parameters, material characteristics, and multifunctional performance benchmarks. These findings provide initial conditions for implementing existing cathode materials in load bearing applications.
Solid State Division Progress Report for period ending March 31, 1986
Energy Technology Data Exchange (ETDEWEB)
Green, P.H.; Watson, D.M. (eds.)
1986-08-01
This report is divided into: theoretical solid-state physics, surface and near-surface properties of solids, defects in solids, transport properties of solids, neutron scattering, and synthesis and properties of novel materials. (DLC)
International Nuclear Information System (INIS)
Gunarwan Prayitno; Ahmad Rifai
2010-01-01
Much has been charged particle detector radiation detector made by the industry, especially those engaged in the development of detection equipment and components. The development and further research will be made solid state detector with silicon material. To be able to detect charged particles (radiation), required the processing of silicon material into the detector material. The method used to make silicon detector material is a lithium evaporations. Having formed an intrinsic region contactor installation process, and with testing. (author)
Assessment of all-solid-state lithium-ion batteries
Braun, P.; Uhlmann, C.; Weiss, M.; Weber, A.; Ivers-Tiffée, E.
2018-07-01
All-solid-state lithium-ion batteries (ASSBs) are considered as next generation energy storage systems. A model might be very useful, which describes all contributions to the internal cell resistance, enables an optimization of the cell design, and calculates the performance of an open choice of cell architectures. A newly developed one-dimensional model for ASSBs is presented, based on a design concept which employs the use of composite electrodes. The internal cell resistance is calculated by linking two-phase transmission line models representing the composite electrodes with an ohmic resistance representing the solid electrolyte (separator). Thereby, electrical parameters, i.e. ionic and electronic conductivity, electrochemical parameters, i.e. charge-transfer resistance at interfaces and lithium solid-state diffusion, and microstructure parameters, i.e. electrode thickness, particle size, interface area, phase composition and tortuosity, are considered as the most important material and design parameters. Subsequently, discharge curves are simulated, and energy- and power-density characteristics of all-solid-state cell architectures are calculated. These model calculations are discussed and compared with experimental data from literature for a high power LiCoO2-Li10GeP2S12/Li10GeP2S12/Li4Ti5O12-Li10GeP2S12 cell.
SOLID STATE ENERGY CONVERSION ALLIANCE (SECA) SOLID OXIDE FUEL CELL PROGRAM
Energy Technology Data Exchange (ETDEWEB)
Unknown
2003-06-01
This report summarizes the progress made during the September 2001-March 2002 reporting period under Cooperative Agreement DE-FC26-01NT41245 for the U. S. Department of Energy, National Energy Technology Laboratory (DOE/NETL) entitled ''Solid State Energy Conversion Alliance (SECA) Solid Oxide Fuel Cell Program''. The program focuses on the development of a low-cost, high-performance 3-to-10-kW solid oxide fuel cell (SOFC) system suitable for a broad spectrum of power-generation applications. The overall objective of the program is to demonstrate a modular SOFC system that can be configured to create highly efficient, cost-competitive, and environmentally benign power plants tailored to specific markets. When fully developed, the system will meet the efficiency, performance, life, and cost goals for future commercial power plants.
Renormalization methods in solid state physics
Energy Technology Data Exchange (ETDEWEB)
Nozieres, P [Institut Max von Laue - Paul Langevin, 38 - Grenoble (France)
1976-01-01
Renormalization methods in various solid state problems (e.g., the Kondo effect) are analyzed from a qualitative vantage point. Our goal is to show how the renormalization procedure works, and to uncover a few simple general ideas (universality, phenomenological descriptions, etc...).
Hyperspectral imaging applied to complex particulate solids systems
Bonifazi, Giuseppe; Serranti, Silvia
2008-04-01
HyperSpectral Imaging (HSI) is based on the utilization of an integrated hardware and software (HW&SW) platform embedding conventional imaging and spectroscopy to attain both spatial and spectral information from an object. Although HSI was originally developed for remote sensing, it has recently emerged as a powerful process analytical tool, for non-destructive analysis, in many research and industrial sectors. The possibility to apply on-line HSI based techniques in order to identify and quantify specific particulate solid systems characteristics is presented and critically evaluated. The originally developed HSI based logics can be profitably applied in order to develop fast, reliable and lowcost strategies for: i) quality control of particulate products that must comply with specific chemical, physical and biological constraints, ii) performance evaluation of manufacturing strategies related to processing chains and/or realtime tuning of operative variables and iii) classification-sorting actions addressed to recognize and separate different particulate solid products. Case studies, related to recent advances in the application of HSI to different industrial sectors, as agriculture, food, pharmaceuticals, solid waste handling and recycling, etc. and addressed to specific goals as contaminant detection, defect identification, constituent analysis and quality evaluation are described, according to authors' originally developed application.
What would Edison do with solid state lighting?
Ferguson, Ian T.; Melton, Andrew; Xu, Tianming; Jamil, Muhammad; Fenwick, Will
2010-08-01
Thomas Edison is widely regarded as the greatest inventor in history and the most prominent individual behind the invention of the electric light. His impressive characteristics as an individual that led to his amazing success as an innovator continue to be an inspiration for researchers today. This paper considers how Edison might proceed in developing solid state lighting into a technology capable of displacing incumbent light sources, including his own incandescent lamps, then reviews some of the "Edison-like" contributions made to solid state lighting by the Next Generation Lighting research program at Georgia Tech.
The LiBH4-LiI Solid Solution as an Electrolyte in an All-Solid-State Battery
DEFF Research Database (Denmark)
Sveinbjörnsson, Dadi Þorsteinn; Christiansen, Ane Sælland; Viskinde, Rasmus
2014-01-01
The charge and discharge performance of an all-solid-state lithium battery with the LiBH4-LiI solid solution as an electrolyte is reported. Lithium titanate (Li4Ti5O12) was used as the positive electrode and lithium metal as the negative electrode. The performance of the all-solid-state cell...
''Solid-state fusion'' effects
International Nuclear Information System (INIS)
Thompson, D.T.
1990-01-01
The ''Solid-State Fusion'' or ''Cold Fusion'' phenomenon, including excess heat generation and the production of nuclear particles, was first reported by Professors Martin Fleischmann and B. Stanley Pons in March 1989. The phenomenon described (the anomalous effects observed when deuterium oxide (heavy water) is electrolysed using a palladium cathode and a platinum anode in the presence of lithium deuteroxide) has many fascinating facets, not least of which is the fact that investigators are unable to produce the effects ''on demand''. Many of the experimental variables which seem to be significant were described and discussed at the ''First Annual Conference on Cold Fusion'' which was held in Salt Lake City, Utah, USA, from 29th to 31st March 1990. The information presented at the conference is summarised here. Some papers addressed the excess heat effects observed, some the nuclear particles, and others the theoretical aspects. These are reviewed. At the end of the conference Fleischmann summarised all the areas where apparent evidence for solid state fusion had been obtained during the past year, namely: excess enthalpy, bursts in enthalpy; tritium, bursts in tritium; neutrons, bursts in neutrons; X-rays, gamma rays and bursts in these. He recommended that emphasis should now be concentrated on confirming reaction products, such as He 4 . New theories were emerging, but one year was too short a time in which to evaluate them fully. (author)
International Nuclear Information System (INIS)
Jaross, R.A.
1983-09-01
An assessment of the reliability of solid-state motor controllers for nuclear power plants is made. Available data on failure-rate and failure-mode data for solid-state motor controllers based on industrial operating experience is meager; the data are augmented by data on other solid-state power electronic devices that are shown to have components similar to those found in solid-state motor controllers. In addition to large nonnuclear solid-state adjustable-speed motor drives, the reliability of nuclear plant inverter systems and high-voltage solid-state dc transmission-line converters is assessed. Licensee Event Report analyses from several sources, the open literature, and personal communications are used to determine the realiability of solid-state devices typical of those expected to be used in nuclear power plants in terms of failures per hour
Kilinc, Ahmet; Demiral, Umit; Kartal, Tezcan
2017-01-01
Teaching socioscientific issues (SSI) necessitates dialogic discourse activities. However, a majority of science teachers prefer monologic discourse in SSI contexts. In addition, some of these teachers are resistant to change (from monologic to dialogic discourse) despite certain professional development attempts. The purpose of the present…
High Energy Solid State Laser Research Facility
Federal Laboratory Consortium — A suite of laboratories with advanced spectroscopic and laser equipment, this facility develops materials and techniques for advanced solid state high energy lasers....
Pulsed Power for Solid-State Lasers
Energy Technology Data Exchange (ETDEWEB)
Gagnon, W; Albrecht, G; Trenholme, J; Newton, M
2007-04-19
Beginning in the early 1970s, a number of research and development efforts were undertaken at U.S. National Laboratories with a goal of developing high power lasers whose characteristics were suitable for investigating the feasibility of laser-driven fusion. A number of different laser systems were developed and tested at ever larger scale in pursuit of the optimum driver for laser fusion experiments. Each of these systems had associated with it a unique pulsed power option. A considerable amount of original and innovative engineering was carried out in support of these options. Ultimately, the Solid-state Laser approach was selected as the optimum driver for the application. Following this, the Laser Program at the Lawrence Livermore National Laboratory and the University of Rochester undertook aggressive efforts directed at developing the technology. In particular, at Lawrence Livermore National Laboratory, a series of laser systems beginning with the Cyclops laser and culminating in the present with the National Ignition Facility were developed and tested. As a result, a large amount of design information for solid-state laser pulsed power systems has been documented. Some of it is in the form of published papers, but most of it is buried in internal memoranda, engineering reports and LLNL annual reports. One of the goals of this book is to gather this information into a single useable format, such that it is easily accessed and understood by other engineers and physicists for use with future designs. It can also serve as a primer, which when seriously studied, makes the subsequent reading of original work and follow-up references considerably easier. While this book deals only with the solid-state laser pulsed power systems, in the bibliography we have included a representative cross section of papers and references from much of the very fine work carried out at other institutions in support of different laser approaches. Finally, in recent years, there has
International Nuclear Information System (INIS)
Ikonen, K.
1993-07-01
The report describes the work performed for achieving readiness to calculate fracture toughness dependence on dimension effects and loading conditions in fracture test specimens and real structures. In the report two- and three-dimensional computer codes developed and calculational methods applied are described. One of the main goals is to converse fracture toughness from small scale three point bending test specimens to case of a depth crack in plane strain i.e. to small scale yielding state (SSY) by numerical elastic-plastic stress analysis. Thickness effect of a test specimens and effect of a crack depth are separately investigated. Tests of three point bending specimens with and without sidegrooves and curved crack front are numerically simulated and experimental and computed results are compared. J-integral is calculated along crack front and also from force-deflection dependence of the beam. For the analyses the computing system was thoroughly automatized. Measuring capacity of three point bending test specimens was tried to evaluate. (orig.) (7 refs., 54 figs.)
Proceedings of 5. scientific conference on solid state physics. Vol. 2
International Nuclear Information System (INIS)
1999-01-01
The 5. Kazakhstan scientific conference on solid state physics was held on 28-30 October, 1999 in Karaganda. Scientists and researchers from Russian Federation, Kazakhstan, Estonia present various reports on different problems of solid state physics
Phosphate Phosphors for Solid-State Lighting
Shinde, Kartik N; Swart, H C; Park, Kyeongsoon
2012-01-01
The idea for this book arose out of the realization that, although excellent surveys and a phosphor handbook are available, there is no single source covering the area of phosphate based phosphors especially for lamp industry. Moreover, as this field gets only limited attention in most general books on luminescence, there is a clear need for a book in which attention is specifically directed toward this rapidly growing field of solid state lighting and its many applications. This book is aimed at providing a sound introduction to the synthesis and optical characterization of phosphate phosphor for undergraduate and graduate students as well as teachers and researchers. The book provides guidance through the multidisciplinary field of solid state lighting specially phosphate phosphors for beginners, scientists and engineers from universities, research organizations, and especially industry. In order to make it useful for a wide audience, both fundamentals and applications are discussed, together.
Lubach, Joseph W; Hau, Jonathan
2018-02-20
To investigate the nature of drug-excipient interactions between indomethacin (IMC) and methacrylate copolymer Eudragit® E (EE) in the amorphous state, and evaluate the effects on formulation and stability of these amorphous systems. Amorphous solid dispersions containing IMC and EE were spray dried with drug loadings from 20% to 90%. PXRD was used to confirm the amorphous nature of the dispersions, and DSC was used to measure glass transition temperatures (T g ). 13 C and 15 N solid-state NMR was utilized to investigate changes in local structure and protonation state, while 1 H T 1 and T 1ρ relaxation measurements were used to probe miscibility and phase behavior of the dispersions. T g values for IMC-EE solid dispersions showed significant positive deviations from predicted values in the drug loading range of 40-90%, indicating a relatively strong drug-excipient interaction. 15 N solid-state NMR exhibited a change in protonation state of the EE basic amine, with two distinct populations for the EE amine at -360.7 ppm (unprotonated) and -344.4 ppm (protonated). Additionally, 1 H relaxation measurements showed phase separation at high drug load, indicating an amorphous ionic complex and free IMC-rich phase. PXRD data showed all ASDs up to 90% drug load remained physically stable after 2 years. 15 N solid-state NMR experiments show a change in protonation state of EE, indicating that an ionic complex indeed forms between IMC and EE in amorphous solid dispersions. Phase behavior was determined to exhibit nanoscale phase separation at high drug load between the amorphous ionic complex and excess free IMC.
Division of solid state physics
International Nuclear Information System (INIS)
Beckman, O.
1983-09-01
This report gives a survey of the present research projects at the division of solid state physics, Inst. of Technology, Uppsala University. The projects fall within the fields of magnetism, i.e. spin glasses, ordered magnetic structures and itinerant electron magnetism, and optics, i.e. properties of crystalline and amorphous materials for selective transmission and absorption in connection with energy-related research. (author)
Solid-state fermentation: a continuous process for fungal tannase production.
van de Lagemaat, J; Pyle, D L
2004-09-30
Truly continuous solid-state fermentations with operating times of 2-3 weeks were conducted in a prototype bioreactor for the production of fungal (Penicillium glabrum) tannase from a tannin-containing model substrate. Substantial quantities of the enzyme were synthesized throughout the operating periods and (imperfect) steady-state conditions seemed to be achieved soon after start-up of the fermentations. This demonstrated for the first time the possibility of conducting solid-state fermentations in the continuous mode and with a constant noninoculated feed. The operating variables and fermentation conditions in the bioreactor were sufficiently well predicted for the basic reinoculation concept to succeed. However, an incomplete understanding of the microbial mechanisms, the experimental system, and their interaction indicated the need for more research in this novel area of solid-state fermentation. Copyright 2004 Wiley Periodicals, Inc.
Heterogeneous Ferroelectric Solid Solutions Phases and Domain States
Topolov, Vitaly
2012-01-01
The book deals with perovskite-type ferroelectric solid solutions for modern materials science and applications, solving problems of complicated heterophase/domain structures near the morphotropic phase boundary and applications to various systems with morphotropic phases. In this book domain state–interface diagrams are presented for the interpretation of heterophase states in perovskite-type ferroelectric solid solutions. It allows to describe the stress relief in the presence of polydomain phases, the behavior of unit-cell parameters of coexisting phases and the effect of external electric fields. The novelty of the book consists in (i) the first systematization of data about heterophase states and their evolution in ferroelectric solid solutions (ii) the general interpretation of heterophase and domain structures at changing temperature, composition or electric field (iii) the complete analysis of interconnection domain structures, unit-cell parameters changes, heterophase structures and stress relief.
Solid-state NMR studies of form I of atorvastatin calcium.
Wang, Wei David; Gao, Xudong; Strohmeier, Mark; Wang, Wei; Bai, Shi; Dybowski, Cecil
2012-03-22
Solid-state (13)C, (19)F, and (15)N magic angle spinning NMR studies of Form I of atorvastatin calcium are reported, including chemical shift tensors of all resolvable carbon sites and fluorine sites. The complete (13)C and (19)F chemical shift assignments are given based on an extensive analysis of (13)C-(1)H HETCOR and (13)C-(19)F HETCOR results. The solid-state NMR data indicate that the asymmetric unit of this material contains two atorvastatin molecules. A possible structure of Form I of atorvastatin calcium (ATC-I), derived from solid-state NMR data and density functional theory calculations of various structures, is proposed for this important active pharmaceutical ingredient (API).
Microelectronics: Atoms diffusion in solid state. Part 1
International Nuclear Information System (INIS)
Lopez Higuera, J.M.
1988-01-01
The fundamentals on which the technology for the diffusion of impurities in solid state is based, is presented. This technology is widely used to produce controlled and localized concentrations of atoms of the mentioned impurities in base solids in order to obtain those characteristics which may lead to the implementation of electronic, optoelectronic and electrooptic devices. (Author)
Advanced Solid State Lighting for Human Evaluation
National Aeronautics and Space Administration — Lighting intensity and color have a significant impact on human circadian rhythms. Advanced solid state lighting was developed for the Advanced Exploration System...
High power all solid state VUV lasers
International Nuclear Information System (INIS)
Zhang, Shen-jin; Cui, Da-fu; Zhang, Feng-feng; Xu, Zhi; Wang, Zhi-min; Yang, Feng; Zong, Nan; Tu, Wei; Chen, Ying; Xu, Hong-yan; Xu, Feng-liang; Peng, Qin-jun; Wang, Xiao-yang; Chen, Chuang-tian; Xu, Zu-yan
2014-01-01
Highlights: • Polarization and pulse repetition rate adjustable ps 177.3 nm laser was developed. • Wavelength tunable ns, ps and fs VUV lasers were developed. • High power ns 177.3 nm laser with narrow linewidth was investigated. - Abstract: We report the investigation on the high power all solid state vacuum ultra-violet (VUV) lasers by means of nonlinear frequency conversion with KBe 2 BO 3 F 2 (KBBF) nonlinear crystal. Several all solid state VUV lasers have developed in our group, including polarization and pulse repetition rate adjustable picosecond 177.3 nm VUV laser, wavelength tunable nanosecond, picosecond and femtosecond VUV lasers, high power ns 177.3 nm laser with narrow linewidth. The VUV lasers have impact, accurate and precise advantage
Fundamental characteristics of degradation-recoverable solid-state DFB polymer laser.
Yoshioka, Hiroaki; Yang, Yu; Watanabe, Hirofumi; Oki, Yuji
2012-02-13
A novel solid-state dye laser with degradation recovery was proposed and demonstrated. Polydimethylsiloxane was used as a nanoporous solid matrix to enable the internal circulation of dye molecules in the solid state. An internal circulation model for the dye molecules was also proposed and verified numerically by assuming molecular mobility and using a proposed diffusion equation. The durability of the laser was increased 20.5-fold compared with that of a conventional polymethylmethacrylate laser. This novel laser solves the low-durability problem of dye-doped polymer lasers.
Solid-state fermentation - A mini review
Smits, J.P.; Sonsbeek, H.M.; Rinzema, A.; Tramper, J.
1998-01-01
The increasing interests in biotechnology for the application of fungi on the one hand, and for cheap agricultural products on the other, can be combined in so-called solid-state fermentation (SSF). SSF resembles a close to natural habitat for filamentous microorganisms and can be applied to
Solid-state electronic devices an introduction
Papadopoulos, Christo
2014-01-01
A modern and concise treatment of the solid state electronic devices that are fundamental to electronic systems and information technology is provided in this book. The main devices that comprise semiconductor integrated circuits are covered in a clear manner accessible to the wide range of scientific and engineering disciplines that are impacted by this technology. Catering to a wider audience is becoming increasingly important as the field of electronic materials and devices becomes more interdisciplinary, with applications in biology, chemistry and electro-mechanical devices (to name a few) becoming more prevalent. Updated and state-of-the-art advancements are included along with emerging trends in electronic devices and their applications. In addition, an appendix containing the relevant physical background will be included to assist readers from different disciplines and provide a review for those more familiar with the area. Readers of this book can expect to derive a solid foundation for understanding ...
Solid-state single-photon emitters
Aharonovich, Igor; Englund, Dirk; Toth, Milos
2016-10-01
Single-photon emitters play an important role in many leading quantum technologies. There is still no 'ideal' on-demand single-photon emitter, but a plethora of promising material systems have been developed, and several have transitioned from proof-of-concept to engineering efforts with steadily improving performance. Here, we review recent progress in the race towards true single-photon emitters required for a range of quantum information processing applications. We focus on solid-state systems including quantum dots, defects in solids, two-dimensional hosts and carbon nanotubes, as these are well positioned to benefit from recent breakthroughs in nanofabrication and materials growth techniques. We consider the main challenges and key advantages of each platform, with a focus on scalable on-chip integration and fabrication of identical sources on photonic circuits.
Applied solid state science advances in materials and device research
Wolfe, Raymond
2013-01-01
Applied Solid State Science: Advances in Materials and Device Research, Volume 1 presents articles about junction electroluminescence; metal-insulator-semiconductor (MIS) physics; ion implantation in semiconductors; and electron transport through insulating thin films. The book describes the basic physics of carrier injection; energy transfer and recombination mechanisms; state of the art efficiencies; and future prospects for light emitting diodes. The text then discusses solid state spectroscopy, which is the pair spectra observed in gallium phosphide photoluminescence. The extensive studies
Energy Technology Data Exchange (ETDEWEB)
Ko, Do Kyeong; Lee, Jong Min; Cha, Byung Heon; Yi, Jong Hoon; Lee, Kang Soo; Kim, Sung Ho; Lim, Gwon
2000-01-01
We have fabricated solid-state dyes with Copolex NK-55, which is the base element of plastic lens, and PMMA. We have measured the longevity of solid-state dyes doped in both polymers and found that PMMA has better properties than Coploex NK-55. We have realized the tuning range of 560-620 nm by doping rhodamine 6Gand rhodamin B in the manufactured solid-state dye laser oscillators. In the standing-wave cavity we achieved the slop efficiency of 10.8 percent and in the grazing incidence cavity, 1.2 percent. We have constructed a very compact grazing- incidence cavity which is only 6 cm long and the linewidth of the laser was less than 1.5 GHz with 3-ns pulse duration. And we have fabricated disk-type solid-state dye cell and installed it in the cavity in which the dye cell can be translated and rotated with the help of the two steeping motors. By this we could constantly changed the illuminated area of the dye cell and , therefore, were able to achieve long time operation and to use almost the entire region of the solid-state dye cell. (author)
International Nuclear Information System (INIS)
Ko, Do Kyeong; Lee, Jong Min; Cha, Byung Heon; Yi, Jong Hoon; Lee, Kang Soo; Kim, Sung Ho; Lim, Gwon
2000-01-01
We have fabricated solid-state dyes with Copolex NK-55, which is the base element of plastic lens, and PMMA. We have measured the longevity of solid-state dyes doped in both polymers and found that PMMA has better properties than Coploex NK-55. We have realized the tuning range of 560-620 nm by doping rhodamine 6G and rhodamin B in the manufactured solid-state dye laser oscillators. In the standing-wave cavity we achieved the slop efficiency of 10.8 percent and in the grazing incidence cavity, 1.2 percent. We have constructed a very compact grazing- incidence cavity which is only 6 cm long and the linewidth of the laser was less than 1.5 GHz with 3-ns pulse duration. And we have fabricated disk-type solid-state dye cell and installed it in the cavity in which the dye cell can be translated and rotated with the help of the two steeping motors. By this we could constantly changed the illuminated area of the dye cell and , therefore, were able to achieve long time operation and to use almost the entire region of the solid-state dye cell. (author)
Mazaheri, Davood; Shojaosadati, Seyed Abbas; Zamir, Seyed Morteza; Mousavi, Seyyed Mohammad
2018-04-21
In this work, mathematical modeling of ethanol production in solid-state fermentation (SSF) has been done based on the variation in the dry weight of solid medium. This method was previously used for mathematical modeling of enzyme production; however, the model should be modified to predict the production of a volatile compound like ethanol. The experimental results of bioethanol production from the mixture of carob pods and wheat bran by Zymomonas mobilis in SSF were used for the model validation. Exponential and logistic kinetic models were used for modeling the growth of microorganism. In both cases, the model predictions matched well with the experimental results during the exponential growth phase, indicating the good ability of solid medium weight variation method for modeling a volatile product formation in solid-state fermentation. In addition, using logistic model, better predictions were obtained.
