WorldWideScience

Sample records for solfataricus alpha-glucosidase implications

  1. Production of {alpha}-glucosidases by Bacillus sp. strains

    Energy Technology Data Exchange (ETDEWEB)

    Castro, G.R. [Univ. Nacional de Tucuman, Facultad de Bioquimica, Quimica y Farmacia, Catedra de Microbiologia Superior, PROIMI-MIRCEN, Tucuman (Argentina); Baigori, M.D. [Univ. Nacional de Tucuman, Facultad de Bioquimica, Quimica y Farmacia, Catedra de Microbiologia Superior, PROIMI-MIRCEN, Tucuman (Argentina); Sineriz, F. [Univ. Nacional de Tucuman, Facultad de Bioquimica, Quimica y Farmacia, Catedra de Microbiologia Superior, PROIMI-MIRCEN, Tucuman (Argentina)

    1995-12-31

    {alpha}-Glucosidase was detected in four wild-type amylolytic production strains belonging to the Bacillus genus. The strains showed {alpha}-glucosidase activity in extracellular and membrane-bound fractions. Kinetic studies of the {alpha}-glucosidase synthesis in the batch cultures of four strains of the Bacillus genus showed two profiles: partially and totally growth-linked synthesis. The presence of different activities and production profiles of {alpha}-glucosidase in the strains at high or low glucose concentrations in the medium would indicate that {alpha}-glucosidase may have a role in the regulation of the metabolism of {alpha}-polysaccharides. (orig.)

  2. Screening alpha-glucosidase and alpha-amylase inhibitors from natural compounds by molecular docking in silico.

    Science.gov (United States)

    Jhong, Chien-Hung; Riyaphan, Jirawat; Lin, Shih-Hung; Chia, Yi-Chen; Weng, Ching-Feng

    2015-01-01

    The alpha-glucosidase inhibitor is a common oral anti-diabetic drug used for controlling carbohydrates normally converted into simple sugars and absorbed by the intestines. However, some adverse clinical effects have been observed. The present study seeks an alternative drug that can regulate the hyperglycemia by down-regulating alpha-glucosidase and alpha-amylase activity by molecular docking approach to screen the hyperglycemia antagonist against alpha-glucosidase and alpha-amylase activities from the 47 natural compounds. The docking data showed that Curcumin, 16-hydroxy-cleroda-3,13-dine-16,15-olide (16-H), Docosanol, Tetracosanol, Antroquinonol, Berberine, Catechin, Quercetin, Actinodaphnine, and Rutin from 47 natural compounds had binding ability towards alpha-amylase and alpha-glucosidase as well. Curcumin had a better biding ability of alpha-amylase than the other natural compounds. Analyzed alpha-glucosidase activity reveals natural compound inhibitors (below 0.5 mM) are Curcumin, Actinodaphnine, 16-H, Quercetin, Berberine, and Catechin when compared to the commercial drug Acarbose (3 mM). A natural compound with alpha-amylase inhibitors (below 0.5 mM) includes Curcumin, Berberine, Docosanol, 16-H, Actinodaphnine/Tetracosanol, Catechin, and Quercetin when compared to Acarbose (1 mM). When taken together, the implication is that molecular docking is a fast and effective way to screen alpha-glucosidase and alpha-amylase inhibitors as lead compounds of natural sources isolated from medicinal plants. © 2015 International Union of Biochemistry and Molecular Biology.

  3. The Role of alpha-Glucosidase in Germinating Barley Grains

    DEFF Research Database (Denmark)

    Stanley, Duncan; Rejzek, Martin; Næsted, Henrik

    2011-01-01

    The importance of alpha-glucosidase in the endosperm starch metabolism of barley (Hordeum vulgare) seedlings is poorly understood. The enzyme converts maltose to glucose (Glc), but in vitro studies indicate that it can also attack starch granules. To discover its role in vivo, we took complementary...... chemical-genetic and reverse-genetic approaches. We identified iminosugar inhibitors of a recombinant form of an alpha-glucosidase previously discovered in barley endosperm (ALPHA-GLUCOSIDASE97 [HvAGL97]), and applied four of them to germinating grains. All four decreased the Glc-to-maltose ratio...... in the endosperm 10 d after imbibition, implying inhibition of maltase activity. Three of the four inhibitors also reduced starch degradation and seedling growth, but the fourth did not affect these parameters. Inhibition of starch degradation was apparently not due to inhibition of amylases. Inhibition...

  4. Alpha-Glucosidase Inhibitory and Antioxidant Activity of Solvent ...

    African Journals Online (AJOL)

    Alpha-Glucosidase Inhibitory and Antioxidant Activity of Solvent Extracts and Fractions of Typha domingensis (Typhaceae) Fruit. Tsun-Thai Chai, Mei-Jee Chiam, Chi-Hou Lau, Nor Ismaliza Mohd Ismail, Hean-Chooi Ong, Fazilah Abd Manan, Fai-Chu Wong ...

  5. Alpha-glucosidase promotes hemozoin formation in a blood-sucking bug: an evolutionary history.

    Directory of Open Access Journals (Sweden)

    Flávia Borges Mury

    Full Text Available BACKGROUND: Hematophagous insects digest large amounts of host hemoglobin and release heme inside their guts. In Rhodnius prolixus, hemoglobin-derived heme is detoxified by biomineralization, forming hemozoin (Hz. Recently, the involvement of the R. prolixus perimicrovillar membranes in Hz formation was demonstrated. METHODOLOGY/PRINCIPAL FINDINGS: Hz formation activity of an alpha-glucosidase was investigated. Hz formation was inhibited by specific alpha-glucosidase inhibitors. Moreover, Hz formation was sensitive to inhibition by Diethypyrocarbonate, suggesting a critical role of histidine residues in enzyme activity. Additionally, a polyclonal antibody raised against a phytophagous insect alpha-glucosidase was able to inhibit Hz formation. The alpha-glucosidase inhibitors have had no effects when used 10 h after the start of reaction, suggesting that alpha-glucosidase should act in the nucleation step of Hz formation. Hz formation was seen to be dependent on the substrate-binding site of enzyme, in a way that maltose, an enzyme substrate, blocks such activity. dsRNA, constructed using the sequence of alpha-glucosidase gene, was injected into R. prolixus females' hemocoel. Gene silencing was accomplished by reduction of both alpha-glucosidase and Hz formation activities. Insects were fed on plasma or hemin-enriched plasma and gene expression and activity of alpha-glucosidase were higher in the plasma plus hemin-fed insects. The deduced amino acid sequence of alpha-glucosidase shows a high similarity to the insect alpha-glucosidases, with critical histidine and aspartic residues conserved among the enzymes. CONCLUSIONS/SIGNIFICANCE: Herein the Hz formation is shown to be associated to an alpha-glucosidase, the biochemical marker from Hemipteran perimicrovillar membranes. Usually, these enzymes catalyze the hydrolysis of glycosidic bond. The results strongly suggest that alpha-glucosidase is responsible for Hz nucleation in the R. prolixus

  6. Cloning a cDNA for the lysosomal alpha-glucosidase

    NARCIS (Netherlands)

    KONINGS, A.; HUPKES, P.; Versteeg, R.; Grosveld, G.; Reuser, A.; Galjaard, H.

    1984-01-01

    Messenger RNA was isolated from monkey testes and size-fractionated on sucrose gradients. In vitro translation of these mRNA fractions resulted in nascent, labeled alpha-glucosidase that could be precipitated with anti human alpha-glucosidase antiserum. A cDNA library was constructed from the most

  7. Alpha-glucosidase inhibitory and antiplasmodial properties of terpenoids from the leaves of Buddleja saligna Willd

    Czech Academy of Sciences Publication Activity Database

    Chukwujekwu, J. C.; Rengasamy, K.R.R.; de Kock, C. A.; Smith, P. J.; Poštová Slavětínská, Lenka; van Staden, J.

    2016-01-01

    Roč. 31, č. 1 (2016), s. 63-66 ISSN 1475-6366 Institutional support: RVO:61388963 Keywords : alpha-glucosidase * antidiabetic * antiplasmodial * Buddleja saligna * terpenoids Subject RIV: CC - Organic Chemistry Impact factor: 4.293, year: 2016

  8. Enzyme therapy for pompe disease with recombinant human alpha-glucosidase from rabbit milk.

    NARCIS (Netherlands)

    Hout, J.M. van den; Reuser, A.J.J.; Klerk, J.B.C. de; Arts, W.F.M.; Smeitink, J.A.M.; Ploeg, A.T. van der

    2001-01-01

    Pompe disease is a metabolic myopathy caused by deficiency of lysosomal acid alpha-glucosidase. In this report we review the first 36 weeks of a clinical study on the safety and efficacy of enzyme therapy aimed at correcting the deficiency. Four patients with infantile Pompe disease were enrolled.

  9. Novel {alpha}-glucosidase from human gut microbiome : substrate specificities and their switch.

    Energy Technology Data Exchange (ETDEWEB)

    Tan, K.; Tesar, C.; Wilton, R.; Keigher, L.; Babnigg, G.; Joachimiak, A.; Biosciences Division

    2010-01-01

    The human intestine harbors a large number of microbes forming a complex microbial community that greatly affects the physiology and pathology of the host. In the human gut microbiome, the enrichment in certain protein gene families appears to be widespread. They include enzymes involved in carbohydrate metabolism such as glucoside hydrolases of dietary polysaccharides and glycoconjugates. We report the crystal structures (wild type, 2 mutants, and a mutant/substrate complex) and the enzymatic activity of a recombinant {alpha}-glucosidase from human gut bacterium Ruminococcus obeum. The first ever protein structures from this bacterium reveal a structural homologue to human intestinal maltase-glucoamylase with a highly conserved catalytic domain and reduced auxiliary domains. The {alpha}-glucosidase, a member of GH31 family, shows substrate preference for {alpha}(1-6) over {alpha}(1-4) glycosidic linkages and produces glucose from isomaltose as well as maltose. The preference can be switched by a single mutation at its active site, suggestive of widespread adaptation to utilization of a variety of polysaccharides by intestinal micro-organisms as energy resources. Novel {alpha}-glucosidase from human gut microbiome: substrate specificities and their switch.

  10. Antidiabetic property of Symplocos cochinchinensis is mediated by inhibition of alpha glucosidase and enhanced insulin sensitivity.

    Directory of Open Access Journals (Sweden)

    Kalathookunnel Antony Antu

    Full Text Available The study is designed to find out the biochemical basis of antidiabetic property of Symplocos cochinchinensis (SC, the main ingredient of 'Nisakathakadi' an Ayurvedic decoction for diabetes. Since diabetes is a multifactorial disease, ethanolic extract of the bark (SCE and its fractions (hexane, dichloromethane, ethyl acetate and 90% ethanol were evaluated by in vitro methods against multiple targets relevant to diabetes such as the alpha glucosidase inhibition, glucose uptake, adipogenic potential, oxidative stress, pancreatic beta cell proliferation, inhibition of protein glycation, protein tyrosine phosphatase-1B (PTP-1B and dipeptidyl peptidase-IV (DPP-IV. Among the extracts, SCE exhibited comparatively better activity like alpha glucosidase inhibition (IC50 value-82.07 ± 2.10 µg/mL, insulin dependent glucose uptake (3 fold increase in L6 myotubes, pancreatic beta cell regeneration in RIN-m5F (3.5 fold increase and reduced triglyceride accumulation (22% decrease in 3T3L1 cells, protection from hyperglycemia induced generation of reactive oxygen species in HepG2 cells (59.57% decrease with moderate antiglycation and PTP-1B inhibition. Chemical characterization by HPLC revealed the superiority of SCE over other extracts due to presence and quantity of bioactives (beta-sitosterol, phloretin 2'glucoside, oleanolic acid in addition to minerals like magnesium, calcium, potassium, sodium, zinc and manganese. So SCE has been subjected to oral sucrose tolerance test to evaluate its antihyperglycemic property in mild diabetic and diabetic animal models. SCE showed significant antihyperglycemic activity in in vivo diabetic models. We conclude that SC mediates the antidiabetic activity mainly via alpha glucosidase inhibition, improved insulin sensitivity, with moderate antiglycation and antioxidant activity.

  11. An alpha-glucosidase inhibitor from an endophytic Cladosporium sp. with potential as a biocontrol agent.

    Science.gov (United States)

    Singh, Bahaderjeet; Kaur, Tamanreet; Kaur, Sanehdeep; Manhas, Rajesh K; Kaur, Amarjeet

    2015-02-01

    This study highlights the importance of alpha-glucosidase inhibitors as mechanisms for endophyte-mediated resistance to insect pests. One of the major benefits which endophytes confer on plants is providing resistance against insect pests. This built-in defense mechanism of the plant can be used for exploring ecofriendly strategies for pest control. In the present study, 34 endophytic fungi were isolated from Tinospora cordifolia and screened for their ability to produce alpha-glucosidase inhibitors. Maximum inhibitory activity was observed in an isolate from T. cordifolia (TN-9S), identified to be Cladosporium sp. The inhibitor was purified using chromatographic techniques. The insecticidal activity of the purified inhibitor was evaluated against Spodoptera litura. The inhibitor induced a significant mortality in the larvae of S. litura and adversely affected its survival and development. It also inhibited the activity of α-glycosidases in vivo in the gut of the larvae. The purified inhibitor was determined to be a phenolic compound with amine groups, demonstrating a noncompetitive type of inhibition in vitro. The production of the inhibitor was optimized. Response surface methodology (RSM) analysis revealed a significant interaction between dextrose and malt extract, with first-order effect of pH.

  12. Alpha-glucosidase inhibitors in the early treatment of type 2 diabetes

    Directory of Open Access Journals (Sweden)

    Floris Alexander van de Laar

    2008-12-01

    Full Text Available Floris Alexander van de LaarRadboud University Nijmegen Medical Centre, Department of General Practice, Nijmegen, The NetherlandsAbstract: Alpha-glucosidase inhibitors (AGIs are drugs that inhibit the absorption of carbohydrates from the gut and may be used in the treatment of patients with type 2 diabetes or impaired glucose tolerance. There is currently no evidence that AGIs are beneficial to prevent or delay mortality or micro- or macrovascular complications in type 2 diabetes. Its beneficial effects on glycated hemoglobin are comparable to metformin or thiazolidinediones, and probably slightly inferior to sulphonylurea. In view of the total body of evidence metformin seems to be superior to AGIs. More long-term studies are needed to study the effects of AGIs compared to other drugs. For patient with impaired glucose tolerance AGIs may prevent, delay or mask the occurrence of type 2 diabetes. A possible beneficial effect on cardiovascular events should be confirmed in new studies.Keywords: alpha-glucosidase inhibitors, type 2 diabetes mellitus, impaired glucose tolerance

  13. Biosynthesis and transport of lysosomal alpha-glucosidase in the human colon carcinoma cell-line Caco-2: secretion from the apical surface

    NARCIS (Netherlands)

    Klumperman, J.; Fransen, J.A.; Boekestijn, J.C.; Oude Elferink, R.P.; Matter, K.; Hauri, H.P.; Tager, J.M.; Ginsel, L.A.

    1991-01-01

    The human adenocarcinoma cell line Caco-2 was used for studies on the biosynthesis and transport of lysosomal acid alpha-glucosidase in polarized epithelial cells. Metabolic labelling revealed that in Caco-2 cells alpha-glucosidase is synthesized as a precursor form of 110 x 10(3) Mr. This form is

  14. Screening of endophytic fungi having ability for antioxidative and alpha-glucosidase inhibitor activities isolated from Taxus sumatrana.

    Science.gov (United States)

    Artanti, N; Tachibana, S; Kardono, L B S; Sukiman, H

    2011-11-15

    Endophytic microbes are considered as an important source of natural products. They show antibiotic, anticancer, antioxidative and antidiabetic activities. Therefore, there are many reports on the isolation and bioactivity screening of endophytic fungi from various plants including Taxus species. Taxus sumatrana (Miq.) de Laub is found in Indonesia. The objective of this study is to conduct an in vitro screening of 14 endophytic fungi isolated from Taxus sumatrana having antioxidative and alpha-glucosidase inhibitor activities. Each endophytic fungus was cultured for 7 days and the fungal mycelium and medium were extracted with methanol and ethyl acetate, respectively, to produce each extract. The antioxidative activity of each extract was tested by DPPH free radical scavenging activity and beta-carotene bleaching assays, whereas antidiabetic activity was tested based on alpha-glucosidase inhibitor activity. The screening results showed that fungal mycelia of TSC 13 had the best alpha-glucosidase inhibitor activity and TSC 24 had the best antioxidative activity. Isolation of bioactive compounds from TSC 13 and TSC 24 is being conducted. This is the first report that endophytic fungi isolated from T. sumatrana exhibited anti alpha-glucosidase inhibitory and anti oxidative activities.