40 CFR 256.02 - Scope of the State solid waste management plan.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Scope of the State solid waste management plan. 256.02 Section 256.02 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR DEVELOPMENT AND IMPLEMENTATION OF STATE SOLID WASTE MANAGEMENT PLANS Purpose, General Requirements, Definitions § 256.0...
SOLID STATE ENERGY CONVERSION ALLIANCE (SECA) SOLID OXIDE FUEL CELL PROGRAM
Energy Technology Data Exchange (ETDEWEB)
Nguyen Minh; Jim Powers
2003-10-01
This report summarizes the work performed for April 2003--September 2003 reporting period under Cooperative Agreement DE-FC26-01NT41245 for the U.S. Department of Energy, National Energy Technology Laboratory (DOE/NETL) entitled ''Solid State Energy Conversion Alliance (SECA) Solid oxide Fuel Cell Program''. During this reporting period, the conceptual system design activity was completed. The system design, including strategies for startup, normal operation and shutdown, was defined. Sealant and stack materials for the solid oxide fuel cell (SOFC) stack were identified which are capable of meeting the thermal cycling and degradation requirements. A cell module was tested which achieved a stable performance of 0.238 W/cm{sup 2} at 95% fuel utilization. The external fuel processor design was completed and fabrication begun. Several other advances were made on various aspects of the SOFC system, which are detailed in this report.
Radioactive isotopes in solid-state physics
Deicher, M
2002-01-01
Radioactive atoms have been used in solid-state physics and in material science for many decades. Besides their classical application as tracer for diffusion studies, nuclear techniques such as M\\"ossbauer spectroscopy, perturbed angular correlation, $\\beta$-NMR, and emission channelling have used nuclear properties (via hyperfine interactions or emitted particles) to gain microscopical information on the structural and dynamical properties of solids. During the last decade, the availability of many different radioactive isotopes as a clean ion beam at ISOL facilities such as ISOLDE at CERN has triggered a new era involving methods sensitive for the optical and electronic properties of solids, especially in the field of semiconductor physics. Extremely sensitive spectroscopic techniques like deep-level transient spectroscopy (DLTS), photoluminescence (PL), and Hall effect have gained a new quality by using radioactive isotopes. Because of their decay the chemical origin of an observed electronic and optical b...
BOOK REVIEW: Solid State Physics: An Introduction
Jakoby, Bernhard
2009-07-01
There's a wealth of excellent textbooks on solid state physics. The author of the present book is well aware of this fact and does not attempt to write just another one. Rather, he has provided a very compact introduction to solid state physics for third-year students. As we are faced with the continuous appearance interdisciplinary fields and associated study curricula in natural and engineering sciences (biophysics, mechatronics, etc), a compact text in solid state physics would be appreciated by students of these disciplines as well. The book features 11 chapters where each is provided with supplementary discussion questions and problems. The first chapters deal with a review of chemical bonding mechanisms, crystal structures and mechanical properties of solids, which are brief but by no means superficial. The following, somewhat more detailed chapter on thermal properties of lattices includes a nice introduction to phonons. The foundations of solid state electronics are treated in the next three chapters. Here the author first discusses the classical treatment of electronic behaviour in metals (Drude model) and continues with a quantum-theoretical approach starting with the free-electron model and leading to the band structures in conductive solids. The next chapter is devoted to semiconductors and ends with a brief but, with respect to the topical scope, adequate discussion of semiconductor devices. The classical topics of magnetic and dielectric behaviour are treated in the sequel. The book closes with a chapter on superconductivity and a brief chapter covering the modern topics of quantum confinement and aspects of nanoscale physics. In my opinion, the author has succeeded in creating a very concise yet not superficial textbook. The account presented often probes subjects deep enough to lay the basis for a thorough understanding, preparing the reader for more specialized textbooks. For instance, I think that this book may serve as an excellent first
Advances in CMOS solid-state photomultipliers for scintillation detector applications
Energy Technology Data Exchange (ETDEWEB)
Christian, James F.; Stapels, Christopher J.; Johnson, Erik B.; McClish, Mickel; Dokhale, Purushotthom; Shah, Kanai S.; Mukhopadhyay, Sharmistha; Chapman, Eric [Radiation Monitoring Devices, 44 Hunt Street, Watertownm, MA 02472 (United States); Augustine, Frank L., E-mail: JChristian@RMDInc.co [Augustine Engineering, 2115 Park Dale Ln, Encinitas, CA 92024 (United States)
2010-12-11
Solid-state photomultipliers (SSPMs) are a compact, lightweight, potentially low-cost alternative to a photomultiplier tube for a variety of scintillation detector applications, including digital-dosimeter and medical-imaging applications. Manufacturing SSPMs with a commercial CMOS process provides the ability for rapid prototyping, and facilitates production to reduce the cost. RMD designs CMOS SSPM devices that are fabricated by commercial foundries. This work describes the characterization and performance of these devices for scintillation detector applications. This work also describes the terms contributing to device noise in terms of the excess noise of the SSPM, the binomial statistics governing the number of pixels triggered by a scintillation event, and the background, or thermal, count rate. The fluctuations associated with these terms limit the resolution of the signal pulse amplitude. We explore the use of pixel-level signal conditioning, and characterize the performance of a prototype SSPM device that preserves the digital nature of the signal. In addition, we explore designs of position-sensitive SSPM detectors for medical imaging applications, and characterize their performance.
SSI`s International Development Co-operation (SIUS). Annual report 1998
Energy Technology Data Exchange (ETDEWEB)
Szendroe, G.; Grapengiesser, S.; Johansson, Gunnar
1999-04-01
SSI`s International Development Co-operation (SIUS), the Swedish program for radiation protection work in Central and Eastern Europe, has since its start in 1992 been granted SEK 109 million by the Swedish government. The projects are accessed, planned and performed in close co-operation with partner organisations in Eastern Europe. This report presents the financial status and a summary of the projects, their status and distribution over the countries and project areas. The presentation is updated as of December 1998
High average power solid state laser power conditioning system
International Nuclear Information System (INIS)
Steinkraus, R.F.
1987-01-01
The power conditioning system for the High Average Power Laser program at Lawrence Livermore National Laboratory (LLNL) is described. The system has been operational for two years. It is high voltage, high power, fault protected, and solid state. The power conditioning system drives flashlamps that pump solid state lasers. Flashlamps are driven by silicon control rectifier (SCR) switched, resonant charged, (LC) discharge pulse forming networks (PFNs). The system uses fiber optics for control and diagnostics. Energy and thermal diagnostics are monitored by computers
Diode-pumped solid state laser for inertial fusion energy
International Nuclear Information System (INIS)
Payne, S.A.; Krupke, W.F.; Orth, C.D.
1994-11-01
The authors evaluate the prospect for development of a diode-pumped solid-state-laser driver in an inertial fusion energy power plant. Using a computer code, they predict that their 1 GWe design will offer electricity at 8.6 cents/kW · hr with the laser operating at 8.6% efficiency and the recycled power level at 31%. The results of their initial subscale experimental testbed of a diode-pumped solid state laser are encouraging, demonstrating good efficiencies and robustness
Synergies Connecting the Photovoltaics and Solid-State Lighting Industries
Energy Technology Data Exchange (ETDEWEB)
Kurtz, S.
2003-05-01
Recent increases in the efficiencies of phosphide, nitride, and organic light-emitting diodes (LEDs) inspire a vision of a revolution in lighting. If high efficiencies, long lifetimes, and low cost can be achieved, solid-state lighting could save our country many quads of electricity in the coming years. The solid-state lighting (SSL) and photovoltaic (PV) industries share many of the same challenges. This paper explores the similarities between the two industries and how they might benefit by sharing information.
Excited state populations and charge-exchange of fast ions in solids
International Nuclear Information System (INIS)
Miller, P.D.; Sofield, C.J.; Woods, C.J.
1984-01-01
Excited state populations and charge state fractions of 445 MeV Cl ions have been measured for a range of thicknesses of solid C targets. Cross sections for electron capture, loss, excitation and excited state quenching have been determined and these data are found to predict a quantitative difference between equilibrium charge state distributions from gases and solids for a special case of the Bohr-Lindhard density effect model. 8 references, 1 figure, 1 table
A multi-phase equation of state for solid and liquid lead
International Nuclear Information System (INIS)
Robinson, C.M.
2004-01-01
This paper considers a multi-phase equation of state for solid and liquid lead. The thermodynamically consistent equation of state is constructed by calculating separate equations of state for the solid and liquid phases. The melt curve is the curve in the pressure, temperature plane where the Gibb's free energy of the solid and liquid phases are equal. In each phase a complete equation of state is obtained using the assumptions that the specific heat capacity is constant and that the Grueneisen parameter is proportional to the specific volume. The parameters for the equation of state are obtained from experimental data. In particular they are chosen to match melt curve and principal Hugoniot data. Predictions are made for the shock pressure required for melt to occur on shock and release
Solid-state cavity quantum electrodynamics using quantum dots
International Nuclear Information System (INIS)
Gerard, J.M.; Gayral, B.; Moreau, E.; Robert, I.; Abram, I.
2001-01-01
We review the recent development of solid-state cavity quantum electrodynamics using single self-assembled InAs quantum dots and three-dimensional semiconductor microcavities. We discuss first prospects for observing a strong coupling regime for single quantum dots. We then demonstrate that the strong Purcell effect observed for single quantum dots in the weak coupling regime allows us to prepare emitted photons in a given state (the same spatial mode, the same polarization). We present finally the first single-mode solid-state source of single photons, based on an isolated quantum dot in a pillar microcavity. This optoelectronic device, the first ever to rely on a cavity quantum electrodynamics effect, exploits both Coulomb interaction between trapped carriers in a single quantum dot and single mode photon tunneling in the microcavity. (author)
Advances in solid-state NMR of cellulose.
Foston, Marcus
2014-06-01
Nuclear magnetic resonance (NMR) spectroscopy is a well-established analytical and enabling technology in biofuel research. Over the past few decades, lignocellulosic biomass and its conversion to supplement or displace non-renewable feedstocks has attracted increasing interest. The application of solid-state NMR spectroscopy has long been seen as an important tool in the study of cellulose and lignocellulose structure, biosynthesis, and deconstruction, especially considering the limited number of effective solvent systems and the significance of plant cell wall three-dimensional microstructure and component interaction to conversion yield and rate profiles. This article reviews common and recent applications of solid-state NMR spectroscopy methods that provide insight into the structural and dynamic processes of cellulose that control bulk properties and biofuel conversion. Copyright © 2014 Elsevier Ltd. All rights reserved.
Solid state dye-sensitized solar cells. Current state of the art. Challenges and opportunities
Energy Technology Data Exchange (ETDEWEB)
Lenzmann, F.O.; Olson, C.L.; Goris, M.J.A.A.; Kroon, J.M. [ECN Solar Energy, Petten (Netherlands)
2008-09-15
The first generation of dye-sensitized solar cell technology is based on a liquid electrolyte component. Today, this technology is on the verge of commercialization. The step towards the market and real applications is supported by the prospect of low manufacturing costs, good efficiency as well as the expectation that the current stability level of this technology is at least sufficient for applications in mobile electronics. These favorable developments may be reinforced and accelerated even further, if the corrosive liquid electrolyte could be replaced by a non-corrosive solid, since this would ease a number of stringent requirements in the production process. A successful exchange of the liquid electrolyte by a solid-state holeconductor requires to at least maintain, preferably improve, the most relevant technical parameters of the solar cell (efficiency, stability, cost). First pioneering work with solid-state hole conductors was carried out 10 years ago with an initial efficiency level below 1%. Until 2007, the record efficiency could be improved to 5%. This paper gives an overview of the solid-state concept as an early stage approach with good perspectives for the mid-term future (5-10 years)
Development of analog solid-state photo-detectors for Positron Emission Tomography
International Nuclear Information System (INIS)
Bisogni, Maria Giuseppina; Morrocchi, Matteo
2016-01-01
Solid-state photo-detectors are one of the main innovations of past century in the field of sensors. First produced in the early forties with the invention of the p–n junction in silicon and the study of its optical properties, photo-detectors received a major boost in the sixties when the p-i-n (PIN) photodiode was developed and successfully used in several applications. The development of devices with internal gain, avalanche photodiodes (APD) first and then Geiger-mode avalanche photodiodes, named single photon avalanche diode (SPAD), leads to a substantial improvement in sensitivity and allowed single photon detection. Later on, thousands of SPADs have been assembled in arrays of few millimeters squared (named SiPM, silicon photo-multiplier) with single photon resolution. The high internal gain of SiPMs, together with other features peculiar of the silicon technology like compactness, speed and compatibility with magnetic fields, promoted SiPMs as the principal photo-detector competitor of photomultipliers in many applications from radiation detection to medical imaging. This paper provides a review of the properties of analog solid-state photo-detectors. Particular emphasis is given to latest advances on Positron Emission Tomography instrumentation boosted by the adoption of the silicon photo-detectors as an alternative to photomultiplier tubes (PMTs). Special attention is dedicated to the SiPMs, which are playing a key role in the development of innovative scanners.
Development of analog solid-state photo-detectors for Positron Emission Tomography
Energy Technology Data Exchange (ETDEWEB)
Bisogni, Maria Giuseppina, E-mail: giuseppina.bisogni@pi.infn.it; Morrocchi, Matteo
2016-02-11
Solid-state photo-detectors are one of the main innovations of past century in the field of sensors. First produced in the early forties with the invention of the p–n junction in silicon and the study of its optical properties, photo-detectors received a major boost in the sixties when the p-i-n (PIN) photodiode was developed and successfully used in several applications. The development of devices with internal gain, avalanche photodiodes (APD) first and then Geiger-mode avalanche photodiodes, named single photon avalanche diode (SPAD), leads to a substantial improvement in sensitivity and allowed single photon detection. Later on, thousands of SPADs have been assembled in arrays of few millimeters squared (named SiPM, silicon photo-multiplier) with single photon resolution. The high internal gain of SiPMs, together with other features peculiar of the silicon technology like compactness, speed and compatibility with magnetic fields, promoted SiPMs as the principal photo-detector competitor of photomultipliers in many applications from radiation detection to medical imaging. This paper provides a review of the properties of analog solid-state photo-detectors. Particular emphasis is given to latest advances on Positron Emission Tomography instrumentation boosted by the adoption of the silicon photo-detectors as an alternative to photomultiplier tubes (PMTs). Special attention is dedicated to the SiPMs, which are playing a key role in the development of innovative scanners.
Solid State Ionic Materials - Proceedings of the 4th Asian Conference on Solid State Ionics
Chowdari, B. V. R.; Yahaya, M.; Talib, I. A.; Salleh, M. M.
1994-07-01
The Table of Contents for the full book PDF is as follows: * Preface * I. INVITED PAPERS * Diffusion of Cations and Anions in Solid Electrolytes * Silver Ion Conductors in the Crystalline State * NMR Studies of Superionic Conductors * Hall Effect and Thermoelectric Power in High Tc Hg-Ba-Ca-Cu-O Ceramics * Solid Electrolyte Materials Prepared by Sol-Gel Chemistry * Preparation of Proton-Conducting Gel Films and their Application to Electrochromic Devices * Thin Film Fuel Cells * Zirconia based Solid Oxide Ion Conductors in Solid Oxide Fuel Cells * The Influence of Anion Substitution on Some Phosphate-based Ion Conducting Glasses * Lithium Intercalation in Carbon Electrodes and its Relevance in Rocking Chair Batteries * Chemical Sensors using Proton Conducting Ceramics * NMR/NQR Studies of Y-Ba-Cu-O Superconductors * Silver Molybdate Glasses and Battery Systems * New Highly Conducting Polymer Ionics and their Application in Electrochemical Devices * Study of Li Electrokinetics on Oligomeric Electrolytes using Microelectrodes * Calculation of Conductivity for Mixed-Phase Electrolytes PEO-MX-Immiscible Additive by Means of Effective Medium Theory * II. CONTRIBUTED PAPERS * Phase Relationship and Electrical Conductivity of Sr-V-O System with Vanadium Suboxide * Amorphous Li+ Ionic Conductors in Li2SO4-Li2O-P2O5 System * Fast Ion Transport in KCl-Al2O3 Composites * The Effect of the Second Phase Precipitation on the Ionic Conductivity of Zr0.85Mg0.15O1.85 * Conductivity Measurements and Phase Relationships in CaCl2-CaHCl Solid Electrolyte * Relationships Between Crystal Structure and Sodium Ion Conductivity in Na7Fe4(AsO4)6 and Na3Al2(AsO4)3 * Electrical Conductivity and Solubility Limit of Ti4+ Ion in Na1+x TiyZr2-ySixP3-xO12 System * Study on Sodium Fast Ion Conductors of Na1+3xAlxTi2-xSi2xP3-2xO12 System * Influences of Zirconia on the Properties of β''-Alumina Ceramics * Decay of Luminescence from Cr3+ Ions in β-Alumina * Lithium Ion Conductivity in the Li4XO4-Li2
Niu, Fushuang; Xu, Yuanhong; Liu, Mengli; Sun, Jing; Guo, Pengran; Liu, Jingquan
2016-03-14
Carbon nanodots (C-dots), a new type of potential alternative to conventional semiconductor quantum dots, have attracted numerous attentions in various applications including bio-chemical sensing, cell imaging, etc., due to their chemical inertness, low toxicity and flexible functionalization. Various methods including electrochemical (EC) methods have been reported for the synthesis of C-dots. However, complex procedures and/or carbon source-containing electrodes are often required. Herein, solid-state C-dots were simply prepared by bottom-up EC carbonization of nitriles (e.g. acetonitrile) in the presence of an ionic liquid [e.g. 1-butyl-3-methylimidazolium hexafluorophosphate (BMIMPF6)], using carbon-free electrodes. Due to the positive charges of BMIM(+) on the C-dots, the final products presented in a precipitate form on the cathode, and the unreacted nitriles and BMIMPF6 can be easily removed by simple vacuum filtration. The as-prepared solid-state C-dots can be well dispersed in an aqueous medium with excellent photoluminescence properties. The average size of the C-dots was found to be 3.02 ± 0.12 nm as evidenced by transmission electron microscopy. Other techniques such as UV-vis spectroscopy, fluorescence spectroscopy, X-ray photoelectron spectroscopy and atomic force microscopy were applied for the characterization of the C-dots and to analyze the possible generation mechanism. These C-dots have been successfully applied in efficient cell imaging and specific ferric ion detection.
Effect of the gate scaling on the analogue performance of s-Si CMOS devices
International Nuclear Information System (INIS)
Fobelets, K; Calvo-Gallego, J; Velázquez-Pérez, J E
2011-01-01
In this contribution, we present a detailed study of the analogue performance of deep submicron strained n-channel Si/SiGe (s-Si) MOSFETs. The study was carried out using a 2D device simulator based on the hydrodynamic model and the impedance field method to self-consistently obtain the current noise at the device's terminals. The analysis focused on the possible benefits of the gate scaling on the ac and noise performance of the transistor for low-power applications while keeping constant the oxide thickness equal to 2 nm to guarantee negligible level of the gate tunnel current. For a drain to source bias of 50 mV, it was found that a pure scaling of the transistor's gate length under 32 nm is detrimental for subthreshold operation in terms of the subthreshold slope (S) and transconductance (g m ) but would lead to reasonably low values of the minimum noise figure (NF min ). For the sake of comparison, SOI MOSFETs with the same layout and operating under the same conditions were simulated. The SOI MOSFETs showed better immunity against the gate scaling in terms of S than the s-Si MOSFETs, but lower values of g m and a higher value of NF min at the same level of the drain current. Finally, the devices have been studied in the saturation region for a drain to source bias of 1 V. In this region, it was found that the dependence of the current level SOI or s-Si MOSFET may outperform its counterparts
Proceedings of the DAE solid state physics symposium. V. 51
International Nuclear Information System (INIS)
Bhushan, K.G.; Gupta, S.K.
2006-01-01
DAE Solid State Physics Symposium, sponsored by the Board of Research in Nuclear Sciences, Department of Atomic Energy, is organized annually. The topics covered are phase transitions, soft condensed matter, nano-materials, experimental techniques, instrumentation and solid state devices, superconductivity, magnetism, electronic structure and phonons, semiconductor physics, transport properties, surface - interface and thin films, liquids, glasses and amorphous systems, etc. Papers relevant to INIS are indexed separately
Imaging of solid kidney tumours in children
International Nuclear Information System (INIS)
Hugosson, C.; Nyman, R.; Jacobsson, B.; Jorulf, H.; Sackey, K.; McDonald, P.
1995-01-01
Eighteen children aged 6 months to 12 years with 20 solid renal tumours; 13 Wilms' tumours (WT), 2 clear cell sarcomas of the kidney, 1 malignant rhabdoid tumour of the kidney and 2 cases of bilateral nephroblastomatosis with Wilms' tumour underwent evaluation with US, CT and MR imaging. Contrast-enhanced CT and non-enhanced MR were equally accurate in determining the size and origin of the tumour but were unreliable in separation of stages I, II and III. US could only accurately assess the size of the tumours. MR characteristics varied somewhat between WTs and non-WTs but contrast-enhanced MR imaging might be useful for separation of WTs from nephroblastomatosis. (orig.)
Social Security Administration — The Under Age 65 Disability Diagnoses of Supplemental Security Income (SSI) Recipients by Census Area (December 2010) is produced using the data found in Table 38...
International Nuclear Information System (INIS)
Chatroux, D.; Maury, J.; Hennevin, B.
1993-01-01
A Copper Vapour Laser Power Supply has been designed using a solid state switch consisting in eighteen Isolated Gate Bipolar Transistors (IGBT), -1200 volts, 400 Amps, each-in parallel. This paper presents the Isolated Gate Bipolar Transistor (IGBTs) replaced in the Power Electronic components evolution, and describes the IGBT conduction mechanism, presents the parallel association of IGBTs, and studies the application of these components to a Copper Vapour Laser Power Supply. The storage capacitor voltage is 820 volts, the peak current of the solid state switch is 17.000 Amps. The switch is connected on the primary of a step-up transformer, followed by a magnetic modulator. The reset of the magnetic modulator is provided by part of the laser reflected energy with a patented circuit. The charging circuit is a resonant circuit with a charge controlled by an IGBT switch. When the switch is open, the inductance energy is free-wheeled by an additional winding and does not extend the charging phase of the storage capacitor. The design allows the storage capacitor voltage to be very well regulated. This circuit is also patented. The electric pulse in the laser has 30.000 Volt peak voltage, 2000 Amp peak current, and is 200 nanoseconds long, for a 200 Watt optical power Copper Vapour Laser
Solidification microstructures and solid-state parallels: Recent developments, future directions
Energy Technology Data Exchange (ETDEWEB)
Asta, M. [Department of Chemical Engineering and Materials Science, University of California at Davis, Davis, CA 95616 (United States); Beckermann, C. [Department of Mechanical and Industrial Engineering, University of Iowa, Iowa City, IA 52242 (United States); Karma, A. [Department of Physics and Center for Interdisciplinary Research on Complex Systems, Northeastern University, Boston, MA 02115 (United States); Kurz, W. [Institute of Materials, Ecole Polytechnique Federale de Lausanne (EPFL), 1015 Lausanne (Switzerland)], E-mail: wilfried.kurz@epfl.ch; Napolitano, R. [Department of Materials Science and Engineering, Iowa State University, and Ames Laboratory USDOE, Ames, IA 50011 (United States); Plapp, M. [Physique de la Matiere Condensee, Ecole Polytechnique, CNRS, 91128 Palaiseau (France); Purdy, G. [Department of Materials Science and Engineering, McMaster University, Hamilton, Ont., L8S 4L7 (Canada); Rappaz, M. [Institute of Materials, Ecole Polytechnique Federale de Lausanne (EPFL), 1015 Lausanne (Switzerland); Trivedi, R. [Department of Materials Science and Engineering, Iowa State University, and Ames Laboratory USDOE, Ames, IA 50011 (United States)
2009-02-15
Rapid advances in atomistic and phase-field modeling techniques as well as new experiments have led to major progress in solidification science during the first years of this century. Here we review the most important findings in this technologically important area that impact our quantitative understanding of: (i) key anisotropic properties of the solid-liquid interface that govern solidification pattern evolution, including the solid-liquid interface free energy and the kinetic coefficient; (ii) dendritic solidification at small and large growth rates, with particular emphasis on orientation selection; (iii) regular and irregular eutectic and peritectic microstructures; (iv) effects of convection on microstructure formation; (v) solidification at a high volume fraction of solid and the related formation of pores and hot cracks; and (vi) solid-state transformations as far as they relate to solidification models and techniques. In light of this progress, critical issues that point to directions for future research in both solidification and solid-state transformations are identified.
SSI response of a typical shear wall structure. Volume 1
International Nuclear Information System (INIS)
Johnson, J.J.; Schewe, E.C.; Maslenikov, O.R.
1984-04-01
The Simplified Methods project of the US NRC-funded Seismic Safety Margins Research Program (SSMRP) has as its goal the development of a methodology to perform routine seismic probabilistic risk assessments of commercial nuclear power plants. The study reported here develops calibration factors to relate best estimate response to design values accounting for approximations and simplifications in SSI analysis procedures. Nineteen cases were analyzed and in-structure response compared. The structure of interest was a typical shear wall structure. 6 references, 44 figures, 22 tables
Park, Hyun; Yoon, Sang-Wook; Sokolov, Amit
2015-12-01
Magnetic Resonance-guided Focused Ultrasound Surgery (MRgFUS) is a non-invasive method to treat uterine fibroids. To help determine the patient suitability for MRgFUS, we propose a new objective measure: the scaled signal intensity (SSI) of uterine fibroids in T2 weighted MR images (T2WI). Forty three uterine fibroids in 40 premenopausal women were included in this retrospective study. SSI of each fibroid was measured from the screening T2WI by standardizing its mean signal intensity to a 0-100 scale, using reference intensities of rectus abdominis muscle (0) and subcutaneous fat (100). Correlation between the SSI and the non-perfused volume (NPV) ratio (a measure for treatment success) was calculated. Pre-treatment SSI showed a significant inverse-correlation with post treatment NPV ratio (p < 0.05). When dichotomizing NPV ratio at 45 %, the optimal cut off value of the SSI was found to be 16.0. A fibroid with SSI value 16.0 or less can be expected to have optimal responses. The SSI of uterine fibroids in T2WI can be suggested as an objective parameter to help in patient selection for MRgFUS. • Signal intensity of fibroid in MR images predicts treatment response to MRgFUS. • Signal intensity is standardized into scaled form using adjacent tissues as references. • Fibroids with SSI less than 16.0 are expected to have optimal responses.
All conducting polymer electrodes for asymmetric solid-state supercapacitors
Kurra, Narendra
2015-02-16
In this study, we report the fabrication of solid-state asymmetric supercapacitors (ASCs) based on conducting polymer electrodes on a plastic substrate. Nanostructured conducting polymers of poly(3,4-ethylenedioxythiophene), PEDOT, and polyaniline (PANI) are deposited electrochemically over Au-coated polyethylene naphthalate (PEN) plastic substrates. Due to the electron donating nature of the oxygen groups in the PEDOT, reduction potentials are higher, allowing it to be used as a negative electrode material. In addition, the high stability of PEDOT in its oxidised state makes it capable to exhibit electrochemical activity in a wide potential window. This can qualify PEDOT to be used as a negative electrode in fabricating asymmetric solid state supercapacitors with PANI as a positive electrode while employing polyvinyl alcohol (PVA)/H2SO4 gel electrolyte. The ASCs exhibit a maximum power density of 2.8 W cm−3 at an energy density of 9 mW h cm−3, which is superior to the carbonaceous and metal oxide based ASC solid state devices. Furthermore, the tandem configuration of asymmetric supercapacitors is shown to be capable of powering a red light emitting diode for about 1 minute after charging for 10 seconds.
International Nuclear Information System (INIS)
Spears, Robert Edward; Coleman, Justin Leigh
2015-01-01
Currently the Department of Energy (DOE) and the nuclear industry perform seismic soil-structure interaction (SSI) analysis using equivalent linear numerical analysis tools. For lower levels of ground motion, these tools should produce reasonable in-structure response values for evaluation of existing and new facilities. For larger levels of ground motion these tools likely overestimate the in-structure response (and therefore structural demand) since they do not consider geometric nonlinearities (such as gaping and sliding between the soil and structure) and are limited in the ability to model nonlinear soil behavior. The current equivalent linear SSI (SASSI) analysis approach either joins the soil and structure together in both tension and compression or releases the soil from the structure for both tension and compression. It also makes linear approximations for material nonlinearities and generalizes energy absorption with viscous damping. This produces the potential for inaccurately establishing where the structural concerns exist and/or inaccurately establishing the amplitude of the in-structure responses. Seismic hazard curves at nuclear facilities have continued to increase over the years as more information has been developed on seismic sources (i.e. faults), additional information gathered on seismic events, and additional research performed to determine local site effects. Seismic hazard curves are used to develop design basis earthquakes (DBE) that are used to evaluate nuclear facility response. As the seismic hazard curves increase, the input ground motions (DBE's) used to numerically evaluation nuclear facility response increase causing larger in-structure response. As ground motions increase so does the importance of including nonlinear effects in numerical SSI models. To include material nonlinearity in the soil and geometric nonlinearity using contact (gaping and sliding) it is necessary to develop a nonlinear time domain methodology. This
International Nuclear Information System (INIS)
Li Jing; Liu Zhengyou; Qiu Chunyin
2008-01-01
By using of the multiple scattering methods, we study the negative refraction imaging effect of solid acoustic waves by two-dimensional three-component phononic crystals composed of coated solid inclusions placed in solid matrix. We show that localized resonance mechanism brings on a group of flat single-mode bands in low-frequency region, which provides two equivalent frequency surfaces (EFS) close to circular. The two constant frequency surfaces correspond to two Bloch modes, a right-handed and a left-handed, whose leading mode are respectively transverse (T) and longitudinal (L) modes. The negative refraction behaviors of the two kinds of modes have been demonstrated by simulation of a Gaussian beam through a finite system. High-quality far-field imaging by a planar lens for transverse or longitudinal waves has been realized separately. This three-component phononic crystal may thus serve as a mode selector in negative refraction imaging of solid acoustic waves
Introduction to solid state physics
International Nuclear Information System (INIS)
Hofmann, Philip
2013-01-01
A compact introduction to solid-state physics for students of physics, material,and engineering sciences - ideal for a one- to two-semestral course. In easily understable form the author introduces to phenomena and concepts. Thereby he avoids expensive mathematical derivations and refers to outgoing literature. The successful didactical preparation makes an easy access to the theme possible. Numerous illustrations clarify the connections and make the explained well understandable. With about 170 questions and exercise problems.
Jain, Abhiney; Morlok, Charles K; Henson, J Michael
2013-01-01
The conversion of sustainable energy crops using microbiological fermentation to biofuels and bioproducts typically uses submerged-state processes. Alternatively, solid-state fermentation processes have several advantages when compared to the typical submerged-state processes. This study compares the use of solid-state versus submerged-state fermentation using the mesophilic anaerobic bacterium Clostridium phytofermentans in the conversion of switchgrass to the end products of ethanol, acetate, and hydrogen. A shift in the ratio of metabolic products towards more acetate and hydrogen production than ethanol production was observed when C. phytofermentans was grown under solid-state conditions as compared to submerged-state conditions. Results indicated that the end product concentrations (in millimolar) obtained using solid-state fermentation were higher than using submerged-state fermentation. In contrast, the total fermentation products (in weight of product per weight of carbohydrates consumed) and switchgrass conversion were higher for submerged-state fermentation. The conversion of xylan was greater than glucan conversion under both fermentation conditions. An initial pH of 7 and moisture content of 80 % resulted in maximum end products formation. Scanning electron microscopy study showed the presence of biofilm formed by C. phytofermentans growing on switchgrass under submerged-state fermentation whereas bacterial cells attached to surface and no apparent biofilm was observed when grown under solid-state fermentation. To our knowledge, this is the first study reporting consolidated bioprocessing of a lignocellulosic substrate by a mesophilic anaerobic bacterium under solid-state fermentation conditions.
Gate errors in solid-state quantum-computer architectures
International Nuclear Information System (INIS)
Hu Xuedong; Das Sarma, S.
2002-01-01
We theoretically consider possible errors in solid-state quantum computation due to the interplay of the complex solid-state environment and gate imperfections. In particular, we study two examples of gate operations in the opposite ends of the gate speed spectrum, an adiabatic gate operation in electron-spin-based quantum dot quantum computation and a sudden gate operation in Cooper-pair-box superconducting quantum computation. We evaluate quantitatively the nonadiabatic operation of a two-qubit gate in a two-electron double quantum dot. We also analyze the nonsudden pulse gate in a Cooper-pair-box-based quantum-computer model. In both cases our numerical results show strong influences of the higher excited states of the system on the gate operation, clearly demonstrating the importance of a detailed understanding of the relevant Hilbert-space structure on the quantum-computer operations
Manipulating Quantum Coherence in Solid State Systems
Flatté, Michael E; The NATO Advanced Study Institute "Manipulating Quantum Coherence in Solid State Systems"
2007-01-01
The NATO Advanced Study Institute "Manipulating Quantum Coherence in Solid State Systems", in Cluj-Napoca, Romania, August 29-September 9, 2005, presented a fundamental introduction to solid-state approaches to achieving quantum computation. This proceedings volume describes the properties of quantum coherence in semiconductor spin-based systems and the behavior of quantum coherence in superconducting systems. Semiconductor spin-based approaches to quantum computation have made tremendous advances in the past several years. Coherent populations of spins can be oriented, manipulated and detected experimentally. Rapid progress has been made towards performing the same tasks on individual spins (nuclear, ionic, or electronic) with all-electrical means. Superconducting approaches to quantum computation have demonstrated single qubits based on charge eigenstates as well as flux eigenstates. These topics have been presented in a pedagogical fashion by leading researchers in the fields of semiconductor-spin-based qu...
Solid-State Ultracapacitor for Improved Energy Storage
Nabors, Sammy
2015-01-01
NASA's Marshall Space Flight Center has developed a solid-state ultracapacitor using a novel nanocomposite, dielectric material. The material's design is based on the internal barrier layer capacitance (IBLC) concept, and it uses novel dielectric and metallic conductive ink formulations. Novel processing methods developed by NASA provide for unique dielectric properties at the grain level. Nanoscale raw material powders are tailored using a variety of techniques and then formulated into a special ink. This dielectric ink is used with novel metallic conductive ink to print a capacitor layer structure into any design necessary to meet a range of technical requirements. The innovation is intended to replace current range safety batteries that NASA uses to power the systems that destroy off-course space vehicles. A solid-state design provides the needed robustness and safety for this demanding application.
Solid State Welding Development at Marshall Space Flight Center
Ding, Robert J.; Walker, Bryant
2012-01-01
What is TSW and USW? TSW is a solid state weld process consisting of an induction coil heating source, a stir rod, and non-rotating containment plates Independent heating, stirring and forging controls Decouples the heating, stirring and forging process elements of FSW. USW is a solid state weld process consisting of an induction coil heating source, a stir rod, and a non-rotating containment plate; Ultrasonic energy integrated into non-rotating containment plate and stir rod; Independent heating, stirring and forging controls; Decouples the heating, stirring and forging process elements of FSW.
Tritium contaminated surface monitoring with a solid - state device
International Nuclear Information System (INIS)
Culcer, Mihai; Iliescu, Mariana; Curuia, Marian; Enache, Adrian; Stefanescu, Ioan; Ducu, Catalin; Malinovschi, Viorel
2004-01-01
The low energy of betas makes tritium difficult to detect. However, there are several methods used in tritium detection, such as liquid scintillation and ionization chambers. Tritium on or near a surface can be also detected using proportional counters and, recently, solid state devices. The paper presents our results in the design and achievement of a surface tritium monitor using a PIN photodiode as a solid state charged particle detector to count betas emitted from the surface. That method allows continuous, real-time and non-destructively measuring of tritium. (authors)
Investigations in the field of solid-state polymerization Pt. 37
International Nuclear Information System (INIS)
Mahr, L.; Cser, F.; Kovacs, G.; Hardy, Gy.
1978-01-01
Chloranil (CA) and bromanil (BA) which have otherwise similar radiation-chemical properties affect the solid state polymerization of acenaphthylene (ACN) in different manner. CA decreases the rate of polymerization proportionally to its concentration and besides, it also decreases the conversion limit and the molecular weight of the product. BA does not influence the reaction up to a conversion of 20%, but soon afterwards the conversion limit of the polymerization is reached. This limit, above 8M% BA content, is independent of the BA concentration. The reason for the different behaviour is that while BA forms an ideal eutectics with ACN, CA forms a solid solution of limited miscibility at the temperature of the experiments. Both pairs of compounds give charge transfer complex in solid state. The charge transfer complex of BA exists merely at the boundary layer of the crystals, but that of CA is within the crystal lattice of ACN as in a solid solvent. In none of the studied cases could be detected the charge transfer complex with its own specific crystal structure. The effect of CA on the solid state polymerization of ACN is discussed on the basis of the results obtained by PPP and CNDO/2 calculations on ACN and CA. (author)
A New All Solid State Approach to Gaseous Pollutant Detection
Brown, V.; Tamstorf, K.
1971-01-01
Recent efforts in our laboratories have concentrated on the development of an all solid state gas sensor, by combining solid electrolyte (ion exchange membrane) technology with advanced thin film deposition processes. With the proper bias magnitude and polarity these miniature electro-chemical,cells show remarkable current responses for many common pollution gases. Current activity is now focused on complementing a multiple array (matrix) of these solid state sensors, with a digital electronic scanner device possessing "scan-compare-identify-alarm: capability. This innovative approach to multi-component pollutant gas analysis may indeed be the advanced prototype for the "third generation" class of pollution analysis instrumentation so urgently needed in the decade ahead.
Unitary transformations in solid state physics
International Nuclear Information System (INIS)
Wagner, M.
1986-01-01
The main emphasis of this book is on the practical application of unitary transformations to problems in solid state physics. This is a method used in the field of nonadiabatic electron-phonon phenomena where the Born-Oppenheimer approximation is no longer applicable. The book is intended as a tool for those who want to apply unitary transformations quickly and on a more elementary level and also for those who want to use this method for more involved problems. The book is divided into 6 chapters. The first three chapters are concerned with presenting quick applications of unitary transformations and chapter 4 presents a more systematic procedure. The last two chapters contain the major known examples of the utilization of unitary transformations in solid state physics, including such highlights as the Froehlich and the Fulton-Gouterman transformations. The book is supplemented by extended tables of unitary transformations, whose properties and peculiarities are also listed. This tabulated material is unique and will be of great practical use to those applying the method of unitary transformations in their work. (Auth.)
Advanced solid state batteries
Energy Technology Data Exchange (ETDEWEB)
Levasseur, A; Delmas, C; Menetrier, M; Hagenmuller, P
1984-01-01
Direct electrochemical storage of electricity is attractive because of its adaptability to vehicle traction as well as to stationary applications. Important advancements are necessary to improve primary or secondary batteries so far used. The aim of this study was to develop and to characterize materials for the next generation of advanced, rechargeable solid state batteries for vehicle transport and stationary storage applications. One of the best electricity storage systems was the lithium/intercalation compound secondary battery, though up to now the behavior of liquid organic electrolytes did not allow for good recycling in such systems. The research program for these batteries is described.
Optical techniques for solid-state materials characterization
Prasankumar, Rohit P
2016-01-01
This book has comprehensively covered the essential optical approaches needed for solid-state materials characterization. Written by experts in the field, this will be a great reference for students, engineers, and scientists.-Professor Yoke Khin Yap, Michigan Technical University.
Allis, Damian G.; Hakey, Patrick M.; Korter, Timothy M.
2008-10-01
The terahertz (THz, far-infrared) spectrum of 3,4-methylene-dioxymethamphetamine hydrochloride (Ecstasy) is simulated using solid-state density functional theory. While a previously reported isolated-molecule calculation is noteworthy for the precision of its solid-state THz reproduction, the solid-state calculation predicts that the isolated-molecule modes account for only half of the spectral features in the THz region, with the remaining structure arising from lattice vibrations that cannot be predicted without solid-state molecular modeling. The molecular origins of the internal mode contributions to the solid-state THz spectrum, as well as the proper consideration of the protonation state of the molecule, are also considered.
Eutectic and solid-state wafer bonding of silicon with gold
International Nuclear Information System (INIS)
Abouie, Maryam; Liu, Qi; Ivey, Douglas G.
2012-01-01
Highlights: ► Eutectic and solid-state Au-Si bonding are compared for both a-Si and c-Si samples. ► Exchange of a-Si and Au layer was observed in both types of bonded samples. ► Use of c-Si for bonding resulted in formation of craters at the Au/c-Si interface. ► Solid-state Au-Si bonding produces better bonds in terms of microstructure. - Abstract: The simple Au-Si eutectic, which melts at 363 °C, can be used to bond Si wafers. However, faceted craters can form at the Au/Si interface as a result of anisotropic and non-uniform reaction between Au and crystalline silicon (c-Si). These craters may adversely affect active devices on the wafers. Two possible solutions to this problem were investigated in this study. One solution was to use an amorphous silicon layer (a-Si) that was deposited on the c-Si substrate to bond with the Au. The other solution was to use solid-state bonding instead of eutectic bonding, and the wafers were bonded at a temperature (350 °C) below the Au-Si eutectic temperature. The results showed that the a-Si layer prevented the formation of craters and solid-state bonding not only required a lower bonding temperature than eutectic bonding, but also prevented spill out of the solder resulting in strong bonds with high shear strength in comparison with eutectic bonding. Using amorphous silicon, the maximum shear strength for the solid-state Au-Si bond reached 15.2 MPa, whereas for the eutectic Au-Si bond it was 13.2 MPa.
High Reversibility of “Soft” Electrode Materials in All-Solid-State Batteries
Energy Technology Data Exchange (ETDEWEB)
Sakuda, Atsushi, E-mail: a.sakuda@aist.go.jp; Takeuchi, Tomonari, E-mail: a.sakuda@aist.go.jp; Shikano, Masahiro; Sakaebe, Hikari; Kobayashi, Hironori [Department of Energy and Environment, Research Institute for Electrochemical Energy, National Institute of Advanced Industrial Science and Technology (AIST), Ikeda (Japan)
2016-05-10
All-solid-state batteries using inorganic solid electrolytes (SEs) are considered to be ideal batteries for electric vehicles and plug-in hybrid electric vehicles because they are potentially safer than conventional lithium-ion batteries (LIBs). In addition, all-solid-state batteries are expected to have long battery life owing to the inhibition of chemical side reactions because only lithium ions move through the typically used inorganic SEs. The development of high-energy density (more than 300 Wh kg{sup −1}) secondary batteries has been eagerly anticipated for years. The application of high-capacity electrode active materials is essential for fabricating such batteries. Recently, we proposed metal polysulfides as new electrode materials. These materials show higher conductivity and density than sulfur, which is advantageous for fabricating batteries with relatively higher energy density. Lithium niobium sulfides, such as Li{sub 3}NbS{sub 4}, have relatively high density, conductivity, and rate capability among metal polysulfide materials, and batteries with these materials have capacities high enough to potentially exceed the gravimetric-energy density of conventional LIBs. Favorable solid–solid contact between the electrode and electrolyte particles is a key factor for fabricating high performance all-solid-state batteries. Conventional oxide-based positive electrode materials tend to give rise to cracks during fabrication and/or charge–discharge processes. Here, we report all-solid-state cells using lithium niobium sulfide as a positive electrode material, where favorable solid–solid contact was established by using lithium sulfide electrode materials because of their high processability. Cracks were barely observed in the electrode particles in the all-solid-state cells before or after charging and discharging with a high capacity of approximately 400 mAh g{sup −1} suggesting that the lithium niobium sulfide electrode charged and discharged without
High Reversibility of “Soft” Electrode Materials in All-Solid-State Batteries
International Nuclear Information System (INIS)
Sakuda, Atsushi; Takeuchi, Tomonari; Shikano, Masahiro; Sakaebe, Hikari; Kobayashi, Hironori
2016-01-01
All-solid-state batteries using inorganic solid electrolytes (SEs) are considered to be ideal batteries for electric vehicles and plug-in hybrid electric vehicles because they are potentially safer than conventional lithium-ion batteries (LIBs). In addition, all-solid-state batteries are expected to have long battery life owing to the inhibition of chemical side reactions because only lithium ions move through the typically used inorganic SEs. The development of high-energy density (more than 300 Wh kg −1 ) secondary batteries has been eagerly anticipated for years. The application of high-capacity electrode active materials is essential for fabricating such batteries. Recently, we proposed metal polysulfides as new electrode materials. These materials show higher conductivity and density than sulfur, which is advantageous for fabricating batteries with relatively higher energy density. Lithium niobium sulfides, such as Li 3 NbS 4 , have relatively high density, conductivity, and rate capability among metal polysulfide materials, and batteries with these materials have capacities high enough to potentially exceed the gravimetric-energy density of conventional LIBs. Favorable solid–solid contact between the electrode and electrolyte particles is a key factor for fabricating high performance all-solid-state batteries. Conventional oxide-based positive electrode materials tend to give rise to cracks during fabrication and/or charge–discharge processes. Here, we report all-solid-state cells using lithium niobium sulfide as a positive electrode material, where favorable solid–solid contact was established by using lithium sulfide electrode materials because of their high processability. Cracks were barely observed in the electrode particles in the all-solid-state cells before or after charging and discharging with a high capacity of approximately 400 mAh g −1 suggesting that the lithium niobium sulfide electrode charged and discharged without experiencing
Surface-Induced Frustration in Solid State Polymorphic Transition of Native Cellulose Nanocrystals.
Salminen, Reeta; Baccile, Niki; Reza, Mehedi; Kontturi, Eero
2017-06-12
The presence of an interface generally influences crystallization of polymers from melt or from solution. Here, by contrast, we explore the effect of surface immobilization in a direct solid state polymorphic transition on individual cellulose nanocrystals (CNCs), extracted from a plant-based origin. The conversion from native cellulose I to cellulose III crystal occurred via a host-guest inclusion of ethylene diamine inside the crystal. A 60% reduction in CNC width (height) in atomic force microscopy images suggested that when immobilized on a flat modified silica surface, the stresses caused by the inclusion or the subsequent regeneration resulted in exfoliation, hypothetically, between the van der Waals bonded sheets within the crystal. Virtually no changes in dimensions were visible when the polymorphic transition was performed to nonimmobilized CNCs in bulk dispersion. With reservations and by acknowledging the obvious dissimilarities, the exfoliation of cellulose crystal sheets can be viewed as analogous to exfoliation of 2D structures like graphene from a van der Waals stacked solid. Here, the detachment is triggered by an inclusion of a guest molecule inside a host cellulose crystal and the stresses caused by the firm attachment of the CNC on a solid substrate, leading to detachment of molecular sheets or stacks of sheets.