  15. alpha-Glucosidase inhibitory pentacyclic triterpenes from the stem bark of Fagara tessmannii (Rutaceae).

    Science.gov (United States)

    Mbaze, Luc Meva'a; Poumale, Herve Martial P; Wansi, Jean Duplex; Lado, Jean Alexandre; Khan, Shamsun Nahar; Iqbal, Muhammad Choudhary; Ngadjui, Bonaventure Tchaleu; Laatsch, Hartmut

    2007-03-01

    In addition to fatty acids, a mixture of sterols (beta-sitosterol, stigmasterol, campesterol and stigmastanol), lupeol, arctigenin methylether, sesamin, vanillic acid (1), 2,6-dimethoxy-1,4-benzoquinone (2), betulinic acid and two pentacyclic triterpene acetates were isolated from Fagara tessmannii Engl. They were identified as 3beta-acetoxy-16beta-hydroxybetulinic acid (3a) and 3beta,16beta-diacetoxybetulinic acid (3b), and their structures were established using 1 and 2D NMR spectra and by comparison with published data. Two derivatives of the compounds were prepared. Some isolated compounds were evaluated for their antifungal and antibacterial activities. Compounds 1 and 3a showed significant inhibition of alpha-glucosidase.

  16. BIOLOGICAL ACTIVITIES AFFORDED BY THE EXTRACT FROM RARU BARK TO INHIBIT ACTION OF ALPHA- GLUCOSIDASE ENZYMES

    Directory of Open Access Journals (Sweden)

    Gunawan Pasaribu

    2011-06-01

    Full Text Available Raru (Shoreabalanocarpoides Sym signifies one of the tree species that grows widespread in Sumatra Island.  Its bark portion is commonly used by local villagers as additional ingredient mixed to nira (sugar palm juice.  This addition is intended to make the juice more durable and also to enrich its taste after the juice is previously fermented to become traditional toddy beverage or the so-call “tuak”.  Local villagers believe that raru bark can reduce the level of blood sugar. As the relevance, the research was conducted to confirm that the extract from raru bark could afford its biological activities to inhibit alpha-glucosidase enzyme through its characterization, quantification, and isolation of its boactive compound. The extraction was performed using two methods (i.e.reflux and maceration techniques. Result revealed that the bark extract obtained from both techniques contained polyphenol compounds: flavonoid, saponin and tannin. Further, raru-bark extract from the reflux and maceration techniques could inhibit the action of alpha glucosidase enzymes on carbohydrate substrate ( i.e. p -nitrophenil-α-D-glucopyranose, at respectively 90.67% and 97.33%. Meanwhile, the inhibition activities afforded by the patented drug as a control (i.e. glucobay equaled to 97.05%.  Assesment using UV-VIS spectroscopy, showed that the maximum spectrum of bioactive compound in the extract was at the wave length of 288.6 nm. Scrutiny using FTIR spectroscopy could identif y the presence of aromatic groups in the compound, containing -OH, C-H, C=C, C-O and C-H bond types. Analysis using GC-MS exhibited that the compound had molecular weight of 390 with molecular structure as C20H22O8. Ultimately, data analysis scrutiny with the aid of NMR judged the most plausible compound as bioactive was 4-Glucosyl-3, 4’, 5-trihydroxystilbene.

  17. Enzymatic profiles of Enterobacter sakazakii and related species with special reference to the alpha-glucosidase reaction and reproducibility of the test system.

    Science.gov (United States)

    Muytjens, H L; van der Ros-van de Repe, J; van Druten, H A

    1984-01-01

    The enzymatic profiles of Enterobacter sakazakii, Enterobacter cloacae, Enterobacter aerogenes, and Enterobacter agglomerans were determined with the API ZYM system (API System S.A., La Balme Les Grottes, France). Each assay was performed three times. A simple formula was derived and applied to assess the reproducibility of the API ZYM tests. In addition, a separate alpha-glucosidase test was performed. All E. sakazakii isolates produced alpha-glucosidase, in contrast to the other Enterobacter isolates. No phosphoamidase activity was detected in any of the E. sakazakii isolates, whereas it was present in 72% of E. cloacae, 89% of E. agglomerans, and 100% of E. aerogenes isolates. It was concluded that detection of alpha-glucosidase permits rapid and reliable differentiation between E. sakazakii and other Enterobacter species. The reproducibilities of alpha-glucosidase and phosphoamidase reactions were estimated to be 89 and 81%, respectively. PMID:6386874

  18. Cloning and Molecular Characterization of an Alpha-Glucosidase (MalH from the Halophilic Archaeon Haloquadratum walsbyi

    Directory of Open Access Journals (Sweden)

    Mara F. Cuebas-Irizarry

    2017-11-01

    Full Text Available We report the heterologous expression and molecular characterization of the first extremely halophilic alpha-glucosidase (EC 3.2.1.20 from the archaeon Haloquadratum walsbyi. A 2349 bp region (Hqrw_2071 from the Hqr. walsbyi C23 annotated genome was PCR-amplified and the resulting amplicon ligated into plasmid pET28b(+, expressed in E. coli Rosetta cells, and the resulting protein purified by Ni-NTA affinity chromatography. The recombinant protein showed an estimated molecular mass of 87 kDa, consistent with the expected value of the annotated protein, and an optimal activity for the hydrolysis of α-PNPG was detected at 40 °C, and at pH 6.0. Enzyme activity values were the highest in the presence of 3 M NaCl or 3–4 M KCl. However, specific activity values were two-fold higher in the presence of 3–4 M KCl when compared to NaCl suggesting a cytoplasmic localization. Phylogenetic analyses, with respect to other alpha-glucosidases from members of the class Halobacteria, showed that the Hqr. walsbyi MalH was most similar (up to 41% to alpha-glucosidases and alpha-xylosidases of Halorubrum. Moreover, computational analyses for the detection of functional domains, active and catalytic sites, as well as 3D structural predictions revealed a close relationship with an E. coli YicI-like alpha-xylosidase of the GH31 family. However, the purified enzyme did not show alpha-xylosidase activity. This narrower substrate range indicates a discrepancy with annotations from different databases and the possibility of specific substrate adaptations of halophilic glucosidases due to high salinity. To our knowledge, this is the first report on the characterization of an alpha-glucosidase from the halophilic Archaea, which could serve as a new model to gain insights into carbon metabolism in this understudied microbial group.

  19. Treatment with acarbose, an alpha-glucosidase inhibitor, reduces increased albumin excretion in streptozotocin-diabetic rats.

    Science.gov (United States)

    Cohen, M P; Vasselli, J R; Neuman, R G; Witt, J

    1995-10-01

    1. We examined the effect of the alpha-glucosidase inhibitor acarbose on urinary albumin excretion (UAE) in streptozotocin diabetic rats. 2. Treatment with acarbose for 8 weeks after induction of diabetes prevented the significant increase in UAE observed in untreated diabetic rats relative to nondiabetic controls. 3. Acarbose significantly reduced integrated glycemia, which correlated with albumin excretion rates, and exerts a salutary effect on diabetic renal dysfunction.

  20. Alpha-glucosidase inhibitory and antiplasmodial properties of terpenoids from the leaves of Buddleja saligna Willd.

    Science.gov (United States)

    Chukwujekwu, Jude C; Rengasamy, Kannan R R; de Kock, Carmen A; Smith, Peter J; Slavětínská, Lenka Poštová; van Staden, Johannes

    2016-01-01

    In our continuing search for biologically active natural product(s) of plant origin, Buddleja saligna, a South African medicinal plant, was screened in line with its traditional use for antidiabetic (yeast alpha glucosidase inhibitory) and antiplasmodial (against a chloroquine sensitive strain of Plasmodium falciparum (NF54)) activities. The hexane fraction showed the most promising activity with regards to its antidiabetic (IC(50) = 260 ± 0.112 µg/ml) and antiplasmodial (IC(50) = 8.5 ± 1.6 µg/ml) activities. Using activity guided fractionation three known terpenoids (betulonic acid, betulone and spinasterol) were isolated from this species for the first time. The compounds displayed varying levels of biological activities (antidiabetic: 27.31 µg/ml ≥ IC(50) ≥ 5.6 µg/ml; antiplasmodial: 14 µg/ml ≥ IC(50) ≥ 2 µg/ml) with very minimal toxicity.

  1. Expression of alpha subunit of alpha glucosidase II in adult mouse brain regions and selective organs

    Science.gov (United States)

    Anji, Antje; Miller, Hayley; Raman, Chandrasekar; Phillips, Mathew; Ciment, Gary; Kumari, Meena

    2014-01-01

    Alpha glucosidase II (GII), a resident of endoplasmic reticulum (ER) and an important enzyme in folding of nascent glycoproteins, is heterodimeric consisting of alpha (GIIα) and beta (GIIβ) subunits. The catalytic GIIα subunit with the help of mannose 6-phosphate receptor homology (MRH) domain of GIIβ sequentially hydrolyzes two α-1-3-linked glucose residues in the 2nd step of N-linked oligosaccharide-mediated protein folding. The soluble GIIα subunit is retained in the ER through its interaction with the HDEL-containing GIIβ subunit. N-glycosylation and correct protein folding is crucial for protein stability, trafficking, and cell surface expression of several proteins in the brain. Alterations in N-glycosylation lead to abnormalities in neuronal migration and mental retardation, various neurodegenerative diseases, and invasion of malignant gliomas. Inhibitors of GII are used to inhibit cell proliferation and migration in a variety of different pathologies such as viral infection, cancer and diabetes. In spite of the widespread usage of GIIα inhibitory drugs and the role of GIIα in brain function little is known about its expression in brain and other tissues. Here, we report generation of a highly specific chicken antibody to GIIα subunit and its characterization by Western blotting and immunoprecipitation using cerebral cortical extracts. Using this antibody we show that the GIIα protein is highly expressed in testis, kidney, and lung, with the least amount in heart. GIIα polypeptide levels in whole brain were comparable to spleen. However, higher expression of GIIα protein was detected in cerebral cortex reflecting its continuous requirement in correct folding of cell surface proteins. PMID:25131991

  2. In vitro alpha glucosidase inhibition and free-radical scavenging activity of propolis from Thai stingless bees in mangosteen orchard

    Directory of Open Access Journals (Sweden)

    Boonyadist Vongsak

    Full Text Available ABSTRACTThe chemical component and biological activity of propolis depend on flora area of bee collection and bee species. In the study, the propolis from three stingless bee species, Lepidotrigona ventralis Smith, Lepidotrigona terminata Smith, and Tetragonula pagdeni Schwarz, was collected in the same region of mangosteen garden from Thailand. Total phenolic content, alpha glucosidase inhibitory effect, and free-radical scavenging activity using FRAP, ABTS, DPPH assays were determined. The most potent activity of propolis extract was investigated for bioactive compounds and their quantity. The ethanol extract of T. pagdeni propolis had the highest total phenolic content 12.83 ± 0.72 g of gallic acid equivalents in 100 g of the extract, and the strongest alpha glucosidase inhibitory effect with the IC50 of 70.79 ± 6.44 µg/ml. The free-radical scavenging activity evaluated by FRAP, ABTS, DPPH assays showed the FRAP value of 279.70 ± 20.55 µmol FeSO4 equivalent/g extract and the IC50 of 59.52 ± 10.76 and 122.71 ± 11.76 µg/ml, respectively. Gamma- and alpha-mangostin from T. pagdeni propolis extract were isolated and determined for the biological activity. Gamma-mangostin exhibited the strongest activity for both alpha glucosidase inhibitory effect and free-radical scavenging activity. Using HPLC quantitative analysis method, the content of gamma- and alpha-mangostin in the extract was found to be 0.94 ± 0.01 and 2.77 ± 0.08% (w/w, respectively. These findings suggested that T. pagdeni propolis may be used as a more suitable raw material for nutraceutical and pharmaceutical products and these mangostin derivatives as markers.

  3. Effect of lipid extracts of Nigella sativa L. seeds on the liver ATP reduction and alpha-glucosidase inhibition.

    Science.gov (United States)

    Sobhi, Widad; Stevigny, Caroline; Duez, Pierre; Calderon, Bedro Buc; Atmani, Djebbar; Benboubetra, Mustapha

    2016-01-01

    Various extracts from the seeds of Nigella sativa have been used in traditional folk medicine to treat inflammation, liver disorders and arthritis. These seeds have been experimentally shown to possess antioxidant and hepatoprotective properties. Beside the hypoglycaemic and hypolipidemic effects, this study was carried out to evaluate, in vitro, toxicological effect of lipid extracts from the Nigella sativa seeds. The tested fractions were: (i) defatted methanolic extract, (ii) total lipid extract obtained by hexane extraction from methanolic extract and (iii) neutral and polar lipid fractions. The fractions were assessed, in vitro, for their inhibitory activity potential on the enzyme alpha-glucosidase as suppressing the enzyme activity is one among the therapeutic approaches to attenuate postprandial hyperglycemia. High inhibition of alpha-glucosidase by the two polar lipid fractions (F6 and F7) was reflected by their IC50 (0.51±0.04mg/ml and 0.55±0.09mg/ml, respectively), compared to acarbose (0.53±0.06mg/ml) and thymoquinone (0.65±0.05mg/ml). The hypoglycaemic effect of the polar lipid fraction of Nigella sativa could be explained by the inhibition of alpha-glucosidase, which is one of early steps of carbohydrate metabolism. Toxicological evaluation was investigated on precision-cut rat liver slices (PCLS). On PCLS, lipid extracts reduced ATP levels by 27 to 35%. Results indicate suggest that Nigella sativa extracts don't show a hepatoprotective effect against acetaminophen, but don't exhibit a major hepatotoxicity when tested alone.

  4. Synergisms in Alpha-glucosidase Inhibition and Antioxidant Activity of Camellia sinensis L. Kuntze and Eugenia uniflora L. Ethanolic Extracts

    Science.gov (United States)

    Vinholes, Juliana; Vizzotto, Márcia

    2017-01-01

    Background: Camellia sinensis, the most consumed and popular beverages worldwide, and Eugenia uniflora, a Brazilian native species, have been already confirmed to have beneficial effects in the treatment of diabetes mellitus. However, their potential acting together against an enzyme linked to this pathology has never been exploited. Objective: The aim of this study was to evaluate the inhibitory properties of individual and combined ethanolic extracts of the leaves of C. sinensis and E. uniflora over alpha-glucosidase, a key digestive enzyme used on the Type 2 diabetes mellitus (T2DM) control. In addition, their inhibitory activity against 2,2-diphenyl-1-picrylhydrazyl radical (DPPH•) and peroxyl radicals was also assayed. Materials and Methods: Enzyme inhibition and antioxidant potential were assessed based on in vitro assays. Total phenolic compounds, carotenoids, and chlorophylls A and B were achieved using spectrophotometric methods. Results: E. uniflora was almost 40 times more active on alpha-glucosidase than C. sinensis and combined extracts showed a significant synergistic effect with an obtained IC50 value almost 5 times lower than the theoretical value. C. sinensis extract was twice more active than E. uniflora concerning DPPH•, in contrast, E. uniflora was almost 10 times more effective than C. sinensis on inhibition of peroxyl radicals with a significant synergistic effect for combined extracts. The extracts activities may be related with their phytochemicals, mainly phenolic compounds, and chlorophylls. Conclusion: Combined C. sinensis and E. uniflora ethanolic extracts showed synergistic effect against alpha-glucosidase and lipid peroxidation. These herbal combinations can be used to control postprandial hyperglycemia and can also provide antioxidant defenses to patients with T2DM. SUMMARY Alfa-glucosidase and antioxidant Interaction between Camellia sinensis L. Kuntze and Eugenia uniflora L. ethanolic extracts was investigated.Extracts showed

  5. Nutrient Content, Phytonutrient Composition, Alpha Amylase, Alpha Glucosidase Inhibition Activity and Antioxidant Activity of the Stoechospermum Marginatum Collected in Pre Monsoon Season

    Directory of Open Access Journals (Sweden)

    Reka Palanivel

    2017-03-01

    Full Text Available The objective of this study was to investigate the nutrient content, phytonutrient composition, physicochemical properties, alpha amylase and alpha glucosidase inhibition activity and antioxidant activity of the brown algae Stoechospermum marginatum collected from Gulf of Mannar, Tamil Nadu, India in pre monsoon season (June- September, 2015. Six and eight hours of ethanol and aqueous extract of Stoechospermum marginatum were used for phytonutrient screening, alpha amylase, alpha glucosidase inhibition activity and antioxidant activity. From the results of the study it is understood that Stoechospermum marginatum contain a high amount of carbohydrate, protein, crude fiber and phytonutrients like tannin, flavonoid, saponin, alkaloid, terpenoids, steroid and total phenolic content. The physicochemical properties namely Water absorption and Swelling power were very promising. Alpha amylase and alpha glucosidase inhibition activity was recorded to be high in both aqueous and ethanol extracts of eight hour extraction than in extracts taken from six hours extraction. Antioxidant activity was detected using DPPH, FRAP, beta carotene scavenging and H2O2 assay and found to have a high radical scavenging activity. Stoechospermum marginatum possess a valuable amount of total phenolic content and other phytonutrients and physicochemical properties, it may the reason for the potential inhibition of alpha amylase, alpha glucosidase and antioxidant activity. It is concluded from the study that the brown algae may be incorporated into foods to enhance their nutritional and therapeutic value.

  6. Purification, enzymatic characterization, and nucleotide sequence of a high-isoelectric-point alpha-glucosidase from barley malt

    DEFF Research Database (Denmark)

    Frandsen, T P; Lok, F; Mirgorodskaya, E

    2000-01-01

    in the transition state complex. Mass spectrometry of tryptic fragments assigned the 92-kD protein to a barley cDNA (GenBank accession no. U22450) that appears to encode an alpha-glucosidase. A corresponding sequence (HvAgl97; GenBank accession no. AF118226) was isolated from a genomic phage library using a c......DNA fragment from a barley cDNA library. HvAgl97 encodes a putative 96.6-kD protein of 879 amino acids with 93.8% identity to the protein deduced from U22450. The sequence contains two active site motifs of glycoside hydrolase family 31. Three introns of 86 to 4,286 bp interrupt the coding region. The four...

  7. Insulin secretagogue, alpha-glucosidase and antioxidant activity of some selected spices in streptozotocin-induced diabetic rats.

    Science.gov (United States)

    Patil, Swapnil Balasaheb; Ghadyale, Varsha Adhikrao; Taklikar, Shreehari Subhash; Kulkarni, Chaitanya Ramesh; Arvindekar, Akalpita Umesh

    2011-03-01

    Spices are extensively used to enhance the taste and flavor of foods and are known to possess several medicinal properties. Myristica fragrans, Parmelia perlata, Illicium verum, Trachyspermum copticum and Myristica malabarica, the commonly used spices in India were assessed for antidiabetic activity in streptozotocin induced diabetic rats. In the in vitro insulin secretion studies on isolated islets of Langerhans, M. fragrans, T. copticum and M. malabarica showed dose dependent insulin secretion. At 1 mg/ml, P. perlata showed significant in vitro alpha-glucosidase inhibitory activity with IC(50) value of 0.14 mg/ml followed by M. malabarica (0.64 mg/ml), I. verum (0.67 mg/ml), M. fragrans (0.85 mg/ml) and T. copticum (0.92 mg/ml). The DPPH free radical scavenging activity of the extracts at a concentration of 1 mg/ml was as M. malabarica (90.45%), M. fragrans (89.89%), I. verum (87.22%), P. perlata (76.70%) and T. copticum (38.14%). P. perlata showed the highest phenolic content (i.e., 118.5 mg gallic acid equivalents/g) followed by M. malabarica (84.13 mg gallic acid equivalents/g). M. malabarica showed the highest flavonoid content (i.e., 38.35 mg quercetin equivalents/g). Regular use of these spices may prevent postprandial rise in glucose levels through inhibition of intestinal alpha-glucosidase and may maintain blood glucose level through insulin secretagogue action.

  8. Alpha-glucosidase inhibitory and antioxidant activities of Vietnamese edible plants and their relationships with polyphenol contents.

    Science.gov (United States)

    Mai, Truong Tuyet; Thu, Nghiem Nguyet; Tien, Pham Gia; Van Chuyen, Nguyen

    2007-06-01

    The prevention and treatment of non-communicable diseases by using the beneficial biological effects of polyphenolic plants have attracted increasing interest from nutritional scientists. The a-glucosidase inhibitory and antioxidant activities of aqueous and methanolic extracts from 28 common Vietnamese edible plants, comprising 4 groups (plants used for making drinks, edible wild vegetables, herbs, and dark green vegetables), were investigated in vitro. The polyphenol contents of these extracts were determined by the Folin-Ciocalteu method and calculated as catechin equivalents. The extracts from plants used for making drinks showed the highest activities for both a-glucosidase inhibition and as antioxidants, followed by edible wild vegetables, herbs, and dark green vegetables. Positive relationships among alpha-glucosidase inhibitory activities, antioxidant activities and polyphenol contents of these 28 edible plants were found in both aqueous and methanolic extracts. Four new promising materials that are similar to or better than guava leaf extract, including Syzygium zeylanicum, Cleistocalyx operculatus, Horsfieldia amygdalina and Careya arborea demonstrated high alpha-glucosidase inhibitory activity (93, 76, 68 and 67%, respectively) at the final concentration of 0.8 mg lyophilized material/mL solution and antioxidant activity (85, 87, 78 and 80%, respectively) at the final concentration of 30 pg lyophilized material/mL solution. These four edible plants contained significantly high polyphenol contents (equivalent to 251.7, 146.6, 136.6 and 168.6 mg of catechin/g dry weight, respectively). Thus, these four materials might be possible new sources of a-glucosidase inhibition and antioxidants suitable for use as functional foods in the future.

  9. Purification, enzymatic characterization, and nucleotide sequence of a high-isoelectric-point alpha-glucosidase from barley malt

    DEFF Research Database (Denmark)

    Frandsen, T P; Lok, F; Mirgorodskaya, E

    2000-01-01

    .5, and catalyzed the hydrolysis by a retaining mechanism, as shown by nuclear magnetic resonance. Acarbose was a strong inhibitor (K(i) = 1.5 microM). Molecular recognition revealed that all OH-groups in the non-reducing ring and OH-3 in the reducing ring of maltose formed important hydrogen bonds to the enzyme......High-isoelectric-point (pI) alpha-glucosidase was purified 7, 300-fold from an extract of barley (Hordeum vulgare) malt by ammonium sulfate fractionation, ion-exchange, and butyl-Sepharose chromatography. The enzyme had high activity toward maltose (k(cat) = 25 s(-1)), with an optimum at pH 4......DNA fragment from a barley cDNA library. HvAgl97 encodes a putative 96.6-kD protein of 879 amino acids with 93.8% identity to the protein deduced from U22450. The sequence contains two active site motifs of glycoside hydrolase family 31. Three introns of 86 to 4,286 bp interrupt the coding region. The four...

  10. [In-vitro study of the drug interactions between Miglitol, an alpha-glucosidase inhibitor, and adsorbents].

    Science.gov (United States)

    Amioka, Katsuo; Wada, Ikuo; Furuta, Yoshiyuki

    2007-12-01

    The interactions between miglitol, an alpha-glucosidase inhibitor, and six adsorbents (carbon spheres, cholestyramine, colestimide, sevelamer hydrochloride, calcium polystyrene sulfonate, and sodium polystyrene sulfonate) were investigated in vitro. Miglitol corresponding to the minimum dose and adsorbents corresponding to the maximum dose were incubated at 37 degrees C for 180 min in solutions of pH 1.2 (gastric pH condition) and pH 6.8 (enteric pH condition), with and without the presence of carbohydrates, which were added to observe the effects on food adsorption. The adsorption ratio of miglitol to carbon spheres was 13.6% and 0% in pH 1.2 solution and 86.4% and 5.0% in pH 6.8 solution without and with the presence of carbohydrates, respectively. Thus, the adsorption ratio was higher in pH 6.8 solution. Adsorption of miglitol to calcium polystyrene sulfonate was nearly the same, 15.0-21.9%, at both pH. The adsorption ratio of miglitol to sodium polystyrene sulfonate was 43.4% and 45.5%, respectively, in pH 1.2 solution without and with carbohydrates. In the pH 6.8 solutions, however, the respective adsorption ratios were low (5.2% and 11.3%). Miglitol did not adsorb to cholestyramine, sevelamer hydrochloride or colestimide under any pH condition examined. The above results suggest that miglitol adsorbs to carbon spheres and polystyrene sulfonic acid cation exchange resins. However, considering that miglitol is taken just before eating and thus exists in gastointestinal fluids together with food, and that the site of its effect is the upper small intestine, the interactions between miglitol and these adsorbents will most likely not be a problem.

  11. Miconia sp. Increases mRNA Levels of PPAR Gamma and Inhibits Alpha Amylase and Alpha Glucosidase

    Directory of Open Access Journals (Sweden)

    David Mizael Ortíz-Martinez

    2016-01-01

    Full Text Available Diabetes mellitus is a public health problem worldwide. For this reason, ethanolic extract of Miconia sp. from Oaxaca, Mexico, was selected in search of an alternative against this disease. The effect of Miconia sp. on mRNA expression of PPARγ on cell line 3T3-L1, its effect on alpha amylase and alpha glucosidase, lipid accumulation during adipogenesis, and cell viability on VERO cells were evaluated. The mRNA levels of PPARγ increased on 1.393±0.008 folds, lipid accumulation was increased by 29.55% with Miconia sp. extract and 34.57% with rosiglitazone, and α-amylase and α-glycosidase were inhibited with IC50 values from 28.23±2.15 μg/mL and 1.95±0.15 μg/mL, respectively; the IC50 on antiproliferative activity on VERO cells was 314.54±45.40 μg/mL. In case of α-amylase and α-glycosidase assays, IC50 (inhibitory concentration 50 refers to necessary extract amounts to inhibit 50% of enzymatic activity. On the other hand, on antiproliferative activity, IC50 (inhibitory concentration 50 refers to necessary extract amounts to inhibit 50% of cell proliferation. It was concluded that the compounds present in Miconia sp. ethanolic extract increase mRNA expression of PPARγ, inhibit α-amylase and α-glucosidase, and increase lipid accumulation. It constitutes an alternative as adjuvant in diabetes mellitus treatment; therefore, we recommend continuing identifying the compounds responsible for its promising in vivo antidiabetic activity.

  12. Oral delivery of Acid Alpha Glucosidase epitopes expressed in plant chloroplasts suppresses antibody formation in treatment of Pompe mice.

    Science.gov (United States)

    Su, Jin; Sherman, Alexandra; Doerfler, Phillip A; Byrne, Barry J; Herzog, Roland W; Daniell, Henry

    2015-10-01

    Deficiency of acid alpha glucosidase (GAA) causes Pompe disease in which the patients systemically accumulate lysosomal glycogen in muscles and nervous systems, often resulting in infant mortality. Although enzyme replacement therapy (ERT) is effective in treating patients with Pompe disease, formation of antibodies against rhGAA complicates treatment. In this report, we investigated induction of tolerance by oral administration of GAA expressed in chloroplasts. Because full-length GAA could not be expressed, N-terminal 410-amino acids of GAA (as determined by T-cell epitope mapping) were fused with the transmucosal carrier CTB. Tobacco transplastomic lines expressing CTB-GAA were generated through site-specific integration of transgenes into the chloroplast genome. Homoplasmic lines were confirmed by Southern blot analysis. Despite low-level expression of CTB-GAA in chloroplasts, yellow or albino phenotype of transplastomic lines was observed due to binding of GAA to a chloroplast protein that has homology to mannose-6 phosphate receptor. Oral administration of the plant-made CTB-GAA fusion protein even at 330-fold lower dose (1.5 μg) significantly suppressed immunoglobulin formation against GAA in Pompe mice injected with 500 μg rhGAA per dose, with several-fold lower titre of GAA-specific IgG1 and IgG2a. Lyophilization increased CTB-GAA concentration by 30-fold (up to 190 μg per g of freeze-dried leaf material), facilitating long-term storage at room temperature and higher dosage in future investigations. This study provides the first evidence that oral delivery of plant cells is effective in reducing antibody responses in ERT for lysosomal storage disorders facilitating further advances in clinical investigations using plant cell culture system or in vitro propagation. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  13. Production of enzymatically active recombinant full-length barley high pI alpha-glucosidase of glycoside family 31 by high cell-density fermentation of Pichia pastoris and affinity purification

    DEFF Research Database (Denmark)

    Næsted, Henrik; Kramhøft, Birte; Lok, F.

    2006-01-01

    of the alcohol oxidase 1 promoter using methanol induction of P. pastoris fermentation in a Biostat B 5 L reactor. Forty-two milligrams a-glucosidase was purified from 3.5 L culture in four steps applying an N-terminal hexa-histidine tag. The apparent molecular mass of the recombinant alpha-glucosidase was 100 k...

  14. Sugar transport in the thermoacidophilic archaeon Sulfolobus solfataricus

    NARCIS (Netherlands)

    Albers, Sonja-Verena

    2001-01-01

    Summary and concluding remarks Introduction The archaeon Sulfolobus solfataricus is a thermoacidophile preferring growth at around 80oC and a pH of 2.5 to 3.5. As a thermoacidophile S. solfataricus faces two major problems: firstly, the proton permeability of membranes increases with temperature

  15. KAPASITAS ANTIOKSIDAN DAN INHIBITOR ALFA GLUKOSIDASE EKSTRAK UMBI BAWANG DAYAK [Antioxidant and Alpha-Glucosidase Inhibitory Properties of Bawang Dayak Bulb Extracts

    Directory of Open Access Journals (Sweden)

    Andi Early Febrinda*

    2013-12-01

    Full Text Available Bawang dayak (Eleutherine palmifolia is an indigenous plant in Borneo traditionally used by Dayak tribes to treat any kind of degenerative deseases including diabetes mellitus. The purpose of this research was to measure antioxidant and antidiabetic capacities of water and ethanolic extracts of bawang dayak bulb. Parameters evaluated in this research were phytochemical screening, total phenolics, flavonoid content, DPPH free-radical scavenging activity, and alpha glucosidase inhibiting (AGI activity. The result showed that the total phenolics and flavonoid content in bawang dayak ethanolic extract (217.71 mg GAE/g and 65.35 mg QE/g were higher than that of the water extract (139.93 mg GAE/g and 16.95 mg QE/g. The ethanolic extract also had higher antioxidant and AGI activities (IC50 112 and 241 ppm than that of the water extract (IC50 526 and 505 ppm. In addition, the IC50 values for AGI in bawang dayak ethanolic extract was lower than acarbose which is known as a commercial antidiabetic agent.

  16. Alpha-glucosidase inhibitor, acarbose, improves glycamic control and reduces body weight in type 2 diabetes: Findings on indian patients from the pooled data analysis

    Directory of Open Access Journals (Sweden)

    Sanjay Kalra

    2013-01-01

    Full Text Available Alpha-glucosidase inhibitors are widely used especially in Asian countries as a treatment option for type 2 diabetes patients with high postprandial glycemia (PPG. The higher carbohydrate in the Indian diets lead to greater prandial glycemic excursion, increased glucosidase, and incretin activity in the gut and may need special therapeutic strategies to tackle these glucose peaks. This is the subgroup analysis of Indian subjects who participated in the GlucoVIP study that investigated the effectiveness and tolerability of acarbose as add-on or monotherapy in a range of patients with type 2 diabetes mellitus. A total of 1996 Indian patients were included in the effectiveness analysis. After 12.5 weeks (mean, the mean change in 2-hour PPG from baseline was −74.4 mg/dl, mean HbA1c decreased by -1.0%, and mean fasting blood glucose decreased by -37.9 mg/dl. The efficacy of acarbose was rated "very good" or "good" in 91.1% of patients, and tolerability as "very good" or "good" in 88.0% of patients. The results of this observational study suggest that acarbose was effective and well tolerated in the Indian patients with T2DM.