Solid state fermentation for foods and beverages
Chen, J.; Zhu, Y.; Nout, M.J.R.; Sarkar, P.K.
2013-01-01
The book systematically describes the production of solid-state fermented food and beverage in terms of the history and development of SSF technology and SSF foods, bio-reactor design, fermentation process, various substrate origins and sustainable development. It emphasizes Oriental traditional
Solar-pumped solid state Nd lasers
Williams, M. D.; Zapata, L.
1985-01-01
Solid state neodymium lasers are considered candidates for space-based polar-pumped laser for continuous power transmission. Laser performance for three different slab laser configurations has been computed to show the excellent power capability of such systems if heat problems can be solved. Ideas involving geometries and materials are offered as potential solutions to the heat problem.
Modular compact solid-state modulators for particle accelerators
Zavadtsev, A. A.; Zavadtsev, D. A.; Churanov, D. V.
2017-12-01
The building of the radio frequency (RF) particle accelerator needs high-voltage pulsed modulator as a power supply for klystron or magnetron to feed the RF accelerating system. The development of a number of solid-state modulators for use in linear accelerators has allowed to develop a series of modular IGBT based compact solid-state modulators with different parameters. This series covers a wide range of needs in accelerator technology to feed a wide range of loads from the low power magnetrons to powerful klystrons. Each modulator of the series is built on base of a number of unified solid-state modules connected to the pulse transformer, and covers a wide range of modulators: voltage up to 250 kV, a peak current up to 250 A, average power up to 100 kW and the pulse duration up to 20 μsec. The parameters of the block with an overall dimensions 880×540×250 mm are: voltage 12 kV, peak current 1600 A, pulse duration 20 μsec, average power 10 kW with air-cooling and 40 kW with liquidcooling. These parameters do not represent a physical limit, and modulators to parameters outside these ranges can be created on request.
Solid State Pathways towards Molecular Complexity in Space
Linnartz, Harold; Bossa, Jean-Baptiste; Bouwman, Jordy; Cuppen, Herma M.; Cuylle, Steven H.; van Dishoeck, Ewine F.; Fayolle, Edith C.; Fedoseev, Gleb; Fuchs, Guido W.; Ioppolo, Sergio; Isokoski, Karoliina; Lamberts, Thanja; Öberg, Karin I.; Romanzin, Claire; Tenenbaum, Emily; Zhen, Junfeng
2011-12-01
It has been a long standing problem in astrochemistry to explain how molecules can form in a highly dilute environment such as the interstellar medium. In the last decennium more and more evidence has been found that the observed mix of small and complex, stable and highly transient species in space is the cumulative result of gas phase and solid state reactions as well as gas-grain interactions. Solid state reactions on icy dust grains are specifically found to play an important role in the formation of the more complex ``organic'' compounds. In order to investigate the underlying physical and chemical processes detailed laboratory based experiments are needed that simulate surface reactions triggered by processes as different as thermal heating, photon (UV) irradiation and particle (atom, cosmic ray, electron) bombardment of interstellar ice analogues. Here, some of the latest research performed in the Sackler Laboratory for Astrophysics in Leiden, the Netherlands is reviewed. The focus is on hydrogenation, i.e., H-atom addition reactions and vacuum ultraviolet irradiation of interstellar ice analogues at astronomically relevant temperatures. It is shown that solid state processes are crucial in the chemical evolution of the interstellar medium, providing pathways towards molecular complexity in space.
Experimental study on the EMP failure mode of DC solid state relay
International Nuclear Information System (INIS)
Sun Beiyun; Chen Xiangyue; Zhai Aibin; Mao Congguang
2009-01-01
DC solid state relay is a new type switch device without touch point, and is extensive used by aviation and spaceflight technique. In this paper, the EMP failure modes of solid state relays were obtained by current injection method. (authors)
Reaction diffusion and solid state chemical kinetics handbook
Dybkov, V I
2010-01-01
This monograph deals with a physico-chemical approach to the problem of the solid-state growth of chemical compound layers and reaction-diffusion in binary heterogeneous systems formed by two solids; as well as a solid with a liquid or a gas. It is explained why the number of compound layers growing at the interface between the original phases is usually much lower than the number of chemical compounds in the phase diagram of a given binary system. For example, of the eight intermetallic compounds which exist in the aluminium-zirconium binary system, only ZrAl3 was found to grow as a separate
Solid state photosensitive devices which employ isolated photosynthetic complexes
Peumans, Peter; Forrest, Stephen R.
2009-09-22
Solid state photosensitive devices including photovoltaic devices are provided which comprise a first electrode and a second electrode in superposed relation; and at least one isolated Light Harvesting Complex (LHC) between the electrodes. Preferred photosensitive devices comprise an electron transport layer formed of a first photoconductive organic semiconductor material, adjacent to the LHC, disposed between the first electrode and the LHC; and a hole transport layer formed of a second photoconductive organic semiconductor material, adjacent to the LHC, disposed between the second electrode and the LHC. Solid state photosensitive devices of the present invention may comprise at least one additional layer of photoconductive organic semiconductor material disposed between the first electrode and the electron transport layer; and at least one additional layer of photoconductive organic semiconductor material, disposed between the second electrode and the hole transport layer. Methods of generating photocurrent are provided which comprise exposing a photovoltaic device of the present invention to light. Electronic devices are provided which comprise a solid state photosensitive device of the present invention.
LOW-TEMPERATURE EQUATION OF STATE OF SOLID METHANE
Directory of Open Access Journals (Sweden)
L. N. Yakub
2016-02-01
Full Text Available The theoretical equation of state for solid methane, developed within the framework of perturbation theory, with the crystal consisting of spherical molecules as zero-order approximation, and octupole – octupole interaction of methane molecules as a perturbation, is proposed. Thermodynamic functions are computed on the sublimation line up to the triple point. The contribution of the octupole – octupole interaction to the thermodynamic properties of solid methane is estimated.
Analysis of solid-state transformations of pharmaceutical compounds using vibrational spectroscopy
DEFF Research Database (Denmark)
Heinz, Andrea; Strachan, Clare J; Gordon, Keith C
2009-01-01
OBJECTIVES: Solid-state transformations may occur during any stage of pharmaceutical processing and upon storage of a solid dosage form. Early detection and quantification of these transformations during the manufacture of solid dosage forms is important since the physical form of an active...... pharmaceutical ingredient can significantly influence its processing behaviour, including powder flow and compressibility, and biopharmaceutical properties such as solubility, dissolution rate and bioavailability. KEY FINDINGS: Vibrational spectroscopic techniques such as infrared, near-infrared, Raman and, most...... multivariate approaches where even overlapping spectral bands can be analysed. SUMMARY: This review discusses the applications of different vibrational spectroscopic techniques to detect and monitor solid-state transformations possible for crystalline polymorphs, hydrates and amorphous forms of pharmaceutical...
Tunability of the circadian action of tetrachromatic solid-state light sources
International Nuclear Information System (INIS)
Žukauskas, A.; Vaicekauskas, R.
2015-01-01
An approach to the optimization of the spectral power distribution of solid-state light sources with the tunable non-image forming photobiological effect on the human circadian rhythm is proposed. For tetrachromatic clusters of model narrow-band (direct-emission) light-emitting diodes (LEDs), the limiting tunability of the circadian action factor (CAF), which is the ratio of the circadian efficacy to luminous efficacy of radiation, was established as a function of constraining color fidelity and luminous efficacy of radiation. For constant correlated color temperatures (CCTs), the CAF of the LED clusters can be tuned above and below that of the corresponding blackbody radiators, whereas for variable CCT, the clusters can have circadian tunability covering that of a temperature-tunable blackbody radiator
Tunability of the circadian action of tetrachromatic solid-state light sources
Energy Technology Data Exchange (ETDEWEB)
Žukauskas, A., E-mail: arturas.zukauskas@ff.vu.lt [Institute of Applied Research, Vilnius University, Saulėtekio al. 9-III, LT-10222 Vilnius (Lithuania); Vaicekauskas, R. [Department of Computer Science, Vilnius University, Didlaukio g. 47, Vilnius LT-08303 (Lithuania)
2015-01-26
An approach to the optimization of the spectral power distribution of solid-state light sources with the tunable non-image forming photobiological effect on the human circadian rhythm is proposed. For tetrachromatic clusters of model narrow-band (direct-emission) light-emitting diodes (LEDs), the limiting tunability of the circadian action factor (CAF), which is the ratio of the circadian efficacy to luminous efficacy of radiation, was established as a function of constraining color fidelity and luminous efficacy of radiation. For constant correlated color temperatures (CCTs), the CAF of the LED clusters can be tuned above and below that of the corresponding blackbody radiators, whereas for variable CCT, the clusters can have circadian tunability covering that of a temperature-tunable blackbody radiator.
Rheological behavior of semi-solid 7075 aluminum alloy at steady state
Directory of Open Access Journals (Sweden)
Li Yageng
2014-03-01
Full Text Available The further application of semi-solid processing lies in the in-depth fundamental study like rheological behavior. In this research, the apparent viscosity of the semi-solid slurry of 7075 alloy was measured using a Couette type viscometer. The effects of solid fraction and shearing rate on the apparent viscosity of this alloy were investigated under different processing conditions. It can be seen that the apparent viscosity increases with an increase in the solid fraction from 10% to 50% (temperature 620 篊 to 630 篊 at steady state. When the solid fraction was fixed, the apparent viscosity can be decreased by altering the shearing rate from 61.235 s-1 to 489.88 s-1 at steady state. An empirical equation that shows the effects of solid fraction and shearing rate on the apparent viscosity is fitted. The microstructure of quenched samples was examined to understand the alloy抯 rheological behavior.
Solid-state interactions between trimethoprim and parabens
DEFF Research Database (Denmark)
Pedersen, S.; Kristensen, H. G.; Cornett, Claus
1994-01-01
by differential scanning calorimetry, X-ray powder diffraction, Fourier transform infrared spectroscopy, and solid-state C-13-NMR. Interactions between trimethoprim and 4-hydroxybenzoic acid and its ethyl,propyl and butyl esters were not observed. The nature of the trimethoprim and methyl parahydroxybenzoate...
Directory of Open Access Journals (Sweden)
Franklin D. Rincón
2015-04-01
Full Text Available This paper introduces a novel steady-state identification (SSI method based on the auto-regressive model with exogenous inputs (ARX. This method allows the SSI with reduced tuning by analyzing the identifiability properties of the system. In particular, the singularity of the model matrices is used as an index for steady-state determination. In this contribution, the novel SSI method is compared to other available techniques, namely the F-like test, wavelet transform and a polynomial-based approach. These methods are implemented for SSI of three different case studies. In the first case, a simulated dataset is used for calibrating the output-based SSI methods. The second case corresponds to a literature nonlinear continuous stirred-tank reactor (CSTR example running at different steady states in which the ARX-based approach is tuned with the available input-output data. Finally, an industrial case with real data of a depropanizer column from PETROBRAS S.A. considering different pieces of equipment is analyzed. The results for a reflux drum case indicate that the wavelet and the F-like test can satisfactorily detect the steady-state periods after careful tuning and when respecting their hypothesis, i.e., smooth data for the wavelet method and the presence of variance in the data for the F-like test. Through a heat exchanger case with different measurement frequencies, we demonstrate the advantages of using the ARX-based method over the other techniques, which include the aspect of online implementation.
Outpatient Imaging Efficiency - State
U.S. Department of Health & Human Services — Use of medical imaging - state data. These measures give you information about hospitals' use of medical imaging tests for outpatients. Examples of medical imaging...
A Model of Solid State Gas Sensors
Woestman, J. T.; Brailsford, A. D.; Shane, M.; Logothetis, E. M.
1997-03-01
Solid state gas sensors are widely used to measure the concentrations of gases such as CO, CH_4, C_3H_6, H_2, C_3H8 and O2 The applications of these sensors range from air-to-fuel ratio control in combustion processes including those in automotive engines and industrial furnaces to leakage detection of inflammable and toxic gases in domestic and industrial environments. As the need increases to accurately measure smaller and smaller concentrations, problems such as poor selectivity, stability and response time limit the use of these sensors. In an effort to overcome some of these limitations, a theoretical model of the transient behavior of solid state gas sensors has been developed. In this presentation, a model for the transient response of an electrochemical gas sensor to gas mixtures containing O2 and one reducing species, such as CO, is discussed. This model accounts for the transport of the reactive species to the sampling electrode, the catalyzed oxidation/reduction reaction of these species and the generation of the resulting electrical signal. The model will be shown to reproduce the results of published steady state models and to agree with experimental steady state and transient data.
Materials research for passive solar systems: Solid-state phase-change materials
Benson, D. K.; Webb, J. D.; Burrows, R. W.; McFadden, J. D. O.; Christensen, C.
1985-03-01
A set of solid-state phase-change materials is being evaluated for possible use in passive solar thermal energy storage systems. The most promising materials are organic solid solutions of pentaerythritol (C5H12O4), pentaglycerinve (C5H12O3), and neopentyl glycol (C5H12O2). Solid solution mixtures of these compounds can be tailored so that they exhibit solid-to-solid phase transformations at any desired temperature between 25 C and 188 C, and have latent heats of transformation etween 20 and 70 cal/g. Transformation temperatures, specific heats, and latent heats of transformation have been measured for a number of these materials. Limited cyclic experiments suggest that the solid solutions are stable. These phase-change materials exhibit large amounts of undercooling; however, the addition of certain nucleating agents as particulate dispersions in the solid phase-change material greatly reduces this effect. Computer simulations suggest that the use of an optimized solid-state phase-change material in a Trombe wall could provide better performance than a concrete Trombe wall four times thicker and nine times heavier.
Solid State Physics Principles and Modern Applications
Quinn, John J
2009-01-01
Intended for a two semester advanced undergraduate or graduate course in Solid State Physics, this treatment offers modern coverage of the theory and related experiments, including the group theoretical approach to band structures, Moessbauer recoil free fraction, semi-classical electron theory, magnetoconductivity, electron self-energy and Landau theory of Fermi liquid, and both quantum and fractional quantum Hall effects. Integrated throughout are developments from the newest semiconductor devices, e.g. space charge layers, quantum wells and superlattices. The first half includes all material usually covered in the introductory course, but in greater depth than most introductory textbooks. The second half includes most of the important developments in solid-state researches of the past half century, addressing e.g. optical and electronic properties such as collective bulk and surface modes and spectral function of a quasiparticle, which is a basic concept for understanding LEED intensities, X ray fine struc...
Edge detection of solid motor' CT image based on gravitation model
International Nuclear Information System (INIS)
Yu Guanghui; Lu Hongyi; Zhu Min; Liu Xudong; Hou Zhiqiang
2012-01-01
In order to detect the edge of solid motor' CT image much better, a new edge detection operator base on gravitation model was put forward. The edge of CT image is got by the new operator. The superiority turned out by comparing the edge got by ordinary operator. The comparison among operators with different size shows that higher quality CT images need smaller size operator while the lower need the larger. (authors)
Solid state detectors for neutron radiation monitoring in fusion facilities
International Nuclear Information System (INIS)
Gómez-Ros, J.M.
2014-01-01
The purpose of this communication is to summarize the main solid state based detectors proposed for neutron diagnostic in fusion applications and their applicability under the required harsh conditions in terms of intense radiation, high temperature and available space restrictions. Activation systems, semiconductor based detectors, luminescent materials and Cerenkov fibre optics sensors (C-FOS) are the main devices that are described. - Highlights: • A state-of-the-art summary of solid state based detectors are described. • Conditions and restrictions for their applicability are described. • A list of the 38 more relevant references has been included
Directory of Open Access Journals (Sweden)
Antonio Granero-Gallegos
2013-03-01
Full Text Available O objetivo deste estudo foi analisar as propriedades psicométricas do Sport Satisfation Instrument (SSI adaptado para a Educação Física (EF por meio de uma análise fatorial exploratória da estrutura bidimensional do instrumento em uma amostra espanhola. Com isso, buscou-se determinar, de maneira preliminar, se o SSI constitui um instrumento válido e fiável para ser utilizado em futuras pesquisas. O instrumento foi elaborado em um modelo teórico de dois fatores: Satisfação/Diversão e Tédio. A amostra constituiu-se de um total de 224 alunos de secundária entre 12 e 19 anos. A versão [espanhola] do instrumento adaptado para a EF demonstrou níveis aceitáveis de consistência interna.The objective of this study was to analyze the psychometric properties of Sport Satisfaction Instrument (SSI adapted physical education (PE using exploratory factor analysis of the dimensional structure of the instrument in a Spanish sample. It was intended to determine, on a preliminary basis, whether it constitutes a valid and reliable for use in future research. Was administered to a total of 224 high school students 12 to 19 years. This analysis supports the hypothesized theoretical model of two factors (satisfaction / fun and boredom. The Spanish version of the instrument for PE showed acceptable levels of internal consistency.
Solid State Division progress report for period ending September 30, 1984
International Nuclear Information System (INIS)
Green, P.H.; Watson, D.M.
1985-03-01
During the reporting period, relatively minor changes have occurred in the research areas of interest to the Division. Nearly all the research of the Division can be classified broadly as mission-oriented basic research. Topics covered include: theoretical solid state physics; surface and near-surface properties of solids; defects in solids; transport properties of solids; neutron scattering; and preparation and characterization of research materials
Solid State Division progress report for period ending September 30, 1984
Energy Technology Data Exchange (ETDEWEB)
Green, P.H.; Watson, D.M. (eds.)
1985-03-01
During the reporting period, relatively minor changes have occurred in the research areas of interest to the Division. Nearly all the research of the Division can be classified broadly as mission-oriented basic research. Topics covered include: theoretical solid state physics; surface and near-surface properties of solids; defects in solids; transport properties of solids; neutron scattering; and preparation and characterization of research materials. (GHT)
A Toolbox of Solid-State NMR Experiments for the Characterization of Soft Organic Nanomaterials
Straasø, Lasse Arnt
2016-02-02
Determining how organic molecules self-assemble into a solid material is a challenging and demanding task if a single crystal of the material cannot be produced. Solid-state NMR spectroscopy offers access to such molecular details via an appropriate selection of techniques. This report gives a selected overview of 1D and 2D solid-state NMR techniques for elucidating the structure of soft organic solids. We focus on how the solid-state NMR techniques are designed from the perspective of the different nuclear interactions, using average Hamiltonian theory and product operators. We also introduce recent methods for quantification and reduction of experimental artifacts. Finally, we highlight how the solid-state NMR techniques can be applied to soft organic materials by reviewing recent applications to semicrystalline polymers, π-conjugated polymers, natural silk, and graphene-related materials.
A Toolbox of Solid-State NMR Experiments for the Characterization of Soft Organic Nanomaterials
Straasø , Lasse Arnt; Saleem, Qasim; Hansen, Michael Ryan
2016-01-01
Determining how organic molecules self-assemble into a solid material is a challenging and demanding task if a single crystal of the material cannot be produced. Solid-state NMR spectroscopy offers access to such molecular details via an appropriate selection of techniques. This report gives a selected overview of 1D and 2D solid-state NMR techniques for elucidating the structure of soft organic solids. We focus on how the solid-state NMR techniques are designed from the perspective of the different nuclear interactions, using average Hamiltonian theory and product operators. We also introduce recent methods for quantification and reduction of experimental artifacts. Finally, we highlight how the solid-state NMR techniques can be applied to soft organic materials by reviewing recent applications to semicrystalline polymers, π-conjugated polymers, natural silk, and graphene-related materials.
Energy Technology Data Exchange (ETDEWEB)
Avila Moreno, R.; Barrdahl, R.; Haegg, C.
1995-05-01
The main objective of the present study was to carry out a screening and a sensitivity analysis of the SSI TOOLBOX source term model SOSIM. This model is a part of the SSI TOOLBOX for radiological impact assessment of the Swedish disposal concept for high-level waste KBS-3. The outputs of interest for this purpose were: the total released fraction, the time of total release, the time and value of maximum release rate, the dose rates after direct releases of the biosphere. The source term equations were derived and simple equations and methods were proposed for calculation of these. A literature survey has been performed in order to determine a characteristic variation range and a nominal value for each model parameter. In order to reduce the model uncertainties the authors recommend a change in the initial boundary condition for solution of the diffusion equation for highly soluble nuclides. 13 refs.
A high precision video-electronic measuring system for use with solid state track detectors
International Nuclear Information System (INIS)
Schott, J.U.; Schopper, E.; Staudte, R.
1976-01-01
A video-electronic image analyzing system Quantimet 720 has been modified to meet the requirements of the measurement of tracks of nuclear particles in solid state track detectors with resulting improvement of precision, speed, and the elimination of subjective influences. A microscope equipped with an automatic XY stage projects the image onto the cathode of a vidicon-amplifier. Within the TV-picture generated, characterized by the coordinate XY in the specimen, we determine coordinates xy of events by setting cross lines on the screen which correspond to a digital accuracy of 0.1 μm at the position of the object. Automatic movement in Z-direction can be performed by stepping motor and measured electronically, or continously by setting electric voltage on a piezostrictive support of the objective. (orig.) [de
The 1989 progress report: Solid-state Mechanics
International Nuclear Information System (INIS)
Habib, P.
1989-01-01
The 1989 progress report of the laboratory of Solid-state Mechanics of the Polytechnic School (France) is presented. The investigations are focused on the study of strain and failure of solids and structures. The results reported concern the fields of: stability and bifurcation of elastic or inelastic systems, damage and fatigue (resistance improvement, failure risks on pipe systems, crack propagation), the development of a computer code for soil strengthening by using linear inclusions, mechanical behavior of several rocks for the safety of underground works, expert systems. The published papers, the conferences and the Laboratory staff are listed [fr
Solid State Ionics: from Michael Faraday to green energy-the European dimension.
Funke, Klaus
2013-08-01
Solid State Ionics has its roots essentially in Europe. First foundations were laid by Michael Faraday who discovered the solid electrolytes Ag 2 S and PbF 2 and coined terms such as cation and anion , electrode and electrolyte . In the 19th and early 20th centuries, the main lines of development toward Solid State Ionics, pursued in Europe, concerned the linear laws of transport, structural analysis, disorder and entropy and the electrochemical storage and conversion of energy. Fundamental contributions were then made by Walther Nernst, who derived the Nernst equation and detected ionic conduction in heterovalently doped zirconia, which he utilized in his Nernst lamp. Another big step forward was the discovery of the extraordinary properties of alpha silver iodide in 1914. In the late 1920s and early 1930s, the concept of point defects was established by Yakov Il'ich Frenkel, Walter Schottky and Carl Wagner, including the development of point-defect thermodynamics by Schottky and Wagner. In terms of point defects, ionic (and electronic) transport in ionic crystals became easy to visualize. In an 'evolving scheme of materials science', point disorder precedes structural disorder, as displayed by the AgI-type solid electrolytes (and other ionic crystals), by ion-conducting glasses, polymer electrolytes and nano-composites. During the last few decades, much progress has been made in finding and investigating novel solid electrolytes and in using them for the preservation of our environment, in particular in advanced solid state battery systems, fuel cells and sensors. Since 1972, international conferences have been held in the field of Solid State Ionics, and the International Society for Solid State Ionics was founded at one of them, held at Garmisch-Partenkirchen, Germany, in 1987.