  17. Effect of alpha-glucosidase inhibitor on exocrine and endocrine pancreatic function in rats fed a high-carbohydrate diet consisting of sucrose or glucose.

    Science.gov (United States)

    Otsuki, M; Okabayashi, Y; Ohki, A; Suehiro, I; Baba, S

    1988-10-14

    The effect of the alpha-glucosidase inhibitor acarbose on pancreatic exocrine and endocrine function was studied using the isolated perfused pancreata prepared from rats fed a normal (control diet) or an acarbose-containing sucrose- (ACS diet) or glucose-supplemented diet (ACG diet) for 10 days. Pancreatic amylase and insulin contents in rats fed the ACS diet were significantly decreased compared with those in rats with the control diet. Rats fed the ACG diet, however, had normal enzyme and hormone contents. Basal and cerulein-stimulated flow rates of pancreatic juice in rats with the ACS or ACG diet were similar to those in rats fed the control diet, suggesting that the pancreata from rats treated with acarbose have normal sensitivity and responsiveness to cerulein. On the other hand, cerulein-stimulated amylase output was significantly decreased in rats with the ACS diet, but was normal in rats with the ACG diet. Insulin secretion to both glucose and cerulein stimulation in rats fed the ACS diet was reduced by approximately 55% compared with the control rats. On the other hand, rats fed the ACG diet showed normal insulin secretion to glucose stimulation, although the insulin response to cerulein stimulation was reduced by 30%. These results suggest that the addition of acarbose to the sucrose-rich diet decreases the secretory responsiveness of amylase to cerulein stimulation and that of insulin to both glucose and cerulein stimulation. All these alterations, except the sensitivity of B cells to cerulein, can be normalized by replacing sucrose with glucose.

  18. Properties and stabilization of an extracellular alpha-glucosidase from the extremely thermophilic archaebacteria Thermococcus strain AN1: enzyme activity at 130 degrees C.

    Science.gov (United States)

    Piller, K; Daniel, R M; Petach, H H

    1996-01-04

    An extracellular alpha-glucosidase from the thermophilic archaebacterium Thermococcus strain AN1 was purified 875-fold in five steps (Hiload Q-Sepharose, phenyl Sepharose, HPHT-hydroxyapatite, gel filtration and Mono Q chromatography) with a yield of 4%. It is a monomer with a molecular mass of about 60 kDa and a pI around 5. At 98 degrees C, the purified enzyme in buffer has a half-life around 35 min, which is increased to around 215 min in presence of 1% (w/v) dithiothreitol and 1% (w/v) BSA. Dithiothreitol (1%, w/v) and BSA (0.4%, w/v) also substantially increase the enzyme activity. The Km at 75 degrees C is 0.41 mM with pNP-alpha-D-glucopyranoside as substrate. The substrate preference of the enzyme is: pNP-alpha-D-glucoside > nigerose > panose > palatinose > isomaltose > maltose and turanose. No activity was found against starch, pullulan, amylose, maltotriose, maltotetraose, isomaltotriose, cellobiose and beta-gentiobiose. A variety of techniques including immobolization (e.g., on epoxy and glass beads), chemical modification (cross- and cocross-linking) and the use of additives (including polyhydroxylic molecules, BSA, salts, etc.) were applied to enhance stability at temperatures above 100 degrees C. The half-life could be increased from about 4 min at 100 degrees C to 30-60 min at 130 degrees C in presence of 90% (w/v) sorbitol, 1% (w/v) dithiothreitol and 1% (w/v) BSA, and by cross-linking with BSA in the presence of 90% (w/v) sorbitol. The stabilized enzyme showed good activity at 130 degrees C.

  19. Post-genomic characterization of metabolic pathways in Sulfolobus solfataricus

    NARCIS (Netherlands)

    Walther, J.

    2012-01-01

    The physiological functions and mode of actions of different biomolecules are of continuous interest and a prerequisite to fully understand and appreciate the potential of Archaea and their molecules. We chose to study Sulfolobus solfataricus for its stable (heat-resistant) enzymes and

  20. The loss of a polymorphic glycosylation site caused by Thr-927 [yields] Ile is linked to a second polymorphic Val-816 [yields] Ile substitution in lysosomal [alpha]-glucosidase of American blacks

    Energy Technology Data Exchange (ETDEWEB)

    Hermans, M.M.P.; Oostra, B.A.; Reuser, A.J.J. (Erasmus Univ., Rotterdam (Netherlands)); Svetkey, L.P.; Chen, Y.T. (Duke Univ., Durham, NC (United States))

    1993-04-01

    Inherited deficiency of the lysosomal hydrolase [alpha]-glucosidase (acid maltase) causes lysosomal accumulation of glycogen, a condition known as glycogen storage disease type II (GSD II). The clinical phenotype is heterogeneous, and heterogeneity also exists at the molecular level. Point mutations were recently identified in two cases of severe infantile and one case of adult GSD II. In addition to mutations with a deleterious effect on enzyme function, several polymorphisms have been documented. Of note are those polymorphisms that relate to racial differences, but they can pose a problem when mutant alleles are being analyzed. An example of this was an American black patient with an adult form of GSD II (GM1935). Mutation analysis revealed three amino acid substitutions that were not encountered in the Caucasian population. The three substitutions were Asp-645 [r arrow] Glu (exon 14), Val-816 [r arrow] Ile (exon 17), and Thr-927 [r arrow] Ile (exon 19), and they were linked to the same allele . The Thr-927 [r arrow] Ile substitution deleting the most carboxyl-terminal N-linked glycosylation site was found to have no effect on enzyme function, in agreement with the studies on the role of the individual glycosylation sites. There were different opinions, however, with respect to the effect of the other two substitutions. The Val-816 [r arrow] Ile substitution was reported by Martiniuk et al. to cause the lysosomal [alpha]-glucosidase deficiency, but the authors concluded on the basis of more extensive studies that the Asp-645[r arrow] Glu substitution was actually the deleterious mutation and the Val-816 [r arrow] Ile substitution a polymorphism. 8 refs., 1 fig.

  1. Glitazones and alpha-glucosidase inhibitors as the second-line oral anti-diabetic agents added to metformin reduce cardiovascular risk in Type 2 diabetes patients: a nationwide cohort observational study.

    Science.gov (United States)

    Chan, Cheng-Wei; Yu, Chu-Leng; Lin, Jiunn-Cherng; Hsieh, Yu-Cheng; Lin, Che-Chen; Hung, Chen-Ying; Li, Cheng-Hung; Liao, Ying-Chieh; Lo, Chu-Pin; Huang, Jin-Long; Lin, Ching-Heng; Wu, Tsu-Juey

    2018-01-24

    Metformin is the standard first-line drug for patients with Type 2 diabetes (T2DM). However, the optimal second-line oral anti-diabetic agent (ADA) remains unclear. We investigated the cardiovascular risk of various ADAs used as add-on medication to metformin in T2DM patients from a nationwide cohort. T2DM patients using different add-on oral ADAs after an initial metformin therapy of > 90 days were identified from the Taiwan National Health Insurance Database. Five classes of ADAs, including sulphonylureas (SU), glinides, thiazolidinediones (TZD), alpha-glucosidase inhibitors (AGI), and dipeptidyl peptidase-4 inhibitors (DPP-4I) were selected for analysis. The reference group was the SU added to metformin. Patients were excluded if aged cardiovascular event (MACE) including ACS, ischemic/hemorrhagic stroke, and death. A Cox regression model was used to estimate the hazard ratio (HR) for MACE. A total of 26,742 patients receiving their add-on drug to metformin of either SU (n = 24,277), glinides (n = 962), TZD (n = 581), AGI (n = 808), or DPP-4I (n = 114) were analyzed. After a mean follow-up duration of 6.6 ± 3.4 years, a total of 4775 MACEs occurred. Compared with the SU+metformin group (reference), the TZD+metformin (adjusted HR: 0.66; 95% CI 0.50-0.88, p = 0.004) and AGI+metformin (adjusted HR: 0.74; 95% CI 0.59-0.94, p = 0.01) groups showed a significantly lower risk of MACE. Both TZD and AGI, when used as an add-on drug to metformin were associated with lower MACE risk when compared with SU added to metformin in this retrospective cohort study. Trial registration CE13152B-3. Registered 7 Mar, 2013, retrospectively registered.

  2. Crystallization and preliminary X-ray diffraction analysis of the hyperthermophilic Sulfolobus solfataricus phosphotriesterase

    International Nuclear Information System (INIS)

    Elias, Mikael; Dupuy, Jérôme; Merone, Luigia; Lecomte, Claude; Rossi, Mosè; Masson, Patrick; Manco, Giuseppe; Chabriere, Eric

    2007-01-01

    A phosphotriesterase (PTE) from the hyperthermophilic archaeon S. solfataricus has been crystallized. Combined with biochemical and bioengineering studies, it is expected that the structure of this protein will provide insight into the natural function of the PTE family and provide important data for achieving an efficient organophosphate biodecontaminant. Organophosphates constitute the largest class of insecticides used worldwide and some of them are potent nerve agents. Consequently, organophosphate-degrading enzymes are of paramount interest as they could be used as bioscavengers and biodecontaminants. Phosphotriesterases (PTEs) are capable of hydrolyzing these toxic compounds with high efficiency. A distant and hyperthermophilic representative of the PTE family was cloned from the archeon Sulfolobus solfataricus MT4, overexpressed in Escherichia coli and crystallized; the crystals diffracted to 2.54 Å resolution. Owing to its exceptional thermostability, this PTE may be an excellent candidate for obtaining an efficient organophosphate biodecontaminant. Here, the crystallization conditions and data collection for the hyperthermophilic S. solfataricus PTE are reported

  3. Harnessing hyperthermostable lactonase from Sulfolobus solfataricus for biotechnological applications.

    Science.gov (United States)

    Rémy, Benjamin; Plener, Laure; Poirier, Laetitia; Elias, Mikael; Daudé, David; Chabrière, Eric

    2016-11-23

    Extremozymes have gained considerable interest as they could meet industrial requirements. Among these, SsoPox is a hyperthermostable enzyme isolated from the archaeon Sulfolobus solfataricus. This enzyme is a lactonase catalyzing the hydrolysis of acyl-homoserine lactones; these molecules are involved in Gram-negative bacterial communication referred to as quorum sensing. SsoPox exhibits promiscuous phosphotriesterase activity for the degradation of organophosphorous chemicals including insecticides and chemical warfare agents. Owing to its bi-functional catalytic abilities as well as its intrinsic stability, SsoPox is appealing for many applications, having potential uses in the agriculture, defense, food and health industries. Here we investigate the biotechnological properties of the mutant SsoPox-W263I, a variant with increased lactonase and phosphotriesterase activities. We tested enzyme resistance against diverse process-like and operating conditions such as heat resistance, contact with organic solvents, sterilization, storage and immobilization. Bacterial secreted materials from both Gram-negative and positive bacteria were harmless on SsoPox-W263I activity and could reactivate heat-inactivated enzyme. SsoPox showed resistance to harsh conditions demonstrating that it is an extremely attractive enzyme for many applications. Finally, the potential of SsoPox-W263I to be active at subzero temperature is highlighted and discussed in regards to the common idea that hyperthermophile enzymes are nearly inactive at low temperatures.

  4. Regulation of expression of the arabinose and glucose transporter genes in the thermophilic archaeon Sulfolobus solfataricus

    NARCIS (Netherlands)

    Lubelska, Joanna M.; Jonuscheit, Melanie; Schleper, Christa; Albers, Sonja-Verena; Driessen, Arnold J. M.

    2006-01-01

    Sugar uptake in Sulfolobus solfataricus, a thermoacidophilic archaeon, occurs through high-affinity binding of protein-dependent ABC transporters. We have investigated the expression patterns of two sugar transport operons, that is, the glucose and arabinose transporters. Analysis of the araS

  5. Identification and characterisation of a novel acylpeptide hydrolase from Sulfolobus solfataricus: structural and functional insights.

    Directory of Open Access Journals (Sweden)

    Marta Gogliettino

    Full Text Available A novel acylpeptide hydrolase, named APEH-3(Ss, was isolated from the hypertermophilic archaeon Sulfolobus solfataricus. APEH is a member of the prolyl oligopeptidase family which catalyzes the removal of acetylated amino acid residues from the N terminus of oligopeptides. The purified enzyme shows a homotrimeric structure, unique among the associate partners of the APEH cluster and, in contrast to the archaeal APEHs which show both exo/endo peptidase activities, it appears to be a "true" aminopeptidase as exemplified by its mammalian counterparts, with which it shares a similar substrate specificity. Furthermore, a comparative study on the regulation of apeh gene expression, revealed a significant but divergent alteration in the expression pattern of apeh-3(Ss and apeh(Ss (the gene encoding the previously identified APEH(Ss from S. solfataricus, which is induced in response to various stressful growth conditions. Hence, both APEH enzymes can be defined as stress-regulated proteins which play a complementary role in enabling the survival of S. solfataricus cells under different conditions. These results provide new structural and functional insights into S. solfataricus APEH, offering a possible explanation for the multiplicity of this enzyme in Archaea.

  6. Properties of the recombinant a-glucosidase from Sulfolobus solfataricus in relation to starch processing

    NARCIS (Netherlands)

    Martino, A.; Schiraldi, C.; Fusco, S.; Lernia, Di I.; Costabile, T.; Pellicano, T.; Marotta, M.; Generoso, M.; Oost, van der J.; Sensen, C.W.

    2001-01-01

    An -glucosidase activity (EC 3.2.1.20) isolated from Sulfolobus solfataricus strain MT-4 was characterised and found of interest at industrial level in the saccharification step of hydrolysis process of starch. The gene encoding for the enzyme was expressed in Escherichia coli BL21 (DE3) with a

  7. Structure of dimeric, recombinant Sulfolobus solfataricus phosphoribosyl diphosphate synthase

    DEFF Research Database (Denmark)

    Andersen, Rune W.; Lo Leggio, Leila; Hove-Jensen, Bjarne

    2015-01-01

    ion were observed. Sulphate ion, reminiscent of the ammonium sulphate precipitation step of the purification, seems to bind tightly and, therefore, presumably occupies and blocks the ribose 5-phosphate binding site. The activity of S. solfataricus PRPP synthase is independent of phosphate ion....

  8. Genome-scale reconstruction and analysis of the metabolic network in the hyperthermophilic archaeon Sulfolobus solfataricus.

    Directory of Open Access Journals (Sweden)

    Thomas Ulas

    Full Text Available We describe the reconstruction of a genome-scale metabolic model of the crenarchaeon Sulfolobus solfataricus, a hyperthermoacidophilic microorganism. It grows in terrestrial volcanic hot springs with growth occurring at pH 2-4 (optimum 3.5 and a temperature of 75-80°C (optimum 80°C. The genome of Sulfolobus solfataricus P2 contains 2,992,245 bp on a single circular chromosome and encodes 2,977 proteins and a number of RNAs. The network comprises 718 metabolic and 58 transport/exchange reactions and 705 unique metabolites, based on the annotated genome and available biochemical data. Using the model in conjunction with constraint-based methods, we simulated the metabolic fluxes induced by different environmental and genetic conditions. The predictions were compared to experimental measurements and phenotypes of S. solfataricus. Furthermore, the performance of the network for 35 different carbon sources known for S. solfataricus from the literature was simulated. Comparing the growth on different carbon sources revealed that glycerol is the carbon source with the highest biomass flux per imported carbon atom (75% higher than glucose. Experimental data was also used to fit the model to phenotypic observations. In addition to the commonly known heterotrophic growth of S. solfataricus, the crenarchaeon is also able to grow autotrophically using the hydroxypropionate-hydroxybutyrate cycle for bicarbonate fixation. We integrated this pathway into our model and compared bicarbonate fixation with growth on glucose as sole carbon source. Finally, we tested the robustness of the metabolism with respect to gene deletions using the method of Minimization of Metabolic Adjustment (MOMA, which predicted that 18% of all possible single gene deletions would be lethal for the organism.

  9. Structure of the dimeric form of CTP synthase from Sulfolobus solfataricus

    DEFF Research Database (Denmark)

    Lauritsen, Iben; Willemoës, Martin; Jensen, Kaj Frank

    2011-01-01

    CTP synthase catalyzes the last committed step in de novo pyrimidine-nucleotide biosynthesis. Active CTP synthase is a tetrameric enzyme composed of a dimer of dimers. The tetramer is favoured in the presence of the substrate nucleotides ATP and UTP; when saturated with nucleotide, the tetramer c....... solfataricus CTP synthase according to a structural alignment with the E. coli enzyme all have large thermal parameters in the dimeric form. Furthermore, they are seen to undergo substantial movement upon tetramerization....

  10. Modeling DNA Repair: Approaching In Vivo Techniques in the Hyperthermophile Sulfolobus Solfataricus

    Energy Technology Data Exchange (ETDEWEB)

    Blanton, J.; Fuss, J.; Yannone, S.M.; Tainer, J.A.; Cooper, P.K.

    2005-01-01

    Archaea are found in some of the most extreme environments on earth and represent a third domain of life distinct from Eukarya and Eubacteria. The hyperthermophilic archaeon Sulfolobus solfataricus, isolated from acidic hot springs (80oC, pH 3) in Yellowstone National Park, has emerged as a potential model system for studying human DNA repair processes. Archaea are more closely related to Eukarya than to Eubacteria, suggesting that archaeal DNA repair machinery may model the complex human system much more closely than that of other prokaryotes. DNA repair requires coordinated protein-protein interactions that are frequently transient. Protein complexes that are transient at extreme temperatures where archaea thrive may be more stable at room temperature, allowing for the characterization of otherwise short-lived complexes. However, characterization of these systems in archaea has been limited by the absence of a stable in vivo transformation and expression system. The work presented here is a pilot study in gene cloning and recombinant protein expression in S. solfataricus. Three genes associated with DNA repair were selected for expression: MRE11, PCNA1, and a putative CSB homologue. Though preparation of these recombinant genes followed standard methods, preparation of a suitable vector proved more challenging. The shuttle vector pSSV64, derived from the SSV1 virus and the E. coli vector pBSSK+, was most successfully isolated from the DH5α E. coli strain. Currently, alternative vectors are being designed for more efficient genetic manipulations in S. solfataricus.

  11. Relato do primeiro paciente brasileiro com a forma infantil da doença de Pompe tratado com alfa-glicosidase recombinante humana Report of the first Brazilian infantile Pompe disease patient to be treated with recombinant human acid alpha-glucosidase

    Directory of Open Access Journals (Sweden)

    Sandra J. Pereira

    2008-06-01

    Full Text Available Objetivo: Relatar o primeiro caso de forma infantil da doença de Pompe tratado no Brasil. Descrição: Trata-se de doença de depósito lisossomal que se caracteriza por defeitos da enzima alfa-glicosidase ácida, com acúmulo intracelular de glicogênio, principalmente nos músculos. São descritas a forma infantil e tardia. Desde 2006, está disponível tratamento com enzima recombinante humana. Descreve-se o primeiro caso de forma infantil da doença tratado no Brasil. Trata-se de menina com 2,5 meses de idade e progressão rápida da doença, com perda dos movimentos dos membros, miocardiopatia hipertrófica e insuficiência respiratória aos 7 meses de idade. Após 10 meses de tratamento, apresentou boa resposta clínica, com remissão da insuficiência respiratória, recuperação parcial dos movimentos dos membros e melhora importante do quadro cardiológico. Comentários: Apesar de pouco freqüente, a forma infantil da doença de Pompe é letal. A disponibilidade de tratamento eficaz aumenta a necessidade de conhecimento e diagnóstico precoce da doença.Objective: To describe the first case of infantile Pompe disease to be treated in Brazil. Description: Pompe disease is a glycogen storage disease related to defects in the acid alpha-glucosidase enzyme, leading to an intracellular accumulation of glycogen, mainly in muscles. Two forms are described: infantile and juvenile. Since 2006, treatment with recombinant human acid alpha-glucosidase has been available. This article describes the first case of infantile Pompe disease treated in Brazil. A girl presented at 2.5 months of age with rapid disease progression, exhibiting severe hypotonia, loss of movements in both upper and lower limbs and hypertrophic cardiomyopathy, progressing to respiratory failure by the age of 7 months. After 10 months of treatment, she exhibited a good clinical response, with remission of the respiratory failure, partial recovery of arm and leg movements and

  12. Biochemical characterization of two Cdc6/ORC1-like proteins from the crenarchaeon Sulfolobus solfataricus.

    Science.gov (United States)

    De Felice, Mariarita; Esposito, Luca; Rossi, Mosè; Pisani, Francesca M

    2006-02-01

    The biological role of archaeal proteins, homologous to the eukaryal replication initiation factors of cell division control (Cdc6) and origin recognition complex (ORC1), has not yet been clearly established. The hyperthermophilic crenarchaeon Sulfolobus solfataricus (referred to as Sso) possesses three Cdc6/ORC1-like factors, which are named Sso Cdc6-1, Cdc6-2 and Cdc6-3. This study is a report on the biochemical characterization of Sso Cdc6-1 and Cdc6-3. It has been found that either Sso Cdc6-1 or Cdc6-3 behave as monomers in solutions by gel filtration analyses. Both factors are able to bind to various single-stranded and double-stranded DNA ligands, but Sso Cdc6-3 shows a higher DNA-binding affinity. It has also been observed that either Sso Cdc6-1 or Cdc6-3 inhibit the DNA unwinding activity of the S. solfataricus homo-hexameric mini-chromosome maintenance (MCM)-like DNA helicase (Sso MCM); although they strongly stimulate the interaction of the Sso MCM with bubble-containing synthetic oligonucleotides. The study has also showed, with surface plasmon resonance measurements, that Sso Cdc6-2 physically interacts with either Sso Cdc6-1 or Sso Cdc6-3. These findings may provide important clues needed to understand the biological role that is played by each of these three Cdc6 factors during the DNA replication initiation process in the S. solfataricus cells.

  13. Metal-ion dependent catalytic properties of Sulfolobus solfataricus class II α-mannosidase

    DEFF Research Database (Denmark)

    Nielsen, Jonas Willum; Poulsen, Nina Rødtness; Johnsson, Anna Margit Susanne

    2012-01-01

    residues. Recently, evidence has accumulated that class II α-mannosidase is active in complex with a range of divalent metal ions. In the present work, with employment of the class II α-mannosidase, ManA, from the hyperthermophilic archaeon Sulfolobus solfataricus, we explored the influence of the divalent...

  14. The Dichotomy of the Poly(ADP-Ribose Polymerase-Like Thermozyme from Sulfolobus solfataricus

    Directory of Open Access Journals (Sweden)

    Maria Rosaria Faraone Mennella

    2018-01-01

    Full Text Available The first evidence of an ADP-ribosylating activity in Archaea was obtained in Sulfolobus solfataricus(strain MT-4 where a poly(ADP-ribose polymerase (PARP-like thermoprotein, defined with the acronymous PARPSso, was found. Similarly to the eukaryotic counterparts PARPSso cleaves beta-nicotinamide adenine dinucleotide to synthesize oligomers of ADP-ribose; cross-reacts with polyclonal anti-PARP-1 catalytic site antibodies; binds DNA. The main differences rely on the molecular mass (46.5 kDa and the thermophily of PARPSso which works at 80 °C. Despite the biochemical properties that allow correlating it to PARP enzymes, the N-terminal and partial amino acid sequences available suggest that PARPSso belongs to a different group of enzymes, the DING proteins, an item discussed in detail in this review.This finding makes PARPSso the first example of a DING protein in Archaea and extends the existence of DING proteins into all the biological kingdoms. PARPSsohas a cell peripheral localization, along with the edge of the cell membrane. The ADP-ribosylation reaction is reverted by a poly(ADP-ribose glycohydrolase-like activity, able to use the eukaryotic poly(ADP-ribose as a substrate too. Here we overview the research of (ADP-ribosylation in Sulfolobus solfataricus in the past thirty years and discuss the features of PARPSso common with the canonical poly(ADP-ribose polymerases, and the structure fitting with that of DING proteins.

  15. Crystallization and preliminary X-ray characterization of a PaaX-like protein from Sulfolobus solfataricus P2

    International Nuclear Information System (INIS)

    Cao, Yi; Lou, Zhiyong; Sun, Yuna; Xue, Fei; Feng, Changzeng; Gong, Xiaocui; Yang, Dongmei; Bartlam, Mark; Meng, Zhaohui; Zhang, Keqin

    2009-01-01

    In this study, the PaaX-like protein from the hyperthermophilic archaeon Sulfolobus solfataricus P2 was successfully crystallized by the hanging-drop vapour-diffusion method using ammonium sulfate as a precipitant. PaaX is a global regulator of the phenylacetyl-coenzyme A catabolon that adjusts the expression of different operons to that of the paa-encoded central pathway. In this study, the PaaX-like protein from the hyperthermophilic archaeon Sulfolobus solfataricus P2 was successfully crystallized by the hanging-drop vapour-diffusion method using ammonium sulfate as a precipitant. Diffraction data were obtained to a resolution of 3.0 Å using synchrotron radiation at the Photon Factory. The crystal belonged to space group P321, with unit-cell parameters a = 86.4, b = 86.4, c = 105.5 Å

  16. Biochemical, transcriptional and translational evidences of the phenol-meta-degradation pathway by the hyperthermophilic Sulfolobus solfataricus 98/2.

    Directory of Open Access Journals (Sweden)

    Alexia Comte

    Full Text Available Phenol is a widespread pollutant and a model molecule to study the biodegradation of monoaromatic compounds. After a first oxidation step leading to catechol in mesophilic and thermophilic microorganisms, two main routes have been identified depending on the cleavage of the aromatic ring: ortho involving a catechol 1,2 dioxygenase (C12D and meta involving a catechol 2,3 dioxygenase (C23D. Our work aimed at elucidating the phenol-degradation pathway in the hyperthermophilic archaea Sulfolobus solfataricus 98/2. For this purpose, the strain was cultivated in a fermentor under different substrate and oxygenation conditions. Indeed, reducing dissolved-oxygen concentration allowed slowing down phenol catabolism (specific growth and phenol-consumption rates dropped 55% and 39%, respectively and thus, evidencing intermediate accumulations in the broth. HPLC/Diode Array Detector and LC-MS analyses on culture samples at low dissolved-oxygen concentration (DOC  =  0.06 mg x L(-1 suggested, apart for catechol, the presence of 2-hydroxymuconic acid, 4-oxalocrotonate and 4-hydroxy-2-oxovalerate, three intermediates of the meta route. RT-PCR analysis on oxygenase-coding genes of S. solfataricus 98/2 showed that the gene coding for the C23D was expressed only on phenol. In 2D-DIGE/MALDI-TOF analysis, the C23D was found and identified only on phenol. This set of results allowed us concluding that S. solfataricus 98/2 degrade phenol through the meta route.

  17. A cis-acting region in the N-methyl-D-aspartate R1 3′-untranslated region interacts with the novel RNA-binding proteins beta subunit of alpha glucosidase II and annexin A2: effect of chronic ethanol exposure in vivo

    Science.gov (United States)

    Anji, Antje; Kumari, Meena

    2011-01-01

    A cis-acting region, Δ4, located in the 3′-untranslated region of N-methyl-D-aspartate R (NR) mRNA interacts with several trans-acting proteins present in polysomes purified from fetal cortical neurons. Chronic ethanol exposure of fetal cortical neurons increases Δ4 RNA–protein interactions. This increased interaction is due to an increase in one of the Δ4-binding trans-acting proteins identified as beta subunit of alpha glucosidase II (GIIβ). In this study, we examined whether ethanol-mediated regulation of NR1 mRNA in vivo is similar to that in vitro and whether Δ4–trans interactions are important for ethanol-mediated NR1 mRNA stability. Our data show that polysomal proteins from adult mouse cerebral cortex (CC) formed a complex with Δ4 RNA, suggesting the presence of NR1 mRNA-binding trans-acting proteins in CC polysomes. The intensity of the Δ4 RNA–protein complex was increased with polysomes from chronic ethanol-exposed CC. The Δ4 RNA–protein complex harbored GIIβ and a second trans-acting protein identified as annexin A2 (AnxA2). Ethanol-sensitive GIIβ was upregulated by 70% in ethanol-exposed CC. Heparin, a known binding partner of AnxA2, inhibited Δ4 RNA–protein complex formation. Transient transfection studies using chimeric constructs with and without the Δ4 region revealed that cis–trans interactions are important for ethanol-mediated stability of NR1 mRNA. Furthermore, our data highlight, for the first time, the presence of a binding site on the 3′-untranslated region of NR1 mRNA for AnxA2 and demonstrate the regulation of NR1 mRNA by AnxA2, GIIβ and a third NR1 mRNA-binding protein, which is yet to be identified. PMID:21995826

  18. An alpha-glucosidase inhibitory activity of thermostable lectin ...

    African Journals Online (AJOL)

    A novel GI lectin was enriched from the seeds of the Djenkol bean, A. jiringa, to apparent homogeneity by 90% saturation ammonium sulfate precipitation and Con A-Sepharose affinity column chromatography. This lectin had an IC50 value for GI activity of 0.031 „b 0.02 mg/ml, an estimated molecular mass of 35.7 kDa, ...

  19. Alpha-Glucosidase Inhibitory and Antioxidant Activity of Solvent ...

    African Journals Online (AJOL)

    50603 Kuala Lumpur, 5Department of Biosciences and Health Sciences, Faculty of Biosciences and Medical Engineering,. Universiti Teknologi Malaysia, 81310 UTM Johor Bahru, ... fruit of Typha domingensis. Methods: Extracts were prepared using hexane, chloroform, ethyl acetate, acetone (AE), methanol, and water.

  20. Proteomic mapping of the hyperthermophilic and acidophilic archaeon Sulfolobus solfataricus P2

    Energy Technology Data Exchange (ETDEWEB)

    Barry, Richard C.; Young, Mark J.; Stedman, Kenneth M.; Dratz, Edward A.

    2006-07-14

    A proteomic map of Sulfolobus solfataricus P2, an archaeon that grows optimally at 80 C and pH 3.2, was developed using high resolution two-dimensional gel electrophoresis and peptide mass fingerprinting. A total of 867 protein spots (659 aqueous tris-soluble spots and 208 aqueous tris-insoluble) were mapped over IPG 3-10, 4-7, and 6-11, with second dimension gels made of 8-18% polyacrylamide. 324 different gene products were represented by the 867 spots, with 274 gene products being identified in the tris-soluble fractions and 100 gene products in the tris-insoluble portion. Fifty gene products were found on gels from both fractions. Additionally, an average of 1.50 + 0.12 isoforms/per protein were identified. This mapping study confirmed the expression of proteins involved in numerous metabolic, transport, energy production, nucleic acid replication, translation, and transcription pathways. Of particular interest, phosphoenolpyruvate carboxykinase (SSO2537) was detected even though the pathway for gluconeogenesis is unknown for this archaeon. Tris-soluble fractions contained many cytosolic proteins while tris-insoluble fractions contained many membrane-associated proteins, including ABC transporters and an ATP synthase. This study provides an optimized 2-DE approach for investigating the biochemical pathways and post-translational modifications employed by Sulfolobus to survive in its extreme environment.

  1. Backbone assignment of the binary complex of the full length Sulfolobus solfataricus DNA polymerase IV and DNA.

    Science.gov (United States)

    Lee, Eunjeong; Fowler, Jason D; Suo, Zucai; Wu, Zhengrong

    2017-04-01

    Sulfolobus solfataricus DNA polymerase IV (Dpo4), a model Y-family DNA polymerase, bypasses a wide range of DNA lesions in vitro and in vivo. In this paper, we report the backbone chemical shift assignments of the full length Dpo4 in its binary complex with a 14/14-mer DNA substrate. Upon DNA binding, several β-stranded regions in the isolated catalytic core and little finger/linker fragments of Dpo4 become more structured. This work serves as a foundation for our ongoing investigation of conformational dynamics of Dpo4 and future determination of the first solution structures of a DNA polymerase and its binary and ternary complexes.