Solid State Ionics: from Michael Faraday to green energy—the European dimension
Funke, Klaus
2013-01-01
Solid State Ionics has its roots essentially in Europe. First foundations were laid by Michael Faraday who discovered the solid electrolytes Ag2S and PbF2 and coined terms such as cation and anion, electrode and electrolyte. In the 19th and early 20th centuries, the main lines of development toward Solid State Ionics, pursued in Europe, concerned the linear laws of transport, structural analysis, disorder and entropy and the electrochemical storage and conversion of energy. Fundamental contributions were then made by Walther Nernst, who derived the Nernst equation and detected ionic conduction in heterovalently doped zirconia, which he utilized in his Nernst lamp. Another big step forward was the discovery of the extraordinary properties of alpha silver iodide in 1914. In the late 1920s and early 1930s, the concept of point defects was established by Yakov Il'ich Frenkel, Walter Schottky and Carl Wagner, including the development of point-defect thermodynamics by Schottky and Wagner. In terms of point defects, ionic (and electronic) transport in ionic crystals became easy to visualize. In an ‘evolving scheme of materials science’, point disorder precedes structural disorder, as displayed by the AgI-type solid electrolytes (and other ionic crystals), by ion-conducting glasses, polymer electrolytes and nano-composites. During the last few decades, much progress has been made in finding and investigating novel solid electrolytes and in using them for the preservation of our environment, in particular in advanced solid state battery systems, fuel cells and sensors. Since 1972, international conferences have been held in the field of Solid State Ionics, and the International Society for Solid State Ionics was founded at one of them, held at Garmisch-Partenkirchen, Germany, in 1987. PMID:27877585
Solid State Ionics: from Michael Faraday to green energy—the European dimension
Directory of Open Access Journals (Sweden)
Klaus Funke
2013-01-01
Full Text Available Solid State Ionics has its roots essentially in Europe. First foundations were laid by Michael Faraday who discovered the solid electrolytes Ag2S and PbF2 and coined terms such as cation and anion, electrode and electrolyte. In the 19th and early 20th centuries, the main lines of development toward Solid State Ionics, pursued in Europe, concerned the linear laws of transport, structural analysis, disorder and entropy and the electrochemical storage and conversion of energy. Fundamental contributions were then made by Walther Nernst, who derived the Nernst equation and detected ionic conduction in heterovalently doped zirconia, which he utilized in his Nernst lamp. Another big step forward was the discovery of the extraordinary properties of alpha silver iodide in 1914. In the late 1920s and early 1930s, the concept of point defects was established by Yakov Il'ich Frenkel, Walter Schottky and Carl Wagner, including the development of point-defect thermodynamics by Schottky and Wagner. In terms of point defects, ionic (and electronic transport in ionic crystals became easy to visualize. In an 'evolving scheme of materials science', point disorder precedes structural disorder, as displayed by the AgI-type solid electrolytes (and other ionic crystals, by ion-conducting glasses, polymer electrolytes and nano-composites. During the last few decades, much progress has been made in finding and investigating novel solid electrolytes and in using them for the preservation of our environment, in particular in advanced solid state battery systems, fuel cells and sensors. Since 1972, international conferences have been held in the field of Solid State Ionics, and the International Society for Solid State Ionics was founded at one of them, held at Garmisch-Partenkirchen, Germany, in 1987.
Thermal management of solid state lighting module
Ye, H.
2014-01-01
Solid-State Lighting (SSL), powered by Light-Emitting Diodes (LEDs), is an energy-efficient technology for lighting systems. In contrast to incandescent lights which obtain high efficiency at high temperatures, the highest efficiency of LEDs is reached at low temperatures. The thermal management in
Comparison of the half-value layer: ionization chambers vs solid-state meters
International Nuclear Information System (INIS)
Pereira, L.C.S.; Navarro, V.C.C.; Navarro, M.V.T.; Macedo, E.M.
2015-01-01
Generally, the half value layer (HVL) is determined by using ionization chambers and aluminum filters. However, some solid-state dosimeters allow simultaneous measurements of X-ray's parameters, among which the HVL. The main objective of this study was to compare the HVL's values indicated by four different solid-state dosimeters, whose values were measured by ionization chambers. The maximum difference found between the two methods was 11.42%, one the solid-state dosimeters, showing that the use these instruments to determine CSR in industrial X-ray should be subject to a more thorough evaluation. (author)
Phosphorus nuclear magnetic resonance imaging in solid bone
International Nuclear Information System (INIS)
Li, Limin.
1990-01-01
Phosphorus ( 31 P) nuclear magnetic resonance (NMR) double-pulse transient experiments of solid bone have shown that the spins dephased by the dipolar spin-spin interactions can be refocused with a 90 degree-β pulse sequence so that an echo is observable at some time following the second pulse. The decay time constant of the maximum echo amplitude is larger than that of the free induction decay (FID) signal from a single 90 degree pulse. Depending on the nutation angle of the second pulse, the former decay time constant is about three-five times as long as the latter one. The dipolar-echo properties of the bone may be relevant with the interpair dipolar interactions. The experiments have also show that, in general, the time for the transient signal from the double pulses to reach the maximum amplitude is not equal to the pulse separation. This can be attributed to the effect of the heteronuclear dipolar interactions. In addition, it is found experimentally that refocused gradients applied only in a time interval of the formation of an echo have the capability of phase-encoding spatial information. Based on this, a new imaging method was proposed. With the method, several 31 P images of the solid bone samples have been obtained. The picture element size is 1-1.5 mm with very good signal-to-noise ratios. The imaging ability of the refocused gradients may be relevant with the inhomogeneous local field produced by the interpair dipolar interactions
Solid state nuclear track detectors
International Nuclear Information System (INIS)
Medeiros, J.A.; Carvalho, M.L.C.P. de
1992-12-01
Solid state nuclear track detectors (SSNTD) are dielectric materials, crystalline or vitreous, which registers tracks of charged nuclear particles, like alpha particles or fission fragments. Chemical etching of the detectors origin tracks that are visible at the optical microscope: track etching rate is higher along the latent track, where damage due to the charged particle increase the chemical potential, and etching rate giving rise to holes, the etched tracks. Fundamental principles are presented as well as some ideas of main applications. (author)
Noginov, Mikhail A
2005-01-01
Random lasers are the simplest sources of stimulated emission without cavity, with the feedback provided by scattering in a gain medium. First proposed in the late 60’s, random lasers have grown to a large research field. This book reviews the history and the state of the art of random lasers, provides an outline of the basic models describing their behavior, and describes the recent advances in the field. The major focus of the book is on solid-state random lasers. However, it also briefly describes random lasers based on liquid dyes with scatterers. The chapters of the book are almost independent of each other. So, the scientists or engineers interested in any particular aspect of random lasers can read directly the relevant section. Researchers entering the field of random lasers will find in the book an overview of the field of study. Scientists working in the field can use the book as a reference source.
Spring meeting of the DPG Working Group 'Solid state physics'
International Nuclear Information System (INIS)
1996-01-01
The volume contains abstracts of the contributions to the Spring Meeting of the Solid State Physics Section with the topics dielectric solids, thin films, dynamics and statistical physics, semiconductor physics, magnetism, metal physics, surface physics, low temperature physics, vacuum physics and engineering, chemical physics. (MM)
Solid state fermentation (SSF): diversity of applications to valorize waste and biomass.
Lizardi-Jiménez, M A; Hernández-Martínez, R
2017-05-01
Solid state fermentation is currently used in a range of applications including classical applications, such as enzyme or antibiotic production, recently developed products, such as bioactive compounds and organic acids, new trends regarding bioethanol and biodiesel as sources of alternative energy, and biosurfactant molecules with environmental purposes of valorising unexploited biomass. This work summarizes the diversity of applications of solid state fermentation to valorize biomass regarding alternative energy and environmental purposes. The success of applying solid state fermentation to a specific process is affected by the nature of specific microorganisms and substrates. An exhaustive number of microorganisms able to grow in a solid matrix are presented, including fungus such as Aspergillus or Penicillum for antibiotics, Rhizopus for bioactive compounds, Mortierella for biodiesel to bacteria, Bacillus for biosurfactant production, or yeast for bioethanol.
Clinical Application of Solid Model Based on Trabecular Tibia Bone CT Images Created by 3D Printer.
Cho, Jaemo; Park, Chan-Soo; Kim, Yeoun-Jae; Kim, Kwang Gi
2015-07-01
The aim of this work is to use a 3D solid model to predict the mechanical loads of human bone fracture risk associated with bone disease conditions according to biomechanical engineering parameters. We used special image processing tools for image segmentation and three-dimensional (3D) reconstruction to generate meshes, which are necessary for the production of a solid model with a 3D printer from computed tomography (CT) images of the human tibia's trabecular and cortical bones. We examined the defects of the mechanism for the tibia's trabecular bones. Image processing tools and segmentation techniques were used to analyze bone structures and produce a solid model with a 3D printer. These days, bio-imaging (CT and magnetic resonance imaging) devices are able to display and reconstruct 3D anatomical details, and diagnostics are becoming increasingly vital to the quality of patient treatment planning and clinical treatment. Furthermore, radiographic images are being used to study biomechanical systems with several aims, namely, to describe and simulate the mechanical behavior of certain anatomical systems, to analyze pathological bone conditions, to study tissues structure and properties, and to create a solid model using a 3D printer to support surgical planning and reduce experimental costs. These days, research using image processing tools and segmentation techniques to analyze bone structures to produce a solid model with a 3D printer is rapidly becoming very important.
Method and system for making integrated solid-state fire-sets and detonators
Energy Technology Data Exchange (ETDEWEB)
O' Brien, Dennis W. (Livermore, CA); Druce, Robert L. (Union City, CA); Johnson, Gary W. (Livermore, CA); Vogtlin, George E. (Fremont, CA); Barbee, Jr., Troy W. (Palo Alto, CA); Lee, Ronald S. (Livermore, CA)
1998-01-01
A slapper detonator comprises a solid-state high-voltage capacitor, a low-jitter dielectric breakdown switch and trigger circuitry, a detonator transmission line, an exploding foil bridge, and a flier material. All these components are fabricated in a single solid-state device using thin film deposition techniques.
International Nuclear Information System (INIS)
Hu, Xiaobing; Fisher, Craig A.J.; Kobayashi, Shunsuke; Ikuhara, Yumi H.; Fujiwara, Yasuyuki; Hoshikawa, Keigo; Moriwake, Hiroki; Kohama, Keiichi; Iba, Hideki; Ikuhara, Yuichi
2017-01-01
La (1-x)/3 Li x NbO 3 (LLNbO) is a promising electrolyte material for solid-state lithium-ion batteries because it is stable in contact with Li metal and contains a high concentration of intrinsic Li-ion vacancies. One strategy for improving its ionic conductivity and making it more competitive with other solid-state Li-ion electrolytes is to disorder the Li-ion vacancies by appropriate post-synthesis heat treatment, e.g., annealing. In this study, we examine the effects of annealing on single crystals of LLNbO with Li contents x = 0.07 and 0.13 based on simultaneous atomic resolution high angle annular dark field and annular bright field imaging methods using state-of-the-art aberration corrected scanning transmission electron microscopes. It is found that La modulation within A1 layers of the cation-deficient layered perovskite structure becomes more diffuse after annealing. In addition, some La atoms move to A-site positions and O4 window positions in the nominally vacant A2 layer, while O atom columns in this layer become rumpled in the [001] p direction, indicating that the NbO 6 octahedra are more heavily distorted after annealing. The observed crystal structure differences between as-prepared and annealed single crystals explain the drop in Li-ion conductivities of LLNbO single crystals after heat treatment.
Atomic and solid state physics with the 14UD
International Nuclear Information System (INIS)
Newton, C.S.
1975-02-01
The use of energetic heavy ions in atomic and solid state physics is discussed. Topics that are discussed include: 1) Properties of excited ions, 2) radiation damage studies by channeling, 3) energy loss of ions and range measurements, 4) oscillating effects in channeling, 5) x-ray production in solids, 6) coherence effects in channeling and 7) formation of united atoms. (author)
Characterization of the polymer Durolon as a solid state nuclear track detector
International Nuclear Information System (INIS)
Pugliesi, Fabio
2008-01-01
The polymer Durolon has been characterized as a solid state nuclear track detector. In these detectors a track, resulting from the damages in its molecular structure, induced by a heavy charged particle, is the testimony of the passage of the particle through the polymer. In order to characterize the Durolon the track diameter, track production rate, light transmission through the polymer and the critical angle of incidence of the particle have been studied. The main objective of such studies was to provide the necessary subsidies to understand the information registered. The damages have been induced by alpha particles from the nuclear reaction 10 B(n,α) 7 Li, by irradiating a boron screen in a thermal neutron field from an experimental facility installed in the beam-hole 08 of the IEA-R1 nuclear research reactor of IPEN-CNEN/SP. The study of the parameters have been performed by using a digital system developed in the present work. Its use has provided a higher quality and quickness regarding data acquisition and data analysis as well as the opportunity to quantify several other parameters regarding the imaging formation theory in solid state nuclear track detectors. The characteristics of the Durolon have been compared with the ones of two other detectors Makrofol-E and Makrofol-DE and have demonstrated its potentiality to use. (author)
Modeling all-solid-state Li-ion batteries
Danilov, D.; Niessen, R.A.H.; Notten, P.H.L.
2011-01-01
A mathematical model for all-solid-state Li-ion batteries is presented. The model includes the charge transfer kinetics at the electrode/electrolyte interface, diffusion of lithium in the intercalation electrode, and diffusion and migration of ions in the electrolyte. The model has been applied to
A High Power Linear Solid State Pulser
International Nuclear Information System (INIS)
Boris Yen; Brent Davis; Rex Booth
1999-01-01
Particle Accelerators require high voltage and often high power. Typically the high voltage/power generation utilizes a topology with an extra energy store and a switching means to extract that stored energy. The switches may be active or passive devices. Active switches are hard or soft vacuum tubes, or semiconductors. When required voltages exceed tens of kilovolts, numerous semiconductors are stacked to withstand that potential. Such topologies can use large numbers of critical parts that, when in series, compromise the system reliability and performance. This paper describes a modular, linear, solid state amplifier which uses a parallel array of semiconductors, coupled with transmission line transformers. Such a design can provide output signals with voltages exceeding 10kV (into 50-ohms), and with rise and fall times (10-90 % amplitude) that are less than 1--ns. This compact solid state amplifier is modular, and has both hot-swap and soft fail capabilities
Broadband spectrally dynamic solid state illumination source
Energy Technology Data Exchange (ETDEWEB)
Nicol, David B; Asghar, Ali; Gupta, Shalini; Kang, Hun; Pan, Ming [Georgia Institute of Technology, School of Electrical and Computer Engineering, Atlanta, GA 30332-0250 (United States); Strassburg, Martin [Georgia Institute of Technology, School of Electrical and Computer Engineering, Atlanta, GA 30332-0250 (United States); Georgia State University, Department of Physics and Astronomy, Atlanta, GA 30302-4106 (United States); Summers, Chris; Ferguson, Ian T [Georgia Institute of Technology, School of Materials Science and Engineering, Atlanta, GA 30332 (United States)
2006-06-15
Solid state lighting has done well recently in niche markets such as signage and displays, however, no available SSL technologies incorporate all the necessary attributes for general illumination. Development of a novel solid state general illumination source is discussed here. Two LEDs emitting at two distinct wavelengths can be monolithically grown and used to excite two or more phosphors with varied excitation spectra. The combined phosphorescence spectrum can then be controlled by adjusting the relative intensities of the two LED emissions. Preliminary phosphor analysis shows such a scheme to be viable for use in a spectrally dynamic broadband general illumination source. A tunnel junction is envisioned as a means of current spreading in a buried layer for three terminal operation. However, tunnel junction properties in GaN based materials are not well understood, and require further optimization to be practical devices. Preliminary results on GaN tunnel junctions are presented here as well. (copyright 2006 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
Novel Non-Vacuum Fabrication of Solid State Lithium Ion Battery Components
Energy Technology Data Exchange (ETDEWEB)
Oladeji, I. [Planar Energy Devices, Inc.; Wood, D. L. [ORNL; Wood, III, D. L.
2012-10-19
The purpose of this Cooperative Research and Development Agreement (CRADA) between Oak Ridge National Laboratory (ORNL) and Planar Energy Devices, Inc. was to develop large-scale electroless deposition and photonic annealing processes associated with making all-solid-state lithium ion battery cathode and electrolyte layers. However, technical and processing difficulties encountered in 2011 resulted in the focus of the CRADA being redirected solely to annealing of the cathode thin films. In addition, Planar Energy Devices de-emphasized the importance of annealing of the solid-state electrolytes within the scope of the project, but materials characterization of stabilized electrolyte layers was still of interest. All-solid-state lithium ion batteries are important to automotive and stationary energy storage applications because they would eliminate the problems associated with the safety of the liquid electrolyte in conventional lithium ion batteries. However, all-solid-state batteries are currently produced using expensive, energy consuming vacuum methods suited for small electrode sizes. Transition metal oxide cathode and solid-state electrolyte layers currently require about 30-60 minutes at 700-800°C vacuum processing conditions. Photonic annealing requires only milliseconds of exposure time at high temperature and a total of <1 min of cumulative processing time. As a result, these processing techniques are revolutionary and highly disruptive to the existing lithium ion battery supply chain. The current methods of producing all-solid-state lithium ion batteries are only suited for small-scale, low-power cells and involve high-temperature vacuum techniques. Stabilized LiNixMnyCozAl1-x-y-zO2 (NMCA) nanoparticle films were deposited onto stainless steel substrates using Planar Energy Devices’ streaming process for electroless electrochemical deposition (SPEED). Since successful SPEED trials were demonstrated by Planar Energy Devices with NMCA prior to 2010, this
Method and system for making integrated solid-state fire-sets and detonators
O`Brien, D.W.; Druce, R.L.; Johnson, G.W.; Vogtlin, G.E.; Barbee, T.W. Jr.; Lee, R.S.
1998-03-24
A slapper detonator comprises a solid-state high-voltage capacitor, a low-jitter dielectric breakdown switch and trigger circuitry, a detonator transmission line, an exploding foil bridge, and a flier material. All these components are fabricated in a single solid-state device using thin film deposition techniques. 13 figs.
Rechargeable quasi-solid state lithium battery with organic crystalline cathode
Hanyu, Yuki; Honma, Itaru
2012-01-01
Utilization of metal-free low-cost high-capacity organic cathodes for lithium batteries has been a long-standing goal, but critical cyclability problems owing to dissolution of active materials into the electrolyte have been an inevitable obstacle. For practical utilisation of numerous cathode-active compounds proposed over the past decades, a novel battery construction strategy is required. We have designed a solid state cell that accommodates organic cathodic reactions in solid phase. The cell was successful at achieving high capacity exceeding 200 mAh/g with excellent cycleability. Further investigations confirmed that our strategy is effective for numerous other redox-active organic compounds. This implies hundreds of compounds dismissed before due to low cycleability would worth a re-visit under solid state design. PMID:22693655
Single longitudinal mode operation of a solid-state dye laser oscillator
Lim, G; Kim, H S; Cha, B H; Lee, J M
2000-01-01
We have operated a single longitudinal mode of a solid-state dye laser oscillator in a Littman configuration. The host material of the solid-state gain medium was rhodamine dye-doped poly (methyl methacrylate). The pumping source was the second harmonic of a Nd:YAG laser with a repetition rate of 10 Hz. The measured linewidth of the laser output was about 1.5 GHz.
Solid state phase change materials for thermal energy storage in passive solar heated buildings
Benson, D. K.; Christensen, C.
1983-11-01
A set of solid state phase change materials was evaluated for possible use in passive solar thermal energy storage systems. The most promising materials are organic solid solutions of pentaerythritol, pentaglycerine and neopentyl glycol. Solid solution mixtures of these compounds can be tailored so that they exhibit solid-to-solid phase transformations at any desired temperature within the range from less than 25 deg to 188 deg. Thermophysical properties such as thermal conductivity, density and volumetric expansion were measured. Computer simulations were used to predict the performance of various Trombe wall designs incorporating solid state phase change materials. Optimum performance was found to be sensitive to the choice of phase change temperatures and to the thermal conductivity of the phase change material. A molecular mechanism of the solid state phase transition is proposed and supported by infrared spectroscopic evidence.
Radioactive ion beams and techniques for solid state research
International Nuclear Information System (INIS)
Correia, J.G.
1998-01-01
In this paper we review the most recent and new applications of solid state characterization techniques using radioactive ion beams. For such type ofresearch, high yields of chemically clean ion beams of radioactive isotopesare needed which are provided by the on-line coupling of high resolution isotope separators to particle accelerators, such as the isotope separator on-line (ISOLDE) facility at CERN. These new experiments are performed by an increasing number of solid state groups. They combine nuclear spectroscopic techniques such as Moessbauer, perturbed angular correlations (PAC) and emission channeling with the traditional non-radioactive techniques liked deep level transient spectroscopy (DLTS) and Hall effect measurements. Recently isotopes of elements, not available before, were successfully used in new PAC experiments, and the first photoluminescence (PL) measurements, where the element transmutation plays the essential role on the PL peak identification, have been performed. The scope of applications of radioactive ion beams for research in solid state physics will be enlarged in the near future, with the installation at ISOLDE of a post-accelerator device providing radioactive beams with energies ranging from a few keV up to a few MeV. (orig.)
Thermoacoustics of solids: A pathway to solid state engines and refrigerators
Hao, Haitian; Scalo, Carlo; Sen, Mihir; Semperlotti, Fabio
2018-01-01
Thermoacoustic oscillations have been one of the most exciting discoveries of the physics of fluids in the 19th century. Since its inception, scientists have formulated a comprehensive theoretical explanation of the basic phenomenon which has later found several practical applications to engineering devices. To date, all studies have concentrated on the thermoacoustics of fluid media where this fascinating mechanism was exclusively believed to exist. Our study shows theoretical and numerical evidence of the existence of thermoacoustic instabilities in solid media. Although the underlying physical mechanism exhibits some interesting similarities with its counterpart in fluids, the theoretical framework highlights relevant differences that have important implications on the ability to trigger and sustain the thermoacoustic response. This mechanism could pave the way to the development of highly robust and reliable solid-state thermoacoustic engines and refrigerators.
Equation of state of solid hydrogen at 0 deg K. A bibliography
International Nuclear Information System (INIS)
Masse, J.-L.
1976-02-01
A bibliography on solid hydrogen at 0 deg K and its equation of state is presented. The isotopic derivatives of H 2 , such as D 2 , HD... have been also considered. Both phases of solid hydrogen have been studied: the molecular phase, stable at low pressure, and the hypothetical metallic phase which must be stable at high pressure. The study of the molecular phase is preceded by a study of the (H 2 ,H 2 ) system of two interacting H 2 , molecules, the knowledge of this interaction being necessary for the evaluation of the properties of the molecular solid phase. The three systems: (H 2 ,H 2 ) and molecular solid and metallic hydrogen have been considered from the experimental and theoretical points of view. The properties of these systems, the measurement or the calculation of which are described, have been chosen on account of their usefulness for the research of the equation of state of molecular or metallic solid hydrogen. Different interaction potentials of two hydrogen molecules and different equations of state of molecular solid hydrogen are given. Some theoretical studies are proposed [fr
Energy Technology Data Exchange (ETDEWEB)
Kabalka, George W
2011-05-20
The goal of this research was on the development of new, rapid, and efficient synthetic methods for incorporating short-lived radionuclides into agents of use in measuring dynamic processes. The initial project period (Year 1) was focused on the preparation of stable, solid state precursors that could be used to efficiently incorporate short-lived radioisotopes into small molecules of use in biological applications (environmental, plant, and animal). The investigation included development and evaluation of new methods for preparing carbon-carbon and carbon-halogen bonds for use in constructing the substrates to be radiolabeled. The second phase (Year 2) was focused on developing isotope incorporation techniques using the stable, boronated polymeric precursors. The final phase (Year 3), was focused on the preparation of specific radiolabeled agents and evaluation of their biodistribution using micro-PET and micro-SPECT. In addition, we began the development of a new series of polymeric borane reagents based on polyethylene glycol backbones.