  2. Overexpression, purification, crystallization and preliminary X-ray diffraction analysis of the C-­terminal domain of Ss-LrpB, a transcription regulator from Sulfolobus solfataricus

    OpenAIRE

    Peeters, Eveline; Hoa, Bach Thi Mai; Zegers, Ingrid; Charlier, Daniel; Maes, Dominique

    2005-01-01

    The C-terminal domain of the transcriptional regulator Ss-LrpB from S. solfataricus was purified by affinity chromatography and crystallized. Crystals belong to space group P21212. A complete data set was collected to a resolution of 2 Å.

  3. The non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase (GAPN) of Sulfolobus solfataricus: a key-enzyme of the semi-phosphorylative branch of the Entner-Doudoroff pathway

    NARCIS (Netherlands)

    Ettema, T.J.G.; Ahmed, H.; Geerling, A.C.M.; Oost, van der J.; Siebers, B.

    2008-01-01

    Archaea utilize a branched modification of the classical Entner¿Doudoroff (ED) pathway for sugar degradation. The semi-phosphorylative branch merges at the level of glyceraldehyde 3-phosphate (GAP) with the lower common shunt of the Emden-Meyerhof-Parnas pathway. In Sulfolobus solfataricus two

  4. Specificities and pH profiles of adenine and hypoxanthine-guanine-xanthine phosphoribosyltransferases (nucleotide synthases) of the thermoacidophile archaeon Sulfolobus solfataricus

    DEFF Research Database (Denmark)

    Hansen, Michael Riis; Jensen, Kristine Steen; Rasmussen, Mads Skytte

    2014-01-01

    Two open reading frames in the genome of Sulfolobus solfataricus (SSO2341 and SSO2424) were cloned and expressed in E. coli. The protein products were purified and their enzymatic activity characterized. Although SSO2341 was annotated as a gene (gpT-1) encoding a 6-oxopurine phosphoribosyltransfe...

  5. Redox stress proteins are involved in adaptation response of the hyperthermoacidophilic archaeon Sulfolobus solfataricus to nickel challenge

    Directory of Open Access Journals (Sweden)

    Scaloni Andrea

    2007-08-01

    Full Text Available Abstract Background Exposure to nickel (Ni and its chemical derivatives has been associated with severe health effects in human. On the contrary, poor knowledge has been acquired on target physiological processes or molecular mechanisms of this metal in model organisms, including Bacteria and Archaea. In this study, we describe an analysis focused at identifying proteins involved in the recovery of the archaeon Sulfolobus solfataricus strain MT4 from Ni-induced stress. Results To this purpose, Sulfolobus solfataricus was grown in the presence of the highest nickel sulphate concentration still allowing cells to survive; crude extracts from treated and untreated cells were compared at the proteome level by using a bi-dimensional chromatography approach. We identified several proteins specifically repressed or induced as result of Ni treatment. Observed up-regulated proteins were largely endowed with the ability to trigger recovery from oxidative and osmotic stress in other biological systems. It is noteworthy that most of the proteins induced following Ni treatment perform similar functions and a few have eukaryal homologue counterparts. Conclusion These findings suggest a series of preferential gene expression pathways activated in adaptation response to metal challenge.

  6. Identification and sequence analysis of Sulfolobus solfataricus purE and purK genes

    DEFF Research Database (Denmark)

    Sørensen, Iben Schildt; Dandanell, Gert

    1997-01-01

    From a genomic library of Sulfolobus solfataricus DSM1617 we have isolated and identified the purEK locus. Two open reading frames are identified as homologs of the purE and purK purine biosynthetic genes in Escherichia coli. The C-terminus of purE overlaps with the N-terminus of purK. When either...... of the genes is expressed from an E. coli promoter they can complement the corresponding purE and purK mutations in E. coli. PurE seems to be more closely related to eubacteria than to other archaea and to eukaryotes. Also the purK gene, which has not yet been found in other archaea, is more closely related...

  7. A New Pepstatin-Insensitive Thermopsin-Like Protease Overproduced in Peptide-Rich Cultures of Sulfolobus solfataricus

    Directory of Open Access Journals (Sweden)

    Marta Gogliettino

    2014-02-01

    Full Text Available In this study, we gain insight into the extracellular proteolytic system of Sulfolobus solfataricus grown on proteinaceous substrates, providing further evidence that acidic proteases were specifically produced in response to peptide-rich media. The main proteolytic component was the previously isolated SsMTP (Sulfolobus solfataricus multi-domain thermopsin-like protease, while the less abundant (named SsMTP-1 one was purified, characterized and identified as the sso1175 gene-product. The protein revealed a multi-domain organization shared with the cognate SsMTP with a catalytic domain followed by several tandemly-repeated motifs. Moreover, both enzymes were found spread across the Crenarchaeota phylum and belonging to the thermopsin family, although segregated into diverse phylogenetic clusters. SsMTP-1 showed a 75-kDa molecular mass and was stable in the temperature range 50–90 °C, with optimal activity at 70 °C and pH 2.0. Serine, metallo and aspartic protease inhibitors did not affect the enzyme activity, designating SsMTP-1 as a new member of the pepstatin-insensitive aspartic protease family. The peptide-bond-specificity of SsMTP-1 in the cleavage of the oxidized insulin B chain was uncommon amongst thermopsins, suggesting that it could play a distinct, but cooperative role in the protein degradation machinery. Interestingly, predictions of the transmembrane protein topology of SsMTP and SsMTP-1 strongly suggest a possible contribution in signal-transduction pathways.

  8. Bypass of Aflatoxin B[subscript 1] Adducts by the Sulfolobus solfataricus DNA Polymerase IV

    Energy Technology Data Exchange (ETDEWEB)

    Banerjee, Surajit; Brown, Kyle L.; Egli, Martin; Stone, Michael P. (Vanderbilt)

    2012-07-18

    Aflatoxin B{sub 1} (AFB{sub 1}) is oxidized to an epoxide in vivo, which forms an N7-dG DNA adduct (AFB{sub 1}-N7-dG). The AFB{sub 1}-N7-dG can rearrange to a formamidopyrimidine (AFB{sub 1}-FAPY) derivative. Both AFB{sub 1}-N7-dG and the {beta}-anomer of the AFB{sub 1}-FAPY adduct yield G {yields} T transversions in Escherichia coli, but the latter is more mutagenic. We show that the Sulfolobus solfataricus P2 DNA polymerase IV (Dpo4) bypasses AFB{sub 1}-N7-dG in an error-free manner but conducts error-prone replication past the AFB{sub 1}-FAPY adduct, including misinsertion of dATP, consistent with the G {yields} T mutations observed in E. coli. Three ternary (Dpo4-DNA-dNTP) structures with AFB{sub 1}-N7-dG adducted template:primers have been solved. These demonstrate insertion of dCTP opposite the AFB{sub 1}-N7-dG adduct, and correct vs incorrect insertion of dATP vs dTTP opposite the 5'-template neighbor dT from a primed AFB{sub 1}-N7-dG:dC pair. The insertion of dTTP reveals hydrogen bonding between the template N3 imino proton and the O{sup 2} oxygen of dTTP, and between the template T O{sup 4} oxygen and the N3 imino proton of dTTP, perhaps explaining why this polymerase does not efficiently catalyze phosphodiester bond formation from this mispair. The AFB{sub 1}-N7-dG maintains the 5'-intercalation of the AFB{sub 1} moiety observed in DNA. The bond between N7-dG and C8 of the AFB{sub 1} moiety remains in plane with the alkylated guanine, creating a 16{sup o} inclination of the AFB{sub 1} moiety with respect to the guanine. A binary (Dpo4-DNA) structure with an AFB{sub 1}-FAPY adducted template:primer also maintains 5'-intercalation of the AFB{sub 1} moiety. The {beta}-deoxyribose anomer is observed. Rotation about the FAPY C5-N{sup 5} bond orients the bond between N{sup 5} and C8 of the AFB{sub 1} moiety out of plane in the 5'-direction, with respect to the FAPY base. The formamide group extends in the 3'-direction. This improves

  9. Mutational analysis of divalent metal ion binding in the active site of class II α-mannosidase from sulfolobus solfataricus

    DEFF Research Database (Denmark)

    Hansen, Dennis K.; Webb, Helen; Nielsen, Jonas Willum

    2015-01-01

    +). Some mutant enzyme forms displayed an altered preference for the metal ion compared to that of the wild type-enzyme. Furthermore, the H228Q, H533E, and H533Q enzymes were inhibited at increasing Zn2+ concentrations. The catalytic rate was reduced for all enzymes compared to that of the wild-type enzyme......Mutational analysis of Sulfolobus solfataricus class II α-mannosidase was focused on side chains that interact with the hydroxyls of the-1 mannosyl of the substrate (Asp-534) or form ligands to the active site divalent metal ion (His-228 and His-533) judged from crystal structures of homologous...... enzymes. D534A and D534N appeared to be completely inactive. When compared to the wild-type enzyme, the mutant enzymes in general showed only small changes in KM for the substrate, p-nitrophenyl-α-mannoside, but elevated activation constants, KA, for the divalent metal ion (Co2+, Zn2+, Mn2+, or Cd2...

  10. Development of in vitro transposon assisted signal sequence trapping and its use in screening Bacillus halodurans C125 and Sulfolobus solfataricus P2 gene libraries

    DEFF Research Database (Denmark)

    Becker, F.; Schnorr, K.; Wilting, R.

    2004-01-01

    Bacillus halodurans C125 and the hyperthermophilic archaeon Sulfolobus solfataricus P2 were tagged with TnSig. The genomic sequences, which are publicly available (EMBL BA000004 and EMBL AE006641), were used for rapid open reading frame (ORF) identification and prediction of protein localisation...... in the cell. Genes for secreted proteins, transmembrane proteins and lipoproteins were successfully identified by this method. In contrast to previous transposon based identification strategies, the method described here is fast and versatile and essentially enables any selectable marker compatible library...

  11. EXPRESSION, PURIFICATION, AND SMALL ANGLE X-RAY SCATTERING OF DNA REPLICATION AND REPAIR PROTEINS FROM THE HYPERTHERMOPHILE SULFOLOBUS SOLFATARICUS

    Energy Technology Data Exchange (ETDEWEB)

    Patterson, S.M.; Hatherill, J.R.; Hammel, M.; Hura, G.L.; Tainer, J.A.; Yannone, S.M.

    2008-01-01

    Vital molecular processes such as DNA replication, transcription, translation, and maintenance occur through transient protein interactions. Elucidating the mechanisms by which these protein complexes and interactions function could lead to treatments for diseases related to DNA damage and cell division control. In the recent decades since its introduction as a third domain, Archaea have shown to be simpler models for complicated eukaryotic processes such as DNA replication, repair, transcription, and translation. Sulfolobus solfataricus is one such model organism. A hyperthermophile with an optimal growth temperature of 80°C, Sulfolobus protein-protein complexes and transient protein interactions should be more stable at moderate temperatures, providing a means to isolate and study their structure and function. Here we provide the initial steps towards characterizing three DNA-related Sulfolobus proteins with small angle X-ray scattering (SAXS): Sso0257, a cell division control and origin recognition complex homolog, Sso0768, the small subunit of the replication factor C, and Sso3167, a Mut-T like protein. SAXS analysis was performed at multiple concentrations for both short and long exposure times. The Sso0257 sample was determined to be either a mixture of monomeric and dimeric states or a population of dynamic monomers in various conformational states in solution, consistent with a fl exible winged helix domain. Sso0768 was found to be a complex mixture of multimeric states in solution. Finally, molecular envelope reconstruction from SAXS data for Sso3167 revealed a novel structural component which may function as a disordered to ordered region in the presence of its substrates and/or protein partners.

  12. Overexpression, purification, crystallization and preliminary X-ray diffraction analysis of the C-terminal domain of Ss-LrpB, a transcription regulator from Sulfolobus solfataricus

    International Nuclear Information System (INIS)

    Peeters, Eveline; Hoa, Bach Thi Mai; Zegers, Ingrid; Charlier, Daniel; Maes, Dominique

    2005-01-01

    The C-terminal domain of the transcriptional regulator Ss-LrpB from S. solfataricus was purified by affinity chromatography and crystallized. Crystals belong to space group P2 1 2 1 2. A complete data set was collected to a resolution of 2 Å. Ss-LrpB from Sulfolobus solfataricus P2 belongs to the bacterial/archaeal superfamily of Lrp-like (leucine-responsive regulatory protein-like) transcription regulators. The N-terminal DNA-binding domain contains a HTH motif and the C-terminal domain contains an αβ-sandwich (βαββαβ fold). The C-terminal domain was overexpressed in Escherichia coli, purified and crystallized using the hanging-drop vapour-diffusion method. The crystals belong to space group P2 1 2 1 2, with unit-cell parameters a = 59.35, b = 74.86, c = 38.08 Å and a data set was collected to 2.0 Å resolution. Structure determination using a selenomethionine derivative is under way

  13. Structural and Dynamics Characteristics of Acylphosphatase from Sulfolobus solfataricus in the Monomeric State and in the Initial Native-like Aggregates*

    Science.gov (United States)

    Pagano, Katiuscia; Bemporad, Francesco; Fogolari, Federico; Esposito, Gennaro; Viglino, Paolo; Chiti, Fabrizio; Corazza, Alessandra

    2010-01-01

    It has previously been shown that the acylphosphatase from Sulfolobus solfataricus is capable of forming amyloid-like aggregates under conditions in which the native structure is maintained and via the transient formation of native-like aggregates. Based on the previously determined NMR structure of the native protein, showing a ferredoxin-like fold and the peculiar presence of an unstructured N-terminal segment, we show here, at a molecular level using NMR spectroscopy, that indeed S. solfataricus acylphosphatase remains in a native-like conformation when placed in aggregating conditions and that such a native-like structure persists when the protein forms the initial aggregates, at least within the low molecular weight species. The analysis carried out under different solution conditions, based on the measurement of the combined 1H and 15N chemical shifts and hydrogen/deuterium exchange rates, enabled the most significant conformational changes to be monitored upon transfer of the monomeric state into aggregating conditions and upon formation of the initial native-like aggregates. Important increases of the hydrogen/deuterium exchange rates throughout the native protein, accompanied by small and localized structural changes, in the monomeric protein were observed. The results also allow the identification of the intermolecular interaction regions within the native-like aggregates, that involve, in particular, the N-terminal unstructured segment, the apical region including strands S4 and S5 with the connecting loop, and the opposite active site. PMID:20223823

  14. A systems biology approach reveals major metabolic changes in the thermoacidophilic archaeon Sulfolobus solfataricus in response to the carbon source L-fucose versus D-glucose.

    Science.gov (United States)

    Wolf, Jacqueline; Stark, Helge; Fafenrot, Katharina; Albersmeier, Andreas; Pham, Trong K; Müller, Katrin B; Meyer, Benjamin H; Hoffmann, Lena; Shen, Lu; Albaum, Stefan P; Kouril, Theresa; Schmidt-Hohagen, Kerstin; Neumann-Schaal, Meina; Bräsen, Christopher; Kalinowski, Jörn; Wright, Phillip C; Albers, Sonja-Verena; Schomburg, Dietmar; Siebers, Bettina

    2016-12-01

    Archaea are characterised by a complex metabolism with many unique enzymes that differ from their bacterial and eukaryotic counterparts. The thermoacidophilic archaeon Sulfolobus solfataricus is known for its metabolic versatility and is able to utilize a great variety of different carbon sources. However, the underlying degradation pathways and their regulation are often unknown. In this work, the growth on different carbon sources was analysed, using an integrated systems biology approach. The comparison of growth on L-fucose and D-glucose allows first insights into the genome-wide changes in response to the two carbon sources and revealed a new pathway for L-fucose degradation in S. solfataricus. During growth on L-fucose major changes in the central carbon metabolic network, as well as an increased activity of the glyoxylate bypass and the 3-hydroxypropionate/4-hydroxybutyrate cycle were observed. Within the newly discovered pathway for L-fucose degradation the following key reactions were identified: (i) L-fucose oxidation to L-fuconate via a dehydrogenase, (ii) dehydration to 2-keto-3-deoxy-L-fuconate via dehydratase, (iii) 2-keto-3-deoxy-L-fuconate cleavage to pyruvate and L-lactaldehyde via aldolase and (iv) L-lactaldehyde conversion to L-lactate via aldehyde dehydrogenase. This pathway as well as L-fucose transport shows interesting overlaps to the D-arabinose pathway, representing another example for pathway promiscuity in Sulfolobus species. © 2016 The Authors. Molecular Microbiology Published by John Wiley & Sons Ltd.

  15. CBD binding domain fused γ-lactamase from Sulfolobus solfataricus is an efficient catalyst for (-) γ-lactam production.

    Science.gov (United States)

    Wang, Jianjun; Zhu, Junge; Min, Cong; Wu, Sheng

    2014-05-13

    γ-lactamase is used for the resolution of γ-lactam which is utilized in the synthesizing of abacavir and peramivir. In some cases, enzymatic method is the most utilized method because of its high efficiency and productivity. The cellulose binding domain (CBD) of cellulose is often used as the bio-specific affinity matrix for enzyme immobilization. Cellulose is cheap and it has excellent chemical and physical properties. Meanwhile, binding between cellulose and CBD is tight and the desorption rarely happened. We prepared two fusion constructs of the γ-lactamase gene gla, which was from Sulfolobus solfataricus P2. These two constructs had Cbd (cellulose binding domain from Clostridium thermocellum) fused at amino or carboxyl terminus of the γ-lactamase. These two constructs were heterogeneously expressed in E. coli rosetta (DE3) as two fusion proteins. Both of them were immobilized well on Avicel (microcrystalline cellulose matrix). The apparent kinetic parameters revealed that carboxyl terminus fused protein (Gla-linker-Cbd) was a better catalyst. The V(max) and k(cat) value of Avicel immobilized Gla-linker-Cbd were 381 U mg⁻¹ and 4.7 × 10⁵ s⁻¹ respectively. And the values of the free Gla-linker-Cbd were 151 U mg⁻¹ and 1.8 × 10⁵ s⁻¹ respectively. These data indicated that the catalytic efficiency of the enzyme was upgraded after immobilization. The immobilized Gla-linker-Cbd had a 10-degree temperature optimum dropping from 80°C to 70°C but it was stable when incubated at 60°C for 48 h. It remained stable in catalyzing 20-batch reactions. After optimization, the immobilized enzyme concentration in transformation was set as 200 mg/mL. We found out that there was inhibition that occurred to the immobilized enzyme when substrate concentration exceeded 60 mM. Finally a 10 mL-volume transformation was conducted, in which 0.6 M substrate was hydrolyzed and the resolution was completed within 9 h with a 99.5% ee value. Cellulose is the most

  16. SMV1 virus-induced CRISPR spacer acquisition from the conjugative plasmid pMGB1 in Sulfolobus solfataricus P2

    DEFF Research Database (Denmark)

    Erdmann, Susanne; Shah, Shiraz Ali; Garrett, Roger Antony

    2013-01-01

    Organisms of the crenarchaeal order Sulfolobales carry complex CRISPR (clustered regularly interspaced short palindromic repeats) adaptive immune systems. These systems are modular and show extensive structural and functional diversity, especially in their interference complexes. The primary...... targets are an exceptional range of diverse viruses, many of which propagate stably within cells and follow lytic life cycles without producing cell lysis. These properties are consistent with the difficulty of activating CRISPR spacer uptake in the laboratory, but appear to conflict with the high...... complexity and diversity of the CRISPR immune systems that are found among the Sulfolobales. In the present article, we re-examine the first successful induction of archaeal spacer acquisition in our laboratory that occurred exclusively for the conjugative plasmid pMGB1 in Sulfolobus solfataricus P2...

  17. Long-term intravenous treatment of Pompe disease with recombinant human alpha-glucosidase from milk.

    NARCIS (Netherlands)

    Hout, J.M. van den; Kamphoven, J.H.; Winkel, L.P.; Arts, W.F.M.; Klerk, J.B.C. de; Loonen, M.C.B.; Vulto, A.G.; Cromme-Dijkhuis, A.H.; Weisglas-Kuperus, N.; Hop, W.C.J.; Hirtum, H. van; Diggelen, O.P. van; Boer, M. de; Kroos, M.A.; Doorn, P.A. van; Voort, E.I. van der; Sibbles, B.; Corven, E.J. van; Brakenhoff, J.P.; Hove, J.L. van; Smeitink, J.A.M.; Jong, G. de; Reuser, A.J.J.; Ploeg, A.T. van der

    2004-01-01

    OBJECTIVE: Recent reports warn that the worldwide cell culture capacity is insufficient to fulfill the increasing demand for human protein drugs. Production in milk of transgenic animals is an attractive alternative. Kilogram quantities of product per year can be obtained at relatively low costs,

  18. Long-term intravenous treatment of Pompe disease with recombinant human alpha-glucosidase from milk

    NARCIS (Netherlands)

    J.M.P. van den Hout (Johanna); B. Sibbles (Barbara); J.P. Brakenhoff (Just); A.H. Cromme-Dijkhuis (Adri); N. Weisglas-Kuperus (Nynke); A.J.J. Reuser (Arnold); M.A. Boer (Marijke); J.A.M. Smeitink (Jan); O.P. van Diggelen (Otto); E. van der Voort (Edwin); E.J.J.M. van Corven (Emiel); H. van Hirtum (Hans); J.H.J. Kamphoven (Joep); A.T. van der Ploeg (Ans); J. van Hove (Johan); W.F.M. Arts (Willem Frans); P.A. van Doorn (Pieter); J.B.C. de Klerk (Johannes); M.C.B. Loonen (Christa); A.G. Vulto (Arnold); M.A. Kroos (Marian); W.C.J. Hop (Wim); L.P.F. Winkel (Léon); G. de Jong (Gerard)

    2004-01-01

    textabstractOBJECTIVE: Recent reports warn that the worldwide cell culture capacity is insufficient to fulfill the increasing demand for human protein drugs. Production in milk of transgenic animals is an attractive alternative. Kilogram quantities of product per year can be

  19. Role of alpha-glucosidase in the fermentable sugar composition of sorghum malt mashes

    CSIR Research Space (South Africa)

    Taylor, JRN

    1994-11-01

    Full Text Available The cause of the high glucose to maltose ratio in sorghum malt worts was studied. Mashing temperature and pH strongly affected both the amount of glucose and the proportion of glucose relative to total fermentable sugars. The relative proportion...

  20. HPLC profile, in vitro alpha-amylase, alpha-glucosidase inhibitory ...

    African Journals Online (AJOL)

    High Performance Liquid Chromatography profile revealed Resorcinol/Catechol to be one of the phenolics detected and may be responsible for GSEALE's inhibition of α-amylase and α-glucosidase and antioxidant properties. This shows that GS can probably be used for antidiabetic purpose due to significant antioxidant ...

  1. Alpha-glucosidase inhibitory effect and inorganic constituents of Phyllanthus amarus Schum. & Thonn. ash

    Directory of Open Access Journals (Sweden)

    Malinee Wongnawa

    2014-10-01

    Full Text Available This study investigated the -glucosidase inhibitory effect and determined the concentration of some inorganic constituents in P. amarus ash. Oral glucose and sucrose tolerance test were performed on normal mice. In vitro -glucosidase inhibitory activity was evaluated by using yeast a-glucosidase. The element concentrations were measured by inductively coupled plasma (ICP spectroscopy. Single oral administration of P. amarus ash did not show antihyperglycemic effect after glucose administration, but decreased blood glucose level after sucrose administration. The ash showed -glucosidase inhibitory activity in vitro with IC50 of 982 mg/mL. The concentrations of K, Ca, Mg, Mn, Fe, Zn, Cu, Pb, Cr, Ni and Co in P. amarus ash were 35049.80±340.64, 3337.24±52.10, 1368.52±13.29, 90.81±1.34, 87.68±1.15, 18.28±0.22, 4.69±0.07, 1.07±0.15, 0.29±0.03, 0.20±0.04 and 0.10±0.02 mg/g, respectively. These results indicate that the antihyperglycemic effect of P. amarus ash might be partly due to the -glucosidase inhibitory activity of the inorganic constituents.

  2. A New alpha-Glucosidase Inhibitor, 10-Hydroxy-8(E)-Octadecenoic Acid

    Science.gov (United States)

    In our continuous effort to screen natural products for their anti-microbial and enzyme inhibitor activities, we found that 10-Hydroxy-8(E)-Octadecenoic acid (HOD) exhibited strong anti- a-glucosidase (EC 3.2.1.20) activity. HOD is an intermediate in the bioconversion of oleic acid to 7,10-dihydrox...

  3. Competitive inhibitor of cellular alpha-glucosidases protects mice from lethal dengue virus infection

    OpenAIRE

    Chang, Jinhong; Schul, Wouter; Yip, Andy; Xu, Xiaodong; Guo, Ju-Tao; Block, Timothy M.

    2011-01-01

    Dengue virus infection causes diseases in people, ranging from the acute febrile illness Dengue fever, to life-threatening Dengue Hemorrhagic Fever/Dengue Shock Syndrome. We previously reported that a host cellular α-glucosidases I and II inhibitor, imino sugar CM-10-18, potently inhibited dengue virus replication in cultured cells, and significantly reduced viremia in dengue virus infected AG129 mice. In this report we show that CM-10-18 also significantly protects mice from death and/or dis...

  4. Discovering Antioxidant Molecules in the Archaea Domain: Peroxiredoxin Bcp1 from Sulfolobus solfataricus Protects H9c2 Cardiomyoblasts from Oxidative Stress

    Directory of Open Access Journals (Sweden)

    Carmen Sarcinelli

    2016-01-01

    Full Text Available Peroxiredoxins (Prxs are ubiquitous thiol peroxidases that are involved in the reduction of peroxides. It has been reported that prokaryotic Prxs generally show greater structural robustness than their eukaryotic counterparts, making them less prone to inactivation by overoxidation. This difference has inspired the search for new antioxidants from prokaryotic sources that can be used as possible therapeutic biodrugs. Bacterioferritin comigratory proteins (Bcps of the hyperthermophilic archaeon Sulfolobus solfataricus that belong to the Prx family have recently been characterized. One of these proteins, Bcp1, was chosen to determine its antioxidant effects in H9c2 rat cardiomyoblast cells. Bcp1 activity was measured in vitro under physiological temperature and pH conditions that are typical of mammalian cells; the yeast thioredoxin reductase (yTrxR/thioredoxin (yTrx reducing system was used to evaluate enzyme activity. A TAT-Bcp1 fusion protein was constructed to allow its internalization and verify the effect of Bcp1 on H9c2 rat cardiomyoblasts subjected to oxidative stress. The results reveal that TAT-Bcp1 is not cytotoxic and inhibits H2O2-induced apoptosis in H9c2 cells by reducing the H2O2 content inside these cells.

  5. Functional and structural properties of the homogeneous beta-glycosidase from the extreme thermoacidophilic archaeon sulfolobus solfataricus expressed in Saccharomyces cerevisiae.

    Science.gov (United States)

    D'Auria, S; Morana, A; Febbraio, F; Vaccaro, C; De Rosa, M; Nucci, R

    1996-05-01

    A protein with beta-glycosidase activity from Sulfolobus solfataricus (S beta gly) was expressed in the yeast Saccharomyces cerevisiae. The purification procedure was made fast and easy by employing a single chromatographic step. After 5.8-fold purification, the cell extract gave a homogeneous enzyme at 166 U/mg. The recombinant enzyme was functionally and structurally similar to the wild-type enzyme. Kinetic experiments showed the same wide substrate specificity; in fact, the expressed enzyme hydrolyzed beta-D-gluco-, fuco-, and galactosides and a large number of glucoside dimers and oligomers, linked beta 1 -> 4. Moreover, the molecular mass of the enzyme was estimated to be 60 kDa by SDS-PAGE and 240 kDa by gel filtration, glycerol gradient, and ultracentrifugation analyses, indicating that the enzyme has a tetrameric structure. The N-terminal amino acid sequence, the temperature dependent activity, and content of secondary structure were similar to those of the wild-type enzyme. CD spectral and kinetic analyses showed that the only differences from the wild-type enzyme consist of the absence of lysine methylation, the presence of some glycosylated amino acid residues, and lower thermostability. Furthermore, calorimetric analyses on the expressed protein indicated values of delta dH = 5072 kJ/ mol and delta (d)C(p)= 100 kJ/mol, appreciably lower than those of the wild-type protein.

  6. Compound K Production from Red Ginseng Extract by β-Glycosidase from Sulfolobus solfataricus Supplemented with α-L-Arabinofuranosidase from Caldicellulosiruptor saccharolyticus.

    Directory of Open Access Journals (Sweden)

    Kyung-Chul Shin

    Full Text Available Ginsenoside compound K (C-K is attracting a lot of interest because of its biological and pharmaceutical activities, including hepatoprotective, antitumor, anti-wrinkling, and anti-skin aging activities. C-K has been used as the principal ingredient in skin care products. For the effective application of ginseng extracts to the manufacture of cosmetics, the PPD-type ginsenosides in ginseng extracts should be converted to C-K by enzymatic conversion. For increased yield of C-K from the protopanaxadiol (PPD-type ginsenosides in red-ginseng extract (RGE, the α-L-arabinofuranoside-hydrolyzing α-L-arabinofuranosidase from Caldicellulosiruptor saccharolyticus (CS-abf was used along with the β-D-glucopyranoside/α-L-arabinopyranoside-hydrolyzing β-glycosidase from Sulfolobus solfataricus (SS-bgly because SS-bgly showed very low hydrolytic activity on the α-L-arabinofuranoside linkage in ginsenosides. The optimal reaction conditions for C-K production were as follows: pH 6.0, 80°C, 2 U/mL SS-bgly, 3 U/mL CS-abf, and 7.5 g/L PPD-type ginsenosides in RGE. Under these optimized conditions, SS-bgly supplemented with CS-abf produced 4.2 g/L C-K from 7.5 g/L PPD-type ginsenosides in 12 h without other ginsenosides, with a molar yield of 100% and a productivity of 348 mg/L/h. To the best of our knowledge, this is the highest concentration and productivity of C-K from ginseng extract ever published in literature.

  7. Mutagenic Replication of N2-Deoxyguanosine Benzo[a]pyrene Adducts by Escherichia coli DNA Polymerase I and Sulfolobus solfataricus DNA Polymerase IV.

    Science.gov (United States)

    Gowda, A S Prakasha; Krzeminski, Jacek; Amin, Shantu; Suo, Zucai; Spratt, Thomas E

    2017-05-15

    Benzo[a]pyrene, a potent human carcinogen, is metabolized in vivo to a diol epoxide that reacts with the N 2 -position of guanine to produce N 2 -BP-dG adducts. These adducts are mutagenic causing G to T transversions. These adducts block replicative polymerases but can be bypassed by the Y-family translesion synthesis polymerases. The mechanisms by which mutagenic bypass occurs is not well-known. We have evaluated base pairing structures using atomic substitution of the dNTP with two stereoisomers, 2'-deoxy-N-[(7R,8S,9R,10S)-7,8,9,10-tetrahydro-7,8,9-trihydroxybenzo[a]pyren-10-yl]guanosine and 2'-deoxy-N-[(7S,8R,9S,10R)-7,8,9,10-tetrahydro-7,8,9-trihydroxybenzo[a]pyren-10-yl]guanosine. We have examined the kinetics of incorporation of 1-deaza-dATP, 7-deaza-dATP, 2'-deoxyinosine triphosphate, and 7-deaza-dGTP, analogues of dATP and dGTP in which single atoms are changed. Changes in rate will occur if that atom provided a critical interaction in the transition state of the reaction. We examined two polymerases, Escherichia coli DNA polymerase I (Kf) and Sulfolobus solfataricus DNA polymerase IV (Dpo4), as models of a high fidelity and TLS polymerase, respectively. We found that with Kf, substitution of the nitrogens on the Watson-Crick face of the dNTPs resulted in decreased rate of reactions. This result is consistent with a Hoogsteen base pair in which the template N 2 -BP-dG flipped from the anti to syn conformation. With Dpo4, while the substitution did not affect the rate of reaction, the amplitude of the reaction decreased with all substitutions. This result suggests that Dpo4 bypasses N 2 -BP-dG via Hoogsteen base pairs but that the flipped nucleotide can be either the dNTP or the template.