Majorana modes in solid state systems and its dynamics
Zhang, Qi; Wu, Biao
2018-04-01
We review the properties of Majorana fermions in particle physics and point out that Majorana modes in solid state systems are significantly different. The key reason is the concept of anti-particle in solid state systems is different from its counterpart in particle physics. We define Majorana modes as the eigenstates of Majorana operators and find that they can exist both at edges and in the bulk. According to our definition, only one single Majorana mode can exist in a system no matter at edges or in the bulk. Kitaev's spinless p-wave superconductor is used to illustrate our results and the dynamical behavior of the Majorana modes.
Peakr: simulating solid-state NMR spectra of proteins
International Nuclear Information System (INIS)
Schneider, Robert; Odronitz, Florian; Hammesfahr, Bjorn; Hellkamp, Marcel; Kollmar, Martin
2013-01-01
When analyzing solid-state nuclear magnetic resonance (NMR) spectra of proteins, assignment of resonances to nuclei and derivation of restraints for 3D structure calculations are challenging and time-consuming processes. Simulated spectra that have been calculated based on, for example, chemical shift predictions and structural models can be of considerable help. Existing solutions are typically limited in the type of experiment they can consider and difficult to adapt to different settings. Here, we present Peakr, a software to simulate solid-state NMR spectra of proteins. It can generate simulated spectra based on numerous common types of internuclear correlations relevant for assignment and structure elucidation, can compare simulated and experimental spectra and produces lists and visualizations useful for analyzing measured spectra. Compared with other solutions, it is fast, versatile and user friendly. (authors)
Effects of different SSI parameters on the floor response spectra of a nuclear reactor building
International Nuclear Information System (INIS)
Kabir, A.F.; Bolourchi, S.; Maryak, M.E.
1991-01-01
The effects of several critical soil-structure interaction (SSI) parameters on the floor response spectra (FRS) of a typical nuclear reactor building have been examined. These parameters are computation of soil impedance functions using different approaches, scattering effects (reductions in ground motion due to embedment and rigidity of building foundation) and strain dependency of soil dynamic properties. This paper reports that the significant conclusions of the study, which are applicable to a deeply embedded very rigid nuclear reactor building, are as follows: FRS generated without considering scattering effects are highly conservative; differences between FRS, generated considering strain-dependency of soil dynamic properties, and those generated suing low-strain values, are not significant; and the lumped-parameter approach of SSI calculations, which only uses a single value of soil shear modulus in impedance calculations, may not be able to properly compute the soil impedances for a soil deposit with irregularly varying properties with depth
Directory of Open Access Journals (Sweden)
Barbara Celuppi Marques
2006-01-01
Full Text Available We compare isotherms for soybeans and soybeans fermented with Rhizopus oryzae, showing that in solid-state fermentation the biomass affects the isotherm of the fermenting solids. Equations are developed to calculate, for a given overall water content of the fermenting solids, the water contents of the biomass and residual substrate, as well as the water activity. A case study, undertaken using a mathematical model of a well-mixed bioreactor, shows that if water additions are made on the basis of the assumption that fermenting solids have the same isotherm as the substrate itself, poor growth can result since the added water does not maintain the water activity at levels favorable for growth. We conclude that the effect of the microbial biomass on the isotherm of the fermenting solids must be taken into account in mathematical models of solid-state fermentation bioreactors.
Chen, Y.-R.; Chiu, K.-F.; Lin, H. C.; Chen, C.-L.; Hsieh, C. Y.; Tsai, C. B.; Chu, B. T. T.
2014-11-01
Sulfonated polyetheretherketone (SPEEK) has been synthesised by sulphonation process and used as the solid-state electrolyte, binder and surfactant for supercapacitors. Reduced graphene dispersed by SPEEK is used as a high-efficiency conducting additive in solid-state supercapacitors. It is found that SPEEK can improve the stability of the reduced graphene dispersion significantly, and therefore, the solid-state supercapacitors show a large decrease in IR drop and charge-transfer resistance (Rct), resulting in a higher rate capability. The solid-state supercapacitors with the activated carbon/reduced graphene/SPEEK/electrode can be operated from 1 to 8 A/g and exhibit capacity retention of 93%. The noteworthy is more than twice higher value for capacity retention by comparison with the solid-state supercapacitors using activated carbon/reduced graphene/PVDF electrode (capacity retention is 36%). The cell of reduced graphene with SPEEK can be cycled over 5000 times at 5 A/g with no capacitance fading.
Lithiated and sulphonated poly(ether ether ketone) solid state electrolyte films for supercapacitors
Energy Technology Data Exchange (ETDEWEB)
Chiu, K.-F.; Su, S.-H., E-mail: minimono42@gmail.com
2013-10-01
Poly(ether ether ketone) (PEEK) films have been synthesised and used as solid-state electrolytes for supercapacitors. In order to increase their ion conductivity, the PEEK films were sulphonated by sulphuric acid, and various amounts of LiClO{sub 4} were added. The solid-state electrolyte films were characterised by Fourier transform infrared spectroscopy, scanning electron microscopy, energy-dispersive X-ray spectroscopy, and thermogravimetric analysis. The ionic conductivities of the electrolyte films were analysed by performing electrochemical impedance spectroscopy. The obtained electrolyte films can be sandwiched or directly coated on activated carbon electrodes to form solid-state supercapacitors. The electrochemical characteristics of these supercapacitors were investigated by performing cyclic voltammetry and charge–discharge tests. Under an optimal content of LiClO{sub 4}, the supercapacitor can provide a capacitance as high as 190 F/g. After 1000 cycles, the supercapacitors show almost no capacitance fading, indicating high stability of the solid-state electrolyte films. - Highlights: • Poly(ether ether ketone) (PEEK) films have been used as solid-state electrolytes. • LiClO4 addition can efficiently improve the ionic conductivity. • Supercapacitors using PEEK electrolyte films deliver high capacitance.
Cho, Eugene N; Zhitomirsky, David; Han, Grace G D; Liu, Yun; Grossman, Jeffrey C
2017-03-15
Solar thermal fuels (STFs) harvest and store solar energy in a closed cycle system through conformational change of molecules and can release the energy in the form of heat on demand. With the aim of developing tunable and optimized STFs for solid-state applications, we designed three azobenzene derivatives functionalized with bulky aromatic groups (phenyl, biphenyl, and tert-butyl phenyl groups). In contrast to pristine azobenzene, which crystallizes and makes nonuniform films, the bulky azobenzene derivatives formed uniform amorphous films that can be charged and discharged with light and heat for many cycles. Thermal stability of the films, a critical metric for thermally triggerable STFs, was greatly increased by the bulky functionalization (up to 180 °C), and we were able to achieve record high energy density of 135 J/g for solid-state STFs, over a 30% improvement compared to previous solid-state reports. Furthermore, the chargeability in the solid state was improved, up to 80% charged from 40% charged in previous solid-state reports. Our results point toward molecular engineering as an effective method to increase energy storage in STFs, improve chargeability, and improve the thermal stability of the thin film.
Lithiated and sulphonated poly(ether ether ketone) solid state electrolyte films for supercapacitors
International Nuclear Information System (INIS)
Chiu, K.-F.; Su, S.-H.
2013-01-01
Poly(ether ether ketone) (PEEK) films have been synthesised and used as solid-state electrolytes for supercapacitors. In order to increase their ion conductivity, the PEEK films were sulphonated by sulphuric acid, and various amounts of LiClO 4 were added. The solid-state electrolyte films were characterised by Fourier transform infrared spectroscopy, scanning electron microscopy, energy-dispersive X-ray spectroscopy, and thermogravimetric analysis. The ionic conductivities of the electrolyte films were analysed by performing electrochemical impedance spectroscopy. The obtained electrolyte films can be sandwiched or directly coated on activated carbon electrodes to form solid-state supercapacitors. The electrochemical characteristics of these supercapacitors were investigated by performing cyclic voltammetry and charge–discharge tests. Under an optimal content of LiClO 4 , the supercapacitor can provide a capacitance as high as 190 F/g. After 1000 cycles, the supercapacitors show almost no capacitance fading, indicating high stability of the solid-state electrolyte films. - Highlights: • Poly(ether ether ketone) (PEEK) films have been used as solid-state electrolytes. • LiClO4 addition can efficiently improve the ionic conductivity. • Supercapacitors using PEEK electrolyte films deliver high capacitance
Quantum theory of the solid state part B
Callaway, Joseph
1974-01-01
Quantum Theory of the Solid State, Part B describes the concepts and methods of the central problems of the quantum theory of solids. This book discusses the developed machinery applied to impurities, disordered systems, effects of external fields, transport phenomena, and superconductivity. The representation theory, low field diamagnetic susceptibility, electron-phonon interaction, and Landau theory of fermi liquids are also deliberated. This text concludes with an introduction to many-body theory and some applications. This publication is a suitable textbook for students who have completed
Advanced materials for solid state hydrogen storage: “Thermal engineering issues”
International Nuclear Information System (INIS)
Srinivasa Murthy, S.; Anil Kumar, E.
2014-01-01
Hydrogen has been widely recognized as the “Energy Carrier” of the future. Efficient, reliable, economical and safe storage and delivery of hydrogen form important aspects in achieving success of the “Hydrogen Economy”. Gravimetric and volumetric storage capacities become important when one considers portable and mobile applications of hydrogen. In the case of solid state hydrogen storage, the gas is reversibly embedded (by physisorption and/or chemisorption) in a solid matrix. A wide variety of materials such as intermetallics, physisorbents, complex hydrides/alanates, metal organic frameworks, etc. have been investigated as possible storage media. This paper discusses the feasibility of lithium– and sodium–aluminum hydrides with emphasis on their thermodynamic and thermo-physical properties. Drawbacks such as poor heat transfer characteristics and poor kinetics demand special attention to the thermal design of solid state storage devices. - Highlights: • Advanced materials suitable for solid state hydrogen storage are discussed. • Issues related to thermodynamic and thermo-physical properties of hydriding materials are brought out. • Hydriding and dehydriding behavior including sorption kinetics of complex hydrides with emphasis on alanates are explained
Xu, Ruochen; Zhang, Shengzhao; Wang, Xiuli; Xia, Yan; Xia, Xinhui; Wu, Jianbo; Gu, Changdong; Tu, Jiangping
2018-04-20
Due to the increasing demand of security and energy density, all-solid-state lithium ion batteries have become the promising next-generation energy storage devices to replace the traditional liquid batteries with flammable organic electrolytes. In this Minireview, we focus on the recent developments of sulfide inorganic electrolytes for all-solid-state batteries. The challenges of assembling bulk-type all-solid-state batteries for industrialization are discussed, including low ionic conductivity of the present sulfide electrolytes, high interfacial resistance and poor compatibility between electrolytes and electrodes. Many efforts have been focused on the solutions for these issues. Although some progresses have been achieved, it is still far away from practical application. The perspectives for future research on all-solid-state lithium ion batteries are presented. © 2018 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.
Energy Technology Data Exchange (ETDEWEB)
Paul, Arya; Bhattacharya, Jayee; Sengupta, Surajit [S N Bose National Centre for Basic Sciences, Block JD, Sector III, Salt Lake, Calcutta 700 098 (India); Rao, Madan [Raman Research Institute, C V Raman Avenue, Bangalore 560 080 (India)
2008-09-10
We study the nucleation dynamics of a model solid state transformation and the criterion for microstructure selection. Using a molecular dynamics (MD) simulation, we had shown that the dynamics of the solid is accompanied by the creation of transient non-affine zones (NAZ), which evolve with the rapidly moving transformation front. Guided by our MD results, we formulate a dynamical continuum theory of solid state transformation, which couples the elastic strain to the non-affine deformation. We demonstrate that our elastoplastic description recovers all qualitative features of the MD simulation. We construct a dynamical phase diagram for microstructure selection, including regimes where martensite or ferrite obtains, in addition to making several testable predictions.
Solid State Energy Conversion Alliance (SECA) Solid Oxide Fuel Cell Program
Energy Technology Data Exchange (ETDEWEB)
Nguyen Minh
2006-07-31
This report summarizes the work performed for Phase I (October 2001 - August 2006) under Cooperative Agreement DE-FC26-01NT41245 for the U. S. Department of Energy, National Energy Technology Laboratory (DOE/NETL) entitled 'Solid State Energy Conversion Alliance (SECA) Solid Oxide Fuel Cell Program'. The program focuses on the development of a low-cost, high-performance 3-to-10-kW solid oxide fuel cell (SOFC) system suitable for a broad spectrum of power-generation applications. During Phase I of the program significant progress has been made in the area of SOFC technology. A high-efficiency low-cost system was designed and supporting technology developed such as fuel processing, controls, thermal management, and power electronics. Phase I culminated in the successful demonstration of a prototype system that achieved a peak efficiency of 41%, a high-volume cost of $724/kW, a peak power of 5.4 kW, and a degradation rate of 1.8% per 500 hours. . An improved prototype system was designed, assembled, and delivered to DOE/NETL at the end of the program. This prototype achieved an extraordinary peak efficiency of 49.6%.
Rapid Thermal Annealing of Cathode-Garnet Interface toward High-Temperature Solid State Batteries.
Liu, Boyang; Fu, Kun; Gong, Yunhui; Yang, Chunpeng; Yao, Yonggang; Wang, Yanbin; Wang, Chengwei; Kuang, Yudi; Pastel, Glenn; Xie, Hua; Wachsman, Eric D; Hu, Liangbing
2017-08-09
High-temperature batteries require the battery components to be thermally stable and function properly at high temperatures. Conventional batteries have high-temperature safety issues such as thermal runaway, which are mainly attributed to the properties of liquid organic electrolytes such as low boiling points and high flammability. In this work, we demonstrate a truly all-solid-state high-temperature battery using a thermally stable garnet solid-state electrolyte, a lithium metal anode, and a V 2 O 5 cathode, which can operate well at 100 °C. To address the high interfacial resistance between the solid electrolyte and cathode, a rapid thermal annealing method was developed to melt the cathode and form a continuous contact. The resulting interfacial resistance of the solid electrolyte and V 2 O 5 cathode was significantly decreased from 2.5 × 10 4 to 71 Ω·cm 2 at room temperature and from 170 to 31 Ω·cm 2 at 100 °C. Additionally, the diffusion resistance in the V 2 O 5 cathode significantly decreased as well. The demonstrated high-temperature solid-state full cell has an interfacial resistance of 45 Ω·cm 2 and 97% Coulombic efficiency cycling at 100 °C. This work provides a strategy to develop high-temperature all-solid-state batteries using garnet solid electrolytes and successfully addresses the high contact resistance between the V 2 O 5 cathode and garnet solid electrolyte without compromising battery safety or performance.
Molecular and solid-state properties of tris-(8-hydroxyquinolate)-aluminum
International Nuclear Information System (INIS)
Martin, Richard L.; Kress, Joel D.; Campbell, I. H.; Smith, D. L.
2000-01-01
We use a hybrid density-functional-theory approach to calculate ground-state electronic properties and a time-dependent density-functional-theory approach to investigate the excited state electronic properties of molecular tris-(8-hydroxyquinolate)-aluminum, Alq. The calculated molecular results are compared with measurements on dense solid-state films of Alq. We specifically consider: the optical absorption spectrum near the fundamental absorption threshold, the ionization potential, the single-particle energy gap, the static dielectric constant, and the electric-field dependence of the electron mobility. We find that the molecular calculations can describe the optical absorption spectrum near the fundamental absorption threshold without significant corrections for solid-state effects. The energies of the triplet excited states are computed and the lowest triplet is found to lie 0.64 eV below the lowest excited singlet state. In contrast, large dielectric corrections must be included for the molecular calculations to describe the ionization potential and single-particle energy gap. When these dielectric corrections are made, using the calculated molecular polarizability, which accurately gives the measured static dielectric constant, both the ionization potential and single-particle energy gap are well described. The calculated molecular dipole moment can be used to interpret the electric-field dependence of the electron mobility. The solid-state properties, determined from the molecular calculations, are then used in a device model to describe the measured current-voltage characteristics in Alq diodes. (c) 2000 The American Physical Society
1980-10-31
Fetterman G. A. Koepf* P. F. Goldsmith6 B.J. Clifton D. Buhl* N. R. Eriekson" D.D. Peck N. McAvoy* P. F. Tannenwald Accepted by Science St40... Fetterman 22 **** -^m^m-i^jm^ -«%, j». ■*** REFERENCES 1. Solid State Research Report, Lincoln Laboratory, M.I.T. (1980:2), pp. 11-12. DTK? AD-A092724...17. M.G. Raymer, J. Mostowski, and J. L. Carlsten, Phys. Rev. A 19, 2304(1979). - 18. W. A.M. Blumberg, U.R. Fetterman , D.D. Peck, and P.F
Reducing environmental burdens of solid-state lighting through end-of-life design
International Nuclear Information System (INIS)
Hendrickson, C T; Matthews, D H; Ashe, M; Jaramillo, P; McMichael, F C
2010-01-01
With 20% of US electricity used for lighting, energy efficient solid-state lighting technology could have significant benefits. While energy efficiency in use is important, the life cycle cost, energy and environmental impacts of light-emitting diode (LED) solid-state lighting could be reduced by reusing, remanufacturing or recycling components of the end products. Design decisions at this time for the nascent technology can reduce material and manufacturing burdens by considering the ease of disassembly, potential for remanufacturing, and recovery of parts and materials for reuse and recycling. We use teardowns of three commercial solid-state lighting products designed to fit in conventional Edison light bulb sockets to analyze potential end-of-life reuse strategies for solid-state lighting and recommend strategies for the industry. Current lamp designs would benefit from standardization of part connections to facilitate disassembly and remanufacturing of components, and fewer material types in structural pieces to maximize homogeneous materials recovery. The lighting industry should also start now to develop an effective product take-back system for collecting future end-of-life products.
Reducing environmental burdens of solid-state lighting through end-of-life design
Energy Technology Data Exchange (ETDEWEB)
Hendrickson, C T; Matthews, D H; Ashe, M; Jaramillo, P; McMichael, F C, E-mail: cth@cmu.ed [Green Design Institute, Carnegie Mellon University (United States)
2010-01-15
With 20% of US electricity used for lighting, energy efficient solid-state lighting technology could have significant benefits. While energy efficiency in use is important, the life cycle cost, energy and environmental impacts of light-emitting diode (LED) solid-state lighting could be reduced by reusing, remanufacturing or recycling components of the end products. Design decisions at this time for the nascent technology can reduce material and manufacturing burdens by considering the ease of disassembly, potential for remanufacturing, and recovery of parts and materials for reuse and recycling. We use teardowns of three commercial solid-state lighting products designed to fit in conventional Edison light bulb sockets to analyze potential end-of-life reuse strategies for solid-state lighting and recommend strategies for the industry. Current lamp designs would benefit from standardization of part connections to facilitate disassembly and remanufacturing of components, and fewer material types in structural pieces to maximize homogeneous materials recovery. The lighting industry should also start now to develop an effective product take-back system for collecting future end-of-life products.
Depletion mode pumping of solid state lasers
International Nuclear Information System (INIS)
Mundinger, D.; Solarz, R.; Beach, R.; Albrecht, G.; Krupke, W.
1990-01-01
Depletion mode pumping of solid state lasers is a new concept which offers features that are of interest for many practical applications. In this paper the authors discuss the physical properties and mechanisms that set the design requirements, present model calculations for a practical laser design, and discuss the results of recent experiments
Detection of DNA hybridizations using solid-state nanopores
International Nuclear Information System (INIS)
Balagurusamy, Venkat S K; Weinger, Paul; Sean Ling, Xinsheng
2010-01-01
We report an experimental study of using DNA translocation through solid-state nanopores to detect the sequential arrangement of two double-stranded 12-mer hybridization segments on a single-stranded DNA molecule. The sample DNA is a trimer molecule formed by hybridizing three single-stranded oligonucleotides. A polystyrene bead is attached to the end of the trimer DNA, providing a mechanism in slowing down the translocation and suppressing the thermal diffusion, thereby allowing the detection of short features of DNA by standard patch-clamp electronics. The electrical signature of the translocation of a trimer molecule through a nanopore has been identified successfully in the temporal traces of ionic current. The results reported here represent the first successful attempt in using a solid-state nanopore as an ionic scanning device in resolving individual hybridization segments (or 'probes') on a DNA molecule.
Detection of DNA hybridizations using solid-state nanopores
Energy Technology Data Exchange (ETDEWEB)
Balagurusamy, Venkat S K; Weinger, Paul; Sean Ling, Xinsheng, E-mail: Xinsheng_Ling@brown.edu [Department of Physics, Brown University, Providence, RI 02912 (United States)
2010-08-20
We report an experimental study of using DNA translocation through solid-state nanopores to detect the sequential arrangement of two double-stranded 12-mer hybridization segments on a single-stranded DNA molecule. The sample DNA is a trimer molecule formed by hybridizing three single-stranded oligonucleotides. A polystyrene bead is attached to the end of the trimer DNA, providing a mechanism in slowing down the translocation and suppressing the thermal diffusion, thereby allowing the detection of short features of DNA by standard patch-clamp electronics. The electrical signature of the translocation of a trimer molecule through a nanopore has been identified successfully in the temporal traces of ionic current. The results reported here represent the first successful attempt in using a solid-state nanopore as an ionic scanning device in resolving individual hybridization segments (or 'probes') on a DNA molecule.
Solid State Division annual progress report for period ending December 31, 1975
International Nuclear Information System (INIS)
Wilkinson, M.K.; Young, F.W. Jr.
1976-05-01
Research activities are reported in programs on theoretical solid state physics, physical properties of solids, radiation effects in metals, neutron scattering, research materials, and isotope research materials
PEO nanocomposite polymer electrolyte for solid state symmetric ...
Indian Academy of Sciences (India)
cells/supercapacitors) to electro-chromic displays, smart windows and ... electrolytes and their usage in lithium ion rechargeable solid state batteries are well .... the experimental plot using the Arrhenius relationship σ = σ0exp(−Ea/kT) where ...
Solid-State Division progress report for period ending March 31, 1983
International Nuclear Information System (INIS)
Green, P.H.; Watson, D.M.
1983-09-01
Progress and activities are reported on: theoretical solid-state physics (surfaces; electronic, vibrational, and magnetic properties; particle-solid interactions; laser annealing), surface and near-surface properties of solids (surface, plasma-material interactions, ion implantation and ion-beam mixing, pulsed-laser and thermal processing), defects in solids (radiation effects, fracture, impurities and defects, semiconductor physics and photovoltaic conversion), transport properties of solids (fast-ion conductors, superconductivity, mass and charge transport in materials), neutron scattering (small-angle scattering, lattice dynamics, magnetic properties, structure and instrumentation), and preparation and characterization of research materials (growth and preparative methods, nuclear waste forms, special materials)
Solid-State Division progress report for period ending March 31, 1983
Energy Technology Data Exchange (ETDEWEB)
Green, P.H.; Watson, D.M. (eds.)
1983-09-01
Progress and activities are reported on: theoretical solid-state physics (surfaces; electronic, vibrational, and magnetic properties; particle-solid interactions; laser annealing), surface and near-surface properties of solids (surface, plasma-material interactions, ion implantation and ion-beam mixing, pulsed-laser and thermal processing), defects in solids (radiation effects, fracture, impurities and defects, semiconductor physics and photovoltaic conversion), transport properties of solids (fast-ion conductors, superconductivity, mass and charge transport in materials), neutron scattering (small-angle scattering, lattice dynamics, magnetic properties, structure and instrumentation), and preparation and characterization of research materials (growth and preparative methods, nuclear waste forms, special materials). (DLC)
International Nuclear Information System (INIS)
Espejo, R.; Gill, A.