  8. High yield production and purification of two recombinant thermostable phosphotriesterase-like lactonases from Sulfolobus acidocaldarius and Sulfolobus solfataricus useful as bioremediation tools and bioscavengers.

    Science.gov (United States)

    Restaino, Odile Francesca; Borzacchiello, Maria Giovanna; Scognamiglio, Ilaria; Fedele, Luigi; Alfano, Alberto; Porzio, Elena; Manco, Giuseppe; De Rosa, Mario; Schiraldi, Chiara

    2018-03-20

    Thermostable phosphotriesterase-like lactonases (PLLs) are able to degrade organophosphates and could be potentially employed as bioremediation tools and bioscavengers. But nowadays their manufacturing in high yields is still an issue that limits their industrial applications. In this work we aimed to set up a high yield production and purification biotechnological process of two recombinant PLLs expressed in E. coli, the wild type SacPox from Sulfolobus acidocaldarius and a triple mutated SsoPox C258L/I261F/W263A, originally from Sulfolobus solfataricus. To follow this aim new induction approaches were investigated to boost the enzyme production, high cell density fermentation strategies were set-up to reach higher and higher enzyme yields up to 22-L scale, a downstream train was studied to meet the requirements of an efficient industrial purification process. Physiological studies in shake flasks demonstrated that the use of galactose as inducer increased the enzyme concentrations up to 4.5 folds, compared to the production obtained by induction with IPTG. Optimising high cell density fed-batch strategies the production and the productivity of both enzymes were further enhanced of 26 folds, up to 2300 U·L - 1 and 47.1 U·L - 1 ·h - 1 for SacPox and to 8700 U·L - 1 and 180.6 U·L - 1 ·h - 1 for SsoPox C258L/I261F/W263A, and the fermentation processes resulted scalable from 2.5 to 22.0 L. After being produced and extracted from the cells, the enzymes were first purified by a thermo-precipitation step, whose conditions were optimised by response surface methodology. A following ultra-filtration process on 100 and 5 KDa cut-off membranes drove to a final pureness and a total recovery of both enzymes of 70.0 ± 2.0%, suitable for industrial applications. In this paper, for the first time, a high yield biotechnological manufacturing process of the recombinant enzymes SacPox and SsoPox C258L/I261F/W263A was set-up. The enzyme production was

  9. Extensive Lysine Methylation in Hyperthermophilic Crenarchaea: Potential Implications for Protein Stability and Recombinant Enzymes

    Directory of Open Access Journals (Sweden)

    Catherine H. Botting

    2010-01-01

    Full Text Available In eukarya and bacteria, lysine methylation is relatively rare and is catalysed by sequence-specific lysine methyltransferases that typically have only a single-protein target. Using RNA polymerase purified from the thermophilic crenarchaeum Sulfolobus solfataricus, we identified 21 methyllysines distributed across 9 subunits of the enzyme. The modified lysines were predominantly in α-helices and showed no conserved sequence context. A limited survey of the Thermoproteus tenax proteome revealed widespread modification with 52 methyllysines in 30 different proteins. These observations suggest the presence of an unusual lysine methyltransferase with relaxed specificity in the crenarchaea. Since lysine methylation is known to enhance protein thermostability, this may be an adaptation to a thermophilic lifestyle. The implications of this modification for studies and applications of recombinant crenarchaeal enzymes are discussed.

  10. Cuparane sesquiterpenes from Laurencia natalensis Kylin as inhibitors of alpha-glucosidase, dipeptidyl peptidase IV and xanthine oxidase

    Czech Academy of Sciences Publication Activity Database

    Rengasamy, K.R.R.; Poštová Slavětínská, Lenka; Kulkarni, M. G.; Stirk, W. A.; Van Staden, J.

    2017-01-01

    Roč. 25, Jul (2017), s. 178-183 ISSN 2211-9264 Institutional support: RVO:61388963 Keywords : 1-deoxyalgoane * dipeptidyl peptidase IV * diabetes * gout * Laurencia natalensis Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 3.994, year: 2016

  11. Antioxidant rich grape pomace extract suppresses postprandial hyperglycemia in diabetic mice by specifically inhibiting alpha-glucosidase

    Directory of Open Access Journals (Sweden)

    Hogan Shelly

    2010-08-01

    Full Text Available Abstract Background Postprandial hyperglycemia is an early defect of type 2 diabetes and one of primary anti-diabetic targets. Treatment of postprandial hyperglycemia can be achieved by inhibiting intestinal α-glucosidase, the key enzyme for oligosaccharide digestion and further glucose absorption. Grape pomace is winemaking byproduct rich in bioactive food compounds such as phenolic antioxidants. This study evaluated the anti-diabetic potential of two specific grape pomace extracts by determining their antioxidant and anti-postprandial hyperglycemic activities in vitro and in vivo. Methods The extracts of red wine grape pomace (Cabernet Franc and white wine grape pomace (Chardonnay were prepared in 80% ethanol. An extract of red apple pomace was included as a comparison. The radical scavenging activities and phenolic profiles of the pomace extracts were determined through the measurement of oxygen radical absorbance capacity, DPPH radical scavenging activity, total phenolic content and flavonoids. The inhibitory effects of the pomace extracts on yeast and rat intestinal α-glucosidases were determined. Male 6-week old C57BLKS/6NCr mice were treated with streptozocin to induce diabetes. The diabetic mice were then treated with vehicle or the grape pomace extract to determine whether the oral intake of the extract can suppress postprandial hyperglycemia through the inhibition of intestinal α-glucosidases. Results The red grape pomace extract contained significantly higher amounts of flavonoids and phenolic compounds and exerted stronger oxygen radical absorbance capacity than the red apple pomace extract. Both the grape pomace extracts but not the apple pomace extract exerted significant inhibition on intestinal α-glucosidases and the inhibition appears to be specific. In the animal study, the oral intake of the grape pomace extract (400 mg/kg body weight significantly suppressed the postprandial hyperglycemia by 35% in streptozocin-induced diabetic mice following starch challenge. Conclusion This is the first report that the grape pomace extracts selectively and significantly inhibits intestinal α-glucosidase and suppresses postprandial hyperglycemia in diabetic mice. The antioxidant and anti-postprandial hyperglycemic activities demonstrated on the tested grape pomace extract therefore suggest a potential for utilizing grape pomace-derived bioactive compounds in management of diabetes.

  12. Orthosiphol A from the aerial parts of Orthosiphon aristatus is putatively responsible for hypoglycemic effect via alpha-glucosidase inhibition.

    Science.gov (United States)

    Damsud, Thanakorn; Grace, Mary H; Adisakwattana, Sirichai; Phuwapraisirisan, Preecha

    2014-05-01

    An infusion of Orthosiphon aristatus has long been used for diabetes therapy; however, the active principles remained unknown. Herein, we report the identification of the putative agents responsible for this antidiabetic activity using an a-glucosidase-guided isolation. Four flavonoids named sinensetin (1), salvigenin (2), tetramethylscutellarein (3) and 3,7,4'-tri-O-methylkaempferol (4), together with a diterpenoid named orthosiphol A (5), were characterized, based on analysis of their spectroscopic data. Flavonoids 3 and 4 inhibited yeast a-glucosidase with IC,o values of 6.34 and 0.75 mM, respectively, whereas orthosiphol A (5) selectively inhibited intestinal maltase with an IC5o, value of 6.54 mM. A kinetic investigation of 5 indicated that it retarded maltase function in a noncompetitive manner.

  13. Increased glucose metabolism and alpha-glucosidase inhibition in Cordyceps militaris water extract-treated HepG2 cells

    Science.gov (United States)

    Kim, Dae Jung; Kang, Yun Hwan; Kim, Kyoung Kon; Kim, Tae Woo; Park, Jae Bong

    2017-01-01

    BACKGROUND/OBJECTIVES Recent living condition improvements, changes in dietary habits, and reductions in physical activity are contributing to an increase in metabolic syndrome symptoms including diabetes and obesity. Through such societal developments, humankind is continuously exposed to metabolic diseases such as diabetes, and the number of the victims is increasing. This study investigated Cordyceps militaris water extract (CMW)-induced glucose uptake in HepG2 cells and the effect of CMW treatment on glucose metabolism. MATERIALS/METHODS Colorimetric assay kits were used to determine the glucokinase (GK) and pyruvate dehydrogenase (PDH) activities, glucose uptake, and glycogen content. Either RT-PCR or western blot analysis was performed for quantitation of glucose transporter 2 (GLUT2), hepatocyte nuclear factor 1 alpha (HNF-1α), phosphatidylinositol 3-kinase (PI3k), protein kinase B (Akt), phosphorylated AMP-activated protein kinase (pAMPK), phosphoenolpyruvate carboxykinase, GK, PDH, and glycogen synthase kinase 3 beta (GSK-3β) expression levels. The α-glucosidase inhibitory activities of acarbose and CMW were evaluated by absorbance measurement. RESULTS CMW induced glucose uptake in HepG2 cells by increasing GLUT2 through HNF-1α expression stimulation. Glucose in the cells increased the CMW-induced phosphorylation of AMPK. In turn, glycolysis was stimulated, and glyconeogenesis was inhibited. Furthermore, by studying the mechanism of action of PI3k, Akt, and GSK-3β, and measuring glycogen content, the study confirmed that the glucose was stored in the liver as glycogen. Finally, CMW resulted in a higher level of α-glucosidase inhibitory activity than that from acarbose. CONCLUSION CMW induced the uptake of glucose into HepG2 cells, as well, it induced metabolism of the absorbed glucose. It is concluded that CMW is a candidate or potential use in diabetes prevention and treatment. PMID:28584574

  14. Lactic Acid Bacteria Producing Inhibitor of Alpha Glucosidase Isolated from Ganyong (Canna Edulis) and Kimpul (Xanthosoma sagittifolium)

    Science.gov (United States)

    Nurhayati, Rifa; Miftakhussolikhah; Frediansyah, Andri; Lailatul Rachmah, Desy

    2017-12-01

    Type 2 diabetes is a disease that caused by the failure of insulin secretion by the beta cells of the pancreas and insulin resistance in peripheral levels. One therapy for diabetics is by inhibiting the activity of α-glucosidase. Lactic acid bacteria have the ability to inhibit of α-glucosidase activity. The aims of this research was to isolation and screening of lactic acid bacteria from ganyong tuber (Canna Edulis) and kimpul tuber (Xanthosoma sagittifolium), which has the ability to inhibit the activity of α-glucosidase. Eightteen isolates were identified as lactic acid bacteria and all of them could inhibit the activity of α-glukosidase. The GN 8 isolate was perform the highest inhibition acivity.

  15. Antioxidant, anti-alpha-glucosidase and pancreatic beta-cell protective effects of methanolic extract of Ensete superbum Cheesm seeds

    Directory of Open Access Journals (Sweden)

    Solomon Habtemariam

    2017-02-01

    Conclusions: The reputed antidiabetic therapeutic uses of the seeds extract of E. superbum may be justified on the basis of inhibition of carbohydrate enzymes, antioxidant effects and pancreatic β-cell protection.

  16. Combination of alpha-glucosidase inhibitor and ribavirin for the treatment of Dengue virus infection in vitro and in vivo

    Science.gov (United States)

    Chang, Jinhong; Schul, Wouter; Butters, Terry D.; Yip, Andy; Liu, Boping; Goh, Anne; Lakshminarayana, Suresh B.; Alonzi, Dominic; Reinkensmeier, Gabriele; Pan, Xiaoben; Qu, Xiaowang; Weidner, Jessica M.; Wang, Lijuan; Yu, Wenquan; Borune, Nigel; Kinch, Mark A.; Rayahin, Jamie E.; Moriarty, Robert; Xu, Xiaodong; Shi, Pei-Yong; Guo, Ju-Tao; Block, Timothy M.

    2010-01-01

    Cellular α-glucosidases I and II are enzymes that sequentially trim the three terminal glucoses in the N-linked oligosaccharides of viral envelope glycoproteins. This process is essential for the proper folding of viral glycoproteins and subsequent assembly of many enveloped viruses, including dengue virus (DENV). Imino sugars are substrate mimics of α-glucosidases I and II. In this report, we show that two oxygenated alkyl imino sugar derivatives, CM-9-78 and CM-10-18, are potent inhibitors of both α-glucosidases I and II in vitro and in treated animals, and efficiently inhibit DENV infection of cultured human cells. Pharmacokinetic studies reveal that both compounds are well tolerated at doses up to 100mg/kg in rats and have favorable pharmacokinetic properties and bioavailability in mice. Moreover, we showed that oral administration of either CM-9-78 or CM-10-18 reduces the peak viremia of DENV in mice. Interestingly, while treatment of DENV infected mice with ribavirin alone did not reduce the viremia, combination therapy of ribavirin with sub-effective dose of CM-10-18 demonstrated a significantly enhanced antiviral activity, as indicated by a profound reduction of the viremia. Our findings thus suggest that combination therapy of two broad-spectrum antiviral agents may provide a practically useful approach for the treatment of DENV infection. PMID:21073903

  17. Inhibitory effect of leaf extract of Newbouldia laevis on the metabolic activities of alpha-glucosidase and alpha-amylase

    Directory of Open Access Journals (Sweden)

    Oyetunji T. Kolawole

    2013-12-01

    Full Text Available In this study, the effect of ethanol extract of the leaves of Newbouldia laevis on the activity of α-amylase and α-glucosidase was investigated. Inhibitory effect of N. laevis extract on α-glucosidase was tested in vitro using baker’s yeast α-glucosidase and rat intestinal α-glucosidase while α-amylase inhibitory effect was assayed using rat pancreatic α-amylase. α-Glucosidase inhibitory effect of the extract was also tested in vivo in diabetic and non-diabetic rats. N. laevis extract exhibited good α-glucosidase inhibitory activity in vitro with IC50 values of 2.2 µg/mL and 43.5 µg/mL for baker’s yeast and rat intestinal α-glucosidase respectively. The extract also inhibited rat pancreatic α-amylase activity with IC50 value of 58.7 µg/mL. In both diabetic and non-diabetic rats, N. laevis extract caused a significant reduction in postprandial blood glucose level after oral sucrose load. The results of this study indicate that N. laevis extract exerts its glucose-lowering effect through inhibition of α-glucosidase and α-amylase.

  18. Mapping the structure of folding cores in TIM barrel proteins by hydrogen exchange mass spectrometry: the roles of motif and sequence for the indole-3-glycerol phosphate synthase from Sulfolobus solfataricus.

    Science.gov (United States)

    Gu, Zhenyu; Zitzewitz, Jill A; Matthews, C Robert

    2007-04-27

    To test the roles of motif and amino acid sequence in the folding mechanisms of TIM barrel proteins, hydrogen-deuterium exchange was used to explore the structure of the stable folding intermediates for the of indole-3-glycerol phosphate synthase from Sulfolobus solfataricus (sIGPS). Previous studies of the urea denaturation of sIGPS revealed the presence of an intermediate that is highly populated at approximately 4.5 M urea and contains approximately 50% of the secondary structure of the native (N) state. Kinetic studies showed that this apparent equilibrium intermediate is actually comprised of two thermodynamically distinct species, I(a) and I(b). To probe the location of the secondary structure in this pair of stable on-pathway intermediates, the equilibrium unfolding process of sIGPS was monitored by hydrogen-deuterium exchange mass spectrometry. The intact protein and pepsin-digested fragments were studied at various concentrations of urea by electrospray and matrix-assisted laser desorption ionization time-of-flight mass spectrometry, respectively. Intact sIGPS strongly protects at least 54 amide protons from hydrogen-deuterium exchange in the intermediate states, demonstrating the presence of stable folded cores. When the protection patterns and the exchange mechanisms for the peptides are considered with the proposed folding mechanism, the results can be interpreted to define the structural boundaries of I(a) and I(b). Comparison of these results with previous hydrogen-deuterium exchange studies on another TIM barrel protein of low sequence identify, alpha-tryptophan synthase (alphaTS), indicates that the thermodynamic states corresponding