1998-01-01
The purpose of this report is to share and summarize our findings about the regulatory roles of SKI/SSI in the context of the Swedish Nuclear System (SNS), with an emphasis on nuclear waste management. The driving force in this review is to make decision processes more transparent. What is reported is based on interviews conducted with employees at SKI/SSI/SKB during early December 1996, the presentation to SKI/SSI in January 1997, discussions during the Shap Wells meeting in Cumbria during March 1997 and RISCOM internal discussions. We offer two hypotheses about the way the Nuclear Waste Management System (NWMS) appears to work. We choose one and derive from it a view about structural issues in SNS and NWMS. The conclusion is a set of systemic roles for the regulators. It is the comparison between these systemic roles and the actual situation that may trigger some adjustments in the system. Our hope is that these findings will make apparent feasible and desirable changes in the system in order to increase the chances for transparent decisions in the Nuclear Waste Management System. In summary, Section 2 includes a general background of the NWMS based on interviews and general information. Section 3 makes a more focused attempt to work out the issues expressed by people in the interviews. Section 4 discusses at a more conceptual level systemic ideas such as the unfolding of complexity. Section 5 is an attempt to organize viewpoints about the NWMS and offers hypotheses to support a preliminary diagnosis of the system in Section 6. We call this section 'A problem of identity'. It is only in Section 7 that basic systemic arguments are unfolded with the intention of supporting an appreciation of SKI/SSI's regulatory roles in the nuclear industry as a whole and nuclear waste management in particular. Section 8 offers a summary of conclusions
Solid State Division annual progress report for period ending December 31, 1975
Energy Technology Data Exchange (ETDEWEB)
Wilkinson, M.K.; Young, F.W. Jr.
1976-05-01
Research activities are reported in programs on theoretical solid state physics, physical properties of solids, radiation effects in metals, neutron scattering, research materials, and isotope research materials. (JRD)
Photoemission from excited states in rare gas solids by combining synchrotronradiation with a laser
International Nuclear Information System (INIS)
Bernstorff, S.
1984-09-01
A new spectroscopic method has been developed to study excited states in rare gas solids: Excitons and conductionband-states are populated by synchrotron radiation (photon energy hw SR =5 - 30 eV). Subsequently electrons from these bound or conduction band-states are excited above the vacuum level of the solid by a pulsed dye laser (hw L =1.9 - 3.7 eV). This experimental technique was applied to solid Xe, Kr, Ar and Ne. (orig./GSCH)
Solid state conformational classification of eight-membered rings
DEFF Research Database (Denmark)
Pérez, J.; García, L.; Kessler, M.
2005-01-01
A statistical classification of the solid state conformation in the title complexes using data retrieved from the Cambridge Structural Database (CSD) has been made. Phosphate and phosphinate complexes show a chair conformation preferably. In phosphonate complexes, the most frequent conformations...
Xu, R. C.; Wang, X. L.; Zhang, S. Z.; Xia, Y.; Xia, X. H.; Wu, J. B.; Tu, J. P.
2018-01-01
Large interfacial resistance between electrode and electrolyte limits the development of high-performance all-solid-state batteries. Herein we report a uniform coating of Li7P3S11 solid electrolyte on MoS2 to form a MoS2/Li7P3S11 composite electrode for all-solid-state lithium ion batteries. The as-synthesized Li7P3S11 processes a high ionic of 2.0 mS cm-1 at room temperature. Due to homogeneous union and reduced interfacial resistance, the assembled all-solid-state batteries with the MoS2/Li7P3S11 composite electrode exhibit higher reversible capacity of 547.1 mAh g-1 at 0.1 C and better cycling stability than the counterpart based on untreated MoS2. Our study provides a new reference for design/fabrication of advanced electrode materials for high-performance all-solid-state batteries.
Ultimate gradient in solid-state accelerators
International Nuclear Information System (INIS)
Whittum, D.H.
1998-08-01
The authors recall the motivation for research in high-gradient acceleration and the problems posed by a compact collider. They summarize the phenomena known to appear in operation of a solid-state structure with large fields, and research relevant to the question of the ultimate gradient. They take note of new concepts, and examine one in detail, a miniature particle accelerator based on an active millimeter-wave circuit and parallel particle beams
Rechargeable sodium all-solid-state battery
International Nuclear Information System (INIS)
Zhou, Weidong; Li, Yutao; Xin, Sen; Goodenough, John B.
2017-01-01
A reversible plating/stripping of a dendrite-free metallic-sodium anode with a reduced anode/ceramic interfacial resistance is created by a thin interfacial interlayer formed in situ or by the introduction of a dry polymer film. Wetting of the sodium on the interfacial interlayer suppresses dendrite formation and growth at different discharge/charge C-rates. Furthermore, all-solid-state batteries were obtained with a high cycling stability and Coulombic efficiency at 65 °C.
Standardized Testing Program for Solid-State Hydrogen Storage Technologies
Energy Technology Data Exchange (ETDEWEB)
Miller, Michael A. [Southwest Research Institute; Page, Richard A. [Southwest Research Institute
2012-07-30
In the US and abroad, major research and development initiatives toward establishing a hydrogen-based transportation infrastructure have been undertaken, encompassing key technological challenges in hydrogen production and delivery, fuel cells, and hydrogen storage. However, the principal obstacle to the implementation of a safe, low-pressure hydrogen fueling system for fuel-cell powered vehicles remains storage under conditions of near-ambient temperature and moderate pressure. The choices for viable hydrogen storage systems at the present time are limited to compressed gas storage tanks, cryogenic liquid hydrogen storage tanks, chemical hydrogen storage, and hydrogen absorbed or adsorbed in a solid-state material (a.k.a. solid-state storage). Solid-state hydrogen storage may offer overriding benefits in terms of storage capacity, kinetics and, most importantly, safety.The fervor among the research community to develop novel storage materials had, in many instances, the unfortunate consequence of making erroneous, if not wild, claims on the reported storage capacities achievable in such materials, to the extent that the potential viability of emerging materials was difficult to assess. This problem led to a widespread need to establish a capability to accurately and independently assess the storage behavior of a wide array of different classes of solid-state storage materials, employing qualified methods, thus allowing development efforts to focus on those materials that showed the most promise. However, standard guidelines, dedicated facilities, or certification programs specifically aimed at testing and assessing the performance, safety, and life cycle of these emergent materials had not been established. To address the stated need, the Testing Laboratory for Solid-State Hydrogen Storage Technologies was commissioned as a national-level focal point for evaluating new materials emerging from the designated Materials Centers of Excellence (MCoE) according to
All Solid State Optical Pulse Shaper for the OMEGA Laser Fusion Facility
International Nuclear Information System (INIS)
Okishev, A.V.; Skeldon, M.D.; Keck, R.L.; Seka, W.
2000-01-01
OAK-B135 All Solid State Optical Pulse Shaper for the OMEGA Laser Fusion Facility. The authors have developed an all-solid-state, compact, computer-controlled, flexible optical pulse shaper for the OMEGA laser facility. This pulse shaper produces high bandwidth, temporally shaped laser pulses that meet OMEGA requirements. The design is a significant simplification over existing technology with improved performance capabilities
Extending solid state laser performance
Miesak, Ed
2017-02-01
Coherent Diode-Pumped Solid-State Orlando (CDO), formerly known as Lee Laser, headquartered in Orlando Florida produces CW and pulsed solid state lasers. Primary wavelengths include 1064 nm, 532 nm, and 355 nm. Other wavelengths produced include 1320 nm, 15xx nm, and 16xx nm. Pulse widths are in the range of singles to hundreds of nanoseconds. Average powers are in the range of a few watts to 1000 watts. Pulse repetition rates are typically in the range of 100 Hz to 100 KHz. Laser performance parameters are often modified according to customer requests. Laser parameters that can be adjusted include average power, pulse repetition rate, pulse length, beam quality, and wavelength. Laser parameters are typically cross-coupled such that adjusting one may change some or all of the others. Customers often request one or more parameters be changed without changing any of the remaining parameters. CDO has learned how to accomplish this successfully with rapid turn-around times and minimal cost impact. The experience gained by accommodating customer requests has produced a textbook of cause and effect combinations of laser components to accomplish almost any parameter change request. Understanding the relationships between component combinations provides valuable insight into lasing effects allowing designers to extend laser performance beyond what is currently available. This has led to several break through products, i.e. >150W average power 355 nm, >60W average power 6 ps 1064 nm, pulse lengths longer than 400 ns at 532 nm with average power >100W, >400W 532 nm with pulse lengths in the 100 ns range.
SSI response of a typical shear wall structure
International Nuclear Information System (INIS)
Johnson, J.J.; Maslenikov, O.R.; Schewe, E.C.
1985-01-01
The seismic response of a typical shear structure in a commercial nuclear power plant was investigated for a series of site and foundation conditions using best estimate and design procedures. The structure selected is a part of the Zion AFT complex which is a connected group of reinforced concrete shear wall buildings, typical of nuclear power plant structures. Comparisons between best estimate responses quantified the effects of placing the structure on different sites and founding it in different manners. Calibration factors were developed by comparing simplified SSI design procedure responses to responses calculated by best estimate procedures. Nineteen basic cases were analyzed - each case was analyzed for ten earthquakes targeted to the NRC R.G. 1.60 design response spectra. The structure is a part of the Zion auxiliary-fuel handling turbine building (AFT) complex to the Zion nuclear power plants. (orig./HP)
Proceedings of the solid state physics symposium. Vol. 34C
International Nuclear Information System (INIS)
1991-12-01
This volume contains the proceedings of the Solid State Physics Symposium held at Varanasi during December 21 to 24, 1991. The topics discussed in the symposium were : (a) Phonon physics, (b) Electron states and electronic properties, (c) Magnetism and magnetic properties, (d) Semiconductor physics, (e) Physics of defects and disordered materials, (f) Transport properties, (g) Superconductivity and superfluidity, (h) Liquid crystals and plastic crystals, (i) Phase transitions and critical phenomena, (j) Surface and interface physics, (k) Non-linear dynamics, instabilities and chaos, (l) Resonance studies and relaxation phenomena, (m) Solid state devices, techniques and instrumentation. Three seminars on topics : (i) High T c superconductors, (ii) Soft matter, and (iii) Physics and technology of interfaces were also held during the symposium. (M.K.V.N.)
Advanced Solid State Lighting for AES Deep Space Hab
National Aeronautics and Space Administration — The advanced Solid State Lighting (SSL) assemblies augmented 2nd generation modules under development for the Advanced Exploration Systems Deep Space Habitat in...
13C solid state NMR investigation of natural resins components
International Nuclear Information System (INIS)
Tavares, Maria I.B.; Bathista, Andre L.B.S.; Silva, Emerson O.; Priante Filho, Nicolau; Nogueira, Jose S.
2001-01-01
The objective of this work is to establish and analytical methodology as a routine using solid state nuclear magnetic resonance (NMR) techniques to investigate the mainly chemical components presented in natural resins in bulk. And also to evaluate the molecular behaviour of these resins. The routine solid state techniques allow us to assign the main compounds presented in the resins. Therefore, applying specialised techniques, like variable contact time, delayed contact time, dephasing time and proton spin lattice relaxation time in the rotating frame (T 1 H ρ), more information about chemical structure and molecular dynamic is available
100 years of solid state dosimetry and radiation protection dosimetry
International Nuclear Information System (INIS)
Bartlett, David T.
2008-01-01
The use of solid state detectors in radiation dosimetry has passed its 100th anniversary. The major applications of these detectors in radiation dosimetry have been in personal dosimetry, retrospective dosimetry, dating, medical dosimetry, the characterization of radiation fields, and also in microdosimetry and radiobiology research. In this introductory paper for the 15th International Conference, I shall speak of the history of solid state dosimetry and of the radiation measurement quantities that developed at the same time, mention some landmark developments in detectors and applications, speak a bit more about dosimetry and measurement quantities, and briefly look at the past and future
Solid-state fermentation : modelling fungal growth and activity
Smits, J.P.
1998-01-01
In solid-state fermentation (SSF) research, it is not possible to separate biomass quantitatively from the substrate. The evolution of biomass dry weight in time can therefore not be measured. Of the aiternatives to dry weight available, glucosamine content is most
International Nuclear Information System (INIS)
Shoji, Mao; Munakata, Hirokazu; Kanamura, Kiyoshi
2016-01-01
All-solid-state lithium-ion batteries using Li + -ion conducting ceramic electrolytes have been focused on as attractive future batteries for electric vehicles and renewable energy conversion systems because high safety can be realized due to non-flammability of ceramic electrolytes. In addition, a higher volumetric energy density than that of current lithium-ion batteries is expected since the all-solid-state lithium-ion batteries can be made in bipolar cell configurations. However, the special ideas and techniques based on ceramic processing are required to construct the electrochemical interface for all-solid-state lithium-ion batteries since the battery development has been done so far based on liquid electrolyte system over 100 years. As one of the promising approaches to develop practical all-solid-state batteries, we have been focusing on three-dimensionally (3D) structured cell configurations such as an interdigitated combination of 3D pillars of cathode and anode, which can be realized by using solid electrolyte membranes with hole-array structures. The application of such kinds of 3D structures effectively increases the interface between solid electrode and solid electrolyte per unit volume, lowering the internal resistance of all-solid-state lithium-ion batteries. In this study, Li 6.25 Al 0.25 La 3 Zr 2 O 12 (LLZAl), which is a Al-doped Li 7 La 3 Zr 2 O 12 (LLZ) with Li + -ion conductivity of ~10 –4 S ⋅cm −1 at room temperature and high stability against lithium-metal, was used as a solid electrolyte, and its pellets with 700 μm depth holes in 700 μm × 700 μm area were fabricated to construct 3D-structured all-solid-state batteries with LiCoO 2 /LLZAl/lithium-metal configuration. It is expected that the LiCoO 2 –LLZAl interface is formed by point-to-point contact even when the LLZAl pellet with 3D hole-array structure is applied. Therefore, Li 3 BO 3 , which is a mechanically soft solid electrolyte with a low melting point at around 700
Supramolecular interactions in the solid state
Directory of Open Access Journals (Sweden)
Giuseppe Resnati
2015-11-01
Full Text Available In the last few decades, supramolecular chemistry has been at the forefront of chemical research, with the aim of understanding chemistry beyond the covalent bond. Since the long-range periodicity in crystals is a product of the directionally specific short-range intermolecular interactions that are responsible for molecular assembly, analysis of crystalline solids provides a primary means to investigate intermolecular interactions and recognition phenomena. This article discusses some areas of contemporary research involving supramolecular interactions in the solid state. The topics covered are: (1 an overview and historical review of halogen bonding; (2 exploring non-ambient conditions to investigate intermolecular interactions in crystals; (3 the role of intermolecular interactions in morphotropy, being the link between isostructurality and polymorphism; (4 strategic realisation of kinetic coordination polymers by exploiting multi-interactive linker molecules. The discussion touches upon many of the prerequisites for controlled preparation and characterization of crystalline materials.
Introduction to solid state physics and crystalline nanostructures
Iadonisi, Giuseppe; Chiofalo, Maria Luisa
2014-01-01
This textbook provides conceptual, procedural, and factual knowledge on solid state and nanostructure physics. It is designed to acquaint readers with key concepts and their connections, to stimulate intuition and curiosity, and to enable the acquisition of competences in general strategies and specific procedures for problem solving and their use in specific applications. To these ends, a multidisciplinary approach is adopted, integrating physics, chemistry, and engineering and reflecting how these disciplines are converging towards common tools and languages in the field. Each chapter discusses essential ideas before the introduction of formalisms and the stepwise addition of complications. Questions on everyday manifestations of the concepts are included, with reasoned linking of ideas from different chapters and sections and further detail in the appendices. The final section of each chapter describes experimental methods and strategies that can be used to probe the phenomena under discussion. Solid state...
Coulomb states in atoms and solids
International Nuclear Information System (INIS)
Ortalano, D.M.
1988-05-01
In this dissertation, an empirical quantum defect approach to describe the valence excitons of the rare gas solids is developed. These Coulomb states are of s-symmetry and form a hydrogen-like series which converges to the bottom of the lowest conduction band. A non-zero quantum defect is found for all of the excitons of neon, argon and xenon. For these systems, then, there exists, in addition to the screened Coulombic component, a non-Coulombic component to the total exciton binding energy. The Wannier formalism is, therefore, inappropriate for the excitons of Ne, Ar and Xe. From the sign of the quantum defect, the non-Coulombic potential is repulsive for Ne and Ar, attractive for Xe, and nearly zero for Kr. This is opposite to that for the Rydberg states of the corresponding rare gas atoms, where the non-Coulombic potential between the electron and the cation is attractive for all of the atoms. The excitons then, are not simply perturbed Rydberg states of the corresponding rare gas atoms (i.e., the excitons do not possess atomic parentage). Interatomic term value/band gap energy correlations and reduced term value/reduced band gap correlations were performed. These correlations were exploited to provide further evidence against both the Wannier formalism and the atomic parentage view point. From these correlations, it was also discovered that the non-Coulombic potential varies smoothly across the valence isoelectronic series of solids, and that it becomes more attractive (or less repulsive) in going from neon to xenon. In order to address the atomic parentage controversy, it was necessary to compare the excitons to the low-n Rydberg states of the rare gas atoms. A review of the quantum defect description of the atomic Rydberg states is, therefore, presented. Also, Rydberg term value/ionization energy correlations are discussed and compared with the analogous exciton correlations. 7 refs., 10 figs., 5 tabs
Fast-neutron solid-state dosimeter
International Nuclear Information System (INIS)
Kecker, K.H.; Haywood, F.F.; Perdue, P.T.; Thorngate, J.H.
1975-01-01
This patent relates to an improved fast-neutron solid-state dosimeter that does not require separation of materials before it can be read out, that utilizes materials that do not melt or otherwise degrade at about 300 0 C readout temperature, that provides a more efficient dosimeter, and that can be reused. The dosimeters are fabricated by intimately mixing a TL material, such as CaSO 4 :Dy, with a powdered polyphenyl, such as p-sexiphenyl, and hot-pressing the mixture to form pellets, followed by out-gassing in a vacuum furnace at 150 0 C prior to first use dosimeters
Structural investigation of e-beam cured epoxy resins through solid state NMR
International Nuclear Information System (INIS)
Alessi, Sabina; Spinella, Alberto; Caponetti, Eugenio; Dispenza, Clelia; Spadaro, Giuseppe
2012-01-01
In this paper the network structure of e-beam cured DGEBF based epoxy resins is investigated. Two epoxy systems, having different reactivity and cured in different process conditions, were analyzed through solid state NMR spectroscopy. The analysis shows that the more reactive system has higher cross-linking density and higher uniformity of network distribution. Similar information were obtained, in a previous work, on the same systems through dynamic mechanical thermal analysis. It is worth noting that unlike DMTA tests, which interfere with the molecular structure of the analyzed material, due to the heating during the analysis itself, more reliable information, without any artefact, are obtained by solid state NMR, carried out at constant room temperature. - Highlights: ► The structure of two e-beam cured epoxy systems is investigated through solid state NMR. ► The aim is to have direct information about the structure without inducing modifications. ► The different molecular structures are able to emphasize the response of solid state NMR. ► T 1 H, T 1ρ H and T CH measurements indicate different cross-linking degrees. ► The NMR results are in agreement with DMTA analysis performed in a previous paper.
Polyol accumulation by Aspergillus oryzae at low water activity in solid-state fermentation
Ruijter, G.J.G.; Visser, J.; Rinzema, A.
2004-01-01
Polyol accumulation and metabolism were examined in Aspergillus oryzae cultured on whole wheat grains or on wheat dough as a model for solid-state culture. In solid-state fermentation (SSF), water activity (a(w)) is typically low resulting in osmotic stress. In addition to a high level of mannitol,
CSIR Research Space (South Africa)
Bell, Teboho
2017-01-01
Full Text Available Filter (LF) was introduced to only transmit 1064 nm and block the 808 nm pump. The laser beam was transmitted out of the cavity through an output coupler mirror (M3 on Figure 1) and was 1:1 relay imaged using two 125 mm lenses (L3 and L4) to a Photon...; Published December 30, 2016 Citation: Bell T, Ngcobo S (2016) Selective Excitation of Higher-radial-order Laguerre-Gaussian Beams Using a Solid-state Digital Laser. J Laser Opt Photonics 3: 144. doi: 10.4172/2469-410X.1000144 Copyright: © 2016 Bell T, et...
Energy Technology Data Exchange (ETDEWEB)
Maged, A F; El-Behay, A Z; Borham, E [National Center for Radiation Research and Technology, Atomic Energy Authority, Cairo (Egypt)
1997-12-31
The use of solid state nuclear track detectors (SSNTDs) is one of the most convenient techniques to assess the average radiation levels of alpha activities in the environment. This technique has been used to assess radon gas and its daughters in buildings. Exposed SSNTD films are chemically etched in an alkali solution and alpha tracks are evaluated by using the image analyzer system. The detailed procedure for this study and the etched films for conversion of alpha track density to radon concentration in Bq m{sup -}3 are given and discussed in the text.1 fig., 3 tabs.
2006 Fundamental Research Underlying Solid-State Lighting: Contractors Meeting
Energy Technology Data Exchange (ETDEWEB)
Fitzsimmons, Tim [Dept. of Energy (DOE), Washington, DC (United States). Office of Basic Energy Sciences. Division of Materials Sciences and Engineering; Kini, Arvind [Dept. of Energy (DOE), Washington, DC (United States). Office of Basic Energy Sciences. Division of Materials Sciences and Engineering; Kelley, Dick [Dept. of Energy (DOE), Washington, DC (United States). Office of Basic Energy Sciences. Division of Materials Sciences and Engineering
2006-02-01
This volume highlights the scientific content of the 2006 Fundamental Research Underlying Solid-State Lighting Contractors Meeting sponsored by the Division of Materials Sciences and Engineering (DMS&E) in the Office of Basic Energy Sciences (BES) of the U. S. Department of Energy (DOE). This meeting is the second in a series of research theme-based Contractors Meetings and will focus on BES/DMS&E-funded research that underpins solid-state lighting technology. The meeting will feature research that cuts across several DMS&E core research program areas. The major programmatic emphasis is on developing a fundamental scientific base, in terms of new concepts and new materials that could be used or mimicked in designing novel materials, processes or devices.
Conductors, semiconductors, superconductors an introduction to solid state physics
Huebener, Rudolf P
2016-01-01
This undergraduate textbook provides an introduction to the fundamentals of solid state physics, including a description of the key people in the field and the historic context. The book concentrates on the electric and magnetic properties of materials. It is written for students up to the bachelor level in the fields of physics, materials science, and electric engineering. Because of its vivid explanations and its didactic approach, it can also serve as a motivating pre-stage and supporting companion in the study of the established and more detailed textbooks of solid state physics. The textbook is suitable for a quick repetition prior to examinations. This second edition is extended considerably by detailed mathematical treatments in many chapters, as well as extensive coverage of magnetic impurities.
Directory of Open Access Journals (Sweden)
Francesco Tres
2015-09-01
Full Text Available We have investigated the dissolution performance of amorphous solid dispersions of poorly water-soluble bicalutamide in a Kollidon VA64 polymeric matrix as a function of the drug loading (5% vs. 30% bicalutamide. A combined suite of state-of-the-art analytical techniques were employed to obtain a clear picture of the drug release, including an integrated magnetic resonance imaging UV-Vis flow cell system and 1H-NMR. Off-line 1H-NMR was used for the first time to simultaneously measure the dissolution profiles and rates of both the drug and the polymer from a solid dispersion. MRI and 1H-NMR data showed that the 5% drug loading compact erodes linearly, and that bicalutamide and Kollidon VA64 are released at approximately the same rate from the molecular dispersion. For the 30% extrudate, data indicated a slower water ingress into the compact which corresponds to a slower dissolution rate of both bicalutamide and Kollidon VA64.
Energy Technology Data Exchange (ETDEWEB)
Hayashi, Akitoshi, E-mail: hayashi@chem.osakafu-u.ac.jp [Department of Applied Chemistry, Graduate School of Engineering, Osaka Prefecture University, Sakai, Osaka (Japan); Sakuda, Atsushi [Department of Applied Chemistry, Graduate School of Engineering, Osaka Prefecture University, Sakai, Osaka (Japan); Department of Energy and Environment, Research Institute of Electrochemical Energy, National Institute of Advanced Industrial Science and Technology (AIST), Ikeda, Osaka (Japan); Tatsumisago, Masahiro [Department of Applied Chemistry, Graduate School of Engineering, Osaka Prefecture University, Sakai, Osaka (Japan)
2016-07-15
All-solid-state batteries with inorganic solid electrolytes (SEs) are recognized as an ultimate goal of rechargeable batteries because of their high safety, versatile geometry, and good cycle life. Compared with thin-film batteries, increasing the reversible capacity of bulk-type all-solid-state batteries using electrode active material particles is difficult because contact areas at solid–solid interfaces between the electrode and electrolyte particles are limited. Sulfide SEs have several advantages of high conductivity, wide electrochemical window, and appropriate mechanical properties, such as formability, processability, and elastic modulus. Sulfide electrolyte with Li{sub 7}P{sub 3}S{sub 11} crystal has a high Li{sup +} ion conductivity of 1.7 × 10{sup −2} S cm{sup −1} at 25°C. It is far beyond the Li{sup +} ion conductivity of conventional organic liquid electrolytes. The Na{sup +} ion conductivity of 7.4 × 10{sup −4} S cm{sup −1} is achieved for Na{sub 3.06}P{sub 0.94}Si{sub 0.06}S{sub 4} with cubic structure. Moreover, formation of favorable solid–solid interfaces between electrode and electrolyte is important for realizing solid-state batteries. Sulfide electrolytes have better formability than oxide electrolytes. Consequently, a dense electrolyte separator and closely attached interfaces with active material particles are achieved via “room-temperature sintering” of sulfides merely by cold pressing without heat treatment. Elastic moduli for sulfide electrolytes are smaller than that of oxide electrolytes, and Na{sub 2}S–P{sub 2}S{sub 5} glass electrolytes have smaller Young’s modulus than Li{sub 2}S–P{sub 2}S{sub 5} electrolytes. Cross-sectional SEM observations for a positive electrode layer reveal that sulfide electrolyte coating on active material particles increases interface areas even with a minimum volume of electrolyte, indicating that the energy density of bulk-type solid-state batteries is enhanced. Both surface coating
Topotactic Solid-State Metal Hydride Reductions of Sr2MnO4.
Hernden, Bradley C; Lussier, Joey A; Bieringer, Mario
2015-05-04
We report novel details regarding the reactivity and mechanism of the solid-state topotactic reduction of Sr2MnO4 using a series of solid-state metal hydrides. Comprehensive details describing the active reducing species are reported and comments on the reductive mechanism are provided, where it is shown that more than one electron is being donated by H(-). Commonly used solid-state hydrides LiH, NaH, and CaH2, were characterized in terms of reducing power. In addition the unexplored solid-state hydrides MgH2, SrH2, and BaH2 are evaluated as potential solid-state reductants and characterized in terms of their reductive reactivities. These 6 group I and II metal hydrides show the following trend in terms of reactivity: MgH2 < SrH2 < LiH ≈ CaH2 ≈ BaH2 < NaH. The order of the reductants are discussed in terms of metal electronegativity and bond strengths. NaH and the novel use of SrH2 allowed for targeted synthesis of reduced Sr2MnO(4-x) (0 ≤ x ≤ 0.37) phases. The enhanced control during synthesis demonstrated by this soft chemistry approach has allowed for a more comprehensive and systematic evaluation of Sr2MnO(4-x) phases than previously reported phases prepared by high temperature methods. Sr2MnO3.63(1) has for the first time been shown to be monoclinic by powder X-ray diffraction and the oxidative monoclinic to tetragonal transition occurs at 450 °C.
20 CFR 416.1826 - Showing that you are not married when you apply for SSI.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Showing that you are not married when you apply for SSI. 416.1826 Section 416.1826 Employees' Benefits SOCIAL SECURITY ADMINISTRATION SUPPLEMENTAL... used on mail for each of you? (iv) Who owns or rents the place where you live? (v) Do any deeds, leases...
Investigation of the Reliability of the SSI-3 for Preschool Persian-Speaking Children Who Stutter
Bakhtiar, Mehdi; Seifpanahi, Sadegh; Ansari, Hossein; Ghanadzade, Mehdi; Packman, Ann
2010-01-01
There is a pressing need in Iran for the translation of widely used speech-language assessment tools into Persian. This study reports the interjudge and intrajudge reliability of a Persian translation of the Stuttering Severity Instrument-3 (SSI-3) (Riley, 1994). There was greater than 80% interjudge and intrajudge agreement on scale scores for…
Solid models for CT/MR image display
International Nuclear Information System (INIS)
ManKovich, N.J.; Yue, A.; Kioumehr, F.; Ammirati, M.; Turner, S.
1991-01-01
Medical imaging can now take wider advantage of Computer-Aided-Manufacturing through rapid prototyping technologies (RPT) such as stereolithography, laser sintering, and laminated object manufacturing to directly produce solid models of patient anatomy from processed CT and MR images. While conventional surgical planning relies on consultation with the radiologist combined with direct reading and measurement of CT and MR studies, 3-D surface and volumetric display workstations are providing a more easily interpretable view of patient anatomy. RPT can provide the surgeon with a life size model of patient anatomy constructed layer by layer with full internal detail. The authors have developed a prototype image processing and model fabrication system based on stereolithography, which provides the neurosurgeon with models of the skull base. Parallel comparison of the mode with the original thresholded CT data and with a CRT displayed surface rendering showed that both have an accuracy of >99.6 percent. The measurements on the surface rendered display proved more difficult to exactly locate and yielded a standard deviation of 2.37 percent. This paper presents an accuracy study and discusses ways of assessing the quality of neurosurgical plans when 3-D models re made available as planning tools
International Nuclear Information System (INIS)
Westerlind, M.; Hedberg, B.
2000-01-01
This paper summarises some experiences gained by the SKI and SSI during the ongoing process for siting a final repository for spent nuclear fuel. The focus is on activities in the municipalities involved in the siting process. In order to give the proper context some basic elements in the legislation, which are important for public participation and confidence in the siting process, are outlined. The importance of clearly defined responsibilities and early participation of the regulators in the siting process are emphasised. It should be pointed out that this paper is not a comprehensive review of the Swedish situation but only contains a few selected issues and personal remarks from the authors. Thus, the views and opinions do not necessarily coincide with those of SKI and SSI. (authors)
Measurement Model of Reasoning Skills among Science Students Based on Socio Scientific Issues (SSI
Directory of Open Access Journals (Sweden)
MOHD AFIFI BAHURUDIN SETAMBAH
2018-05-01
Full Text Available The lack of reasoning skills has been recognized as one of the contributing factors to the declined achievement in the Trends in Mathematics and Science Studies (TIMSS and Programme for International Student Assessment (PISA assessments in Malaysia. The use of socio-scientific issues (SSI as a learning strategy offers the potential of improving the level of students' reasoning skills and consequently improves students’ achievement in science subjects. This study examined the development of a measurement model of reasoning skills among science students based on SSI using the analysis of moment structure (AMOS approach before going to second level to full structured equation modelling (SEM. A total of 450 respondents were selected using a stratified random sampling. Results showed a modified measurement model of reasoning skills consisting of the View Knowledge (VK was as a main construct. The items that measure the level of pre-reflection of students fulfilled the elements of unidimensionality, validity, and reliability. Although the level of student reasoning skills was still low but this development of measurement model could be identified and proposed teaching methods that could be adopted to improve students’ reasoning skills.
International Nuclear Information System (INIS)
Morgan, C.R.
1977-01-01
Novel styrene-allyl alcohol copolymer based solid polyene compositions which when mixed with liquid polythiols can form solid curable polyene-polythiol systems are claimed. These solid polyenes, containing at least two reactive carbon-to-carbon unsaturated bonds, are urethane or ester derivatives of styrene-allyl alcohol copolymers. The solid polyenes are prepared by treating the hydroxyl groups of a styrene-allyl alcohol copolymer with a reactive unsaturated isocyanate, e.g., allyl isocyanate or a reactive unsaturated carboxylic acid, e.g., acrylic acid. Upon exposure to a free radical generator, e.g., actinic radiation, the solid polyene-polythiol compositions cure to solid, insoluble, chemically resistant, cross-linked polythioether products. Since the solid polyene-liquid polythiol composition can be cured in a solid state, such a curable system finds particular use in preparation of coatings, imaged surfaces such as photoresists, particularly solder-resistant photoresists, printing plates, etc
Solid State NMR Characterization of Complex Metal Hydrides systems for Hydrogen Storage Applications
Directory of Open Access Journals (Sweden)
Son-Jong Hwang
2011-12-01
Full Text Available Solid state NMR is widely applied in studies of solid state chemistries for hydrogen storage reactions. Use of 11B MAS NMR in studies of metal borohydrides (BH4 is mainly focused, revisiting the issue of dodecaborane formation and observation of 11B{1H} Nuclear Overhauser Effect.
Pressure Effects on Solid State Phase Transformation of Aluminium Bronze in Cooling Process
International Nuclear Information System (INIS)
Hai-Yan, Wang; Jian-Hua, Liu; Gui-Rong, Peng; Yan, Chen; Yu-Wen, Liu; Fei, Li; Wen-Kui, Wang
2009-01-01
Effects of high pressure (6 GPa) on the solid state phase transformation kinetic parameters of aluminum bronze during the cooling process are investigated, based on the measurement and calculation of its solid state phase transformation temperature, duration and activation energy and the observation of its microstructures. The results show that high pressure treatment can reduce the solid phase transformation temperature and activation energy in the cooling process and can shorten the phase transformation duration, which is favorable when forming fine-grained aluminum bronze
An overview of Engineering Aspects of Solid State Fermentation
Directory of Open Access Journals (Sweden)
Prabhakar, A.
2005-01-01
Full Text Available Solid substrate cultivation (SSC or solid state fermentation (SSF is envisioned as a prominent bio conversion technique to transform natural raw materials into a wide variety of chemical as well as bio-chemical products. This process involves the fermentation of solid substrate medium with microorganism in the absence of free flowing water. Recent developments and concerted focus on SSF enabled it to evolve as a potential bio- technology as an alternative to thetraditional chemical synthesis. SSF is being successfully exploited for food production, fuels, enzymes, antibiotics, animal feeds and also for dye degradation. This paper discusses the various micro and macro level engineering problems associated with SSF and some possible solutions for its full commercial realization.
Kang, Seung-Gul; Na, Kyoung-Sae; Choi, Jae-Won; Kim, Jeong-Hee; Son, Young-Don; Lee, Yu Jin
2017-07-03
In this study, we investigated the difference in resting-state functional connectivity (RSFC) of the amygdala between suicide attempters and non-suicide attempters with major depressive disorder (MDD) using functional magnetic resonance imaging (fMRI). This study included 19 suicide attempters with MDD and 19 non-suicide attempters with MDD. RSFC was compared between the two groups and the regression analyses were conducted to identify the correlation between RSFC and Scale for Suicide Ideation (SSI) scores in the suicide attempt group. Statistical significance was set at p-value (uncorrected) suicide attempters, suicide attempters showed significantly increased RSFC of the left amygdala with the right insula and left superior orbitofrontal area, and increased RSFC of the right amygdala with the left middle temporal area. The regression analysis showed a significant correlation between the SSI total score and RSFC of the right amygdala with the right parahippocampal area in the suicide attempt group. The present RSFC findings provide evidence of a functional neural basis and will help reveal the pathophysiology underlying suicidality in subjects with MDD. Copyright © 2017. Published by Elsevier Inc.
2010-01-11
... extend the home exclusion to beneficiaries who, because of domestic abuse, leave a home that had... Domestic Abuse An SSI applicant's or beneficiary's home and associated land are excluded from resources by... abuse leaves the home and resides elsewhere. Currently, a victim fleeing from domestic abuse may return...
Compact, diode-pumped, solid-state lasers for next generation defence and security sensors
Silver, M.; Lee, S. T.; Borthwick, A.; McRae, I.; Jackson, D.; Alexander, W.
2015-06-01
Low-cost semiconductor laser diode pump sources have made a dramatic impact in sectors such as advanced manufacturing. They are now disrupting other sectors, such as defence and security (D&S), where Thales UK is a manufacturer of sensor systems for application on land, sea, air and man portable. In this talk, we will first give an overview of the market trends and challenges in the D&S sector. Then we will illustrate how low cost pump diodes are enabling new directions in D&S sensors, by describing two diode pumped, solid- state laser products currently under development at Thales UK. The first is a new generation of Laser Target Designators (LTD) that are used to identify targets for the secure guiding of munitions. Current systems are bulky, expensive and require large battery packs to operate. The advent of low cost diode technology, merged with our novel solid-state laser design, has created a designator that will be the smallest, lowest cost, STANAG compatible laser designator on the market. The LTD delivers greater that 50mJ per pulse up to 20Hz, and has compact dimensions of 125×70×55mm. Secondly, we describe an ultra-compact, eye-safe, solid-state laser rangefinder (LRF) with reduced size, weight and power consumption compared to existing products. The LRF measures 100×55×34mm, weighs 200g, and can range to greater than 10km with a single laser shot and at a reprate of 1Hz. This also leverages off advances in laser pump diodes, but also utilises low cost, high reliability, packaging technology commonly found in the telecoms sector. As is common in the D&S sector, the products are designed to work in extreme environments, such as wide temperature range (-40 to +71°C) and high levels of shock and vibration. These disruptive products enable next- generation laser sensors such as rangefinders, target designators and active illuminated imagers.
Plasma-assisted ALD of LiPO(N) for solid state batteries
Put, B.; Mees, M.J.; Hornsveld, N.; Sepúlveda, A.; Vereecken, P.M.; Kessels, W.M.M.; Creatore, M.
2016-01-01
All solid state 3D batteries are pursued for their increased safety and high power capabilities. At present conformai coating of the solid electrolyte remains one of the key hurdles for the implementation of such devices. In the present work we investigate atomic layer deposition (ALD) as means of
Solid State Division progress report for period ending March 31, 1992
International Nuclear Information System (INIS)
Green, P.H.; Hinton, L.W.
1992-09-01
During this period, the division conducted a broad, interdisciplinary materials research program with emphasis on theoretical solid state physics, superconductivity, neutron scattering, synthesis and characterization of materials, ion beam and laser processing, and the structure of solids and surfaces. The High Flux Isotope Reactor was returned to full operation
Solid State Division progress report for period ending March 31, 1992
Energy Technology Data Exchange (ETDEWEB)
Green, P.H.; Hinton, L.W. (eds.)
1992-09-01
During this period, the division conducted a broad, interdisciplinary materials research program with emphasis on theoretical solid state physics, superconductivity, neutron scattering, synthesis and characterization of materials, ion beam and laser processing, and the structure of solids and surfaces. The High Flux Isotope Reactor was returned to full operation.
Solid-state NMR on complex biomolecules: novel methods and applications
Nand, D.
2011-01-01
Solid-state NMR (ssNMR) represents a versatile technique in providing atomic-resolution information without the need for crystals or fast molecular motion required for X-ray crystallography and solution-state NMR, respectively. Recent past has witnessed the ability of this technique in providing
Advanced Solid-state Lasers - to Ignition and Beyond
International Nuclear Information System (INIS)
Marshall, C.; Bibeau, C.; Orth, C; Meier, W.R.; Payne, S.; Sutton, S.
1998-01-01
This brochure concentrates on the diode-pumped solid-state laser. Surrounding it on the cover are some of the primary technological developments that make it a candidate for the means by which inertial confinement fusion will create inertial fusion energy as an inexhaustible source of electric power
Chinese vinegar and its solid-state fermentation process
Liu Dengru,; Yang Zhu, Yang; Beeftink, H.H.; Ooijkaas, L.P.; Rinzema, A.; Jian Chen,; Tramper, J.
2004-01-01
China uses solid-state fermentation (SSF) processes on a large scale for products such as vinegar, Chinese distilled spirit, soy sauce, Furu, and other national foods that are consumed around the world. In this article, the typical SSF process is discussed, with a focus on Chinese vinegars,
The effect of interfaces on solid-state reactions between oxides
International Nuclear Information System (INIS)
Johnson, M.T.; Carter, C.B.
1998-01-01
A thin-film geometry has been used to study fundamental solid-state reaction processes occurring at interfaces in two spinel-forming oxide systems. In the first system, NiO/Al 2 O 3 , epitactic NiO films were deposited on various orientations of single-crystal α-Al 2 O 3 . In this case, the reaction kinetics were studied and correlated with the interfacial structure (or substrate orientation). In the second, In 2 O 3 /MgO, solid-state reactions were studied under the influence of an electric field. The electric field provides a driving force for mass transport that affects both the reaction process and the morphological stability of an interface
Solid state physics and physicists of the post war Latvia
International Nuclear Information System (INIS)
Zakis, J.
2003-01-01
In Latvia during the so-called post war period (1944-1991) fields that promoted the research activities were nuclear research and semiconductor electronics. Being considered as classified the researches in these fields were separated from the universities and transferred to the institutes of recently founded Latvian Academy of Sciences. The institutes related to the so-called sector management ministries performed the most of research in semiconductor physics. Research activities at the University of Latvia were mainly in the basic solid state physics (ionic crystals, Ferro ceramics). Despite of being controlled research activities in solid-state physics in Latvia were on relatively high level recognized both nationally and internationally
Emerging solid-state laser technology by lidar/DIAL remote sensing
Killinger, Dennis
1992-01-01
Significant progress has been made in recent years in the development of new, solid-state laser sources. This talk will present an overview of some of the new developments in solid-state lasers, and their application toward lidar/DIAL measurements of the atmosphere. Newly emerging lasers such as Ho:YAG, Tm:YAG, OPO, and Ti:Sapphire will be covered, along with the spectroscopic parameters required for differential operational modes of atmospheric remote sensing including Doppler-Windshear lidar, Tunable laser detection of water/CO2, and broad linewidth OPO's for open path detection of pollutant hydrocarbon gases. Additional considerations of emerging laser technology for lidar/DIAL will also be covered.
Solid-state tap-changer of transformers: Design, control and implementation
Energy Technology Data Exchange (ETDEWEB)
Faiz, Jawad; Siahkolah, Behzad [Center of Excellence on Applied Electromagnetic Systems, School of Electrical and Computer Engineering, University of Tehran, Tehran 1439957131 (Iran, Islamic Republic of)
2011-02-15
This paper presents the implementation of a prototype electronic tap-changer of transformer. Mechanical tap-changer has many problems such as low operating speed, short lifetime and heavy size. In order to solve these problems a fully solid-state tap-changer with a new control strategy and optimal configuration is proposed. The design of tap-changer is discussed and bi-directional solid-state power electronics switches are implemented. Following the realization of the tap-changer controller, developed software for such precise control is introduced. To verify the design procedure and optimal configuration and apply the developed software, a prototype low-power tap-changer has been built and tested. (author)
Templated Solid-State Dewetting of Thin Silicon Films.
Naffouti, Meher; David, Thomas; Benkouider, Abdelmalek; Favre, Luc; Delobbe, Anne; Ronda, Antoine; Berbezier, Isabelle; Abbarchi, Marco
2016-11-01
Thin film dewetting can be efficiently exploited for the implementation of functionalized surfaces over very large scales. Although the formation of sub-micrometer sized crystals via solid-state dewetting represents a viable method for the fabrication of quantum dots and optical meta-surfaces, there are several limitations related to the intrinsic features of dewetting in a crystalline medium. Disordered spatial organization, size, and shape fluctuations are relevant issues not properly addressed so far. This study reports on the deterministic nucleation and precise positioning of Si- and SiGe-based nanocrystals by templated solid-state dewetting of thin silicon films. The dewetting dynamics is guided by pattern size and shape taking full control over number, size, shape, and relative position of the particles (islands dimensions and relative distances are in the hundreds nm range and fluctuate ≈11% for the volumes and ≈5% for the positioning). © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Zhang, Xian-Fu; Zhang, Ya-Kui
2015-01-01
The optical absorption and fluorescence properties of five rhodamine dyes in solid-state are measured and show large difference from that in their gas phase or liquid solvents. All solid-state rhodamine dyes strongly absorb all light in UV and visible region, but emit only red and NIR fluorescence (680–800 nm, >100 nm red-shifted from that in solution). Further more, the absorption maxima of a solid-state rhodamine show a large red-shifted band (~100 nm) and blue-shifted peak (~125 nm) compared to that in solutions, indicating a strong molecular exciton coupling between molecules. All solid-state rhodamines still show reasonably good fluorescence quantum yield (Φ f ). In particular, solid-state Rhodamine B butyl ester and sulfonyl Rhodamine B showed a much longer emission lifetime (τ f ) than that of the corresponding molecular rhodamine, i.e. 4.12 and 4.14 ns in solid state compared to 1.61 and 2.47 ns in solution. The chemical structure of a rhodamine molecule showed dramatic effect on Φ f and τ f values for solid state rhodamine. The larger substituent in the benzene moiety favors higher Φ f and τ f values of rhodamine solids. These effects can be elucidated by the relation between structure-molecular distance and molecular exciton couplings. - Highlights: • Optical properties of solid rhodamines show large difference from that in solutions. • Solid-state rhodamine dyes emit red and NIR fluorescence (680–800 nm). • Solid-state rhodamines still show reasonably good fluorescence quantum yield. • Solid-state rhodamines have much longer fluorescence lifetimes than that in solutions
Energy Technology Data Exchange (ETDEWEB)
Zhang, Xian-Fu, E-mail: zhangxianfu@tsinghua.org.cn [Institute of Applied Photochemistry & Center of Analysis and Measurements, Hebei Normal University of Science and Technology, Qinhuangdao 066004, Hebei Province (China); MPC Technologies, Hamilton, ON, Canada L8S 3H4 (Canada); Zhang, Ya-Kui [Institute of Applied Photochemistry & Center of Analysis and Measurements, Hebei Normal University of Science and Technology, Qinhuangdao 066004, Hebei Province (China)
2015-10-15
The optical absorption and fluorescence properties of five rhodamine dyes in solid-state are measured and show large difference from that in their gas phase or liquid solvents. All solid-state rhodamine dyes strongly absorb all light in UV and visible region, but emit only red and NIR fluorescence (680–800 nm, >100 nm red-shifted from that in solution). Further more, the absorption maxima of a solid-state rhodamine show a large red-shifted band (~100 nm) and blue-shifted peak (~125 nm) compared to that in solutions, indicating a strong molecular exciton coupling between molecules. All solid-state rhodamines still show reasonably good fluorescence quantum yield (Φ{sub f}). In particular, solid-state Rhodamine B butyl ester and sulfonyl Rhodamine B showed a much longer emission lifetime (τ{sub f}) than that of the corresponding molecular rhodamine, i.e. 4.12 and 4.14 ns in solid state compared to 1.61 and 2.47 ns in solution. The chemical structure of a rhodamine molecule showed dramatic effect on Φ{sub f} and τ{sub f} values for solid state rhodamine. The larger substituent in the benzene moiety favors higher Φ{sub f} and τ{sub f} values of rhodamine solids. These effects can be elucidated by the relation between structure-molecular distance and molecular exciton couplings. - Highlights: • Optical properties of solid rhodamines show large difference from that in solutions. • Solid-state rhodamine dyes emit red and NIR fluorescence (680–800 nm). • Solid-state rhodamines still show reasonably good fluorescence quantum yield. • Solid-state rhodamines have much longer fluorescence lifetimes than that in solutions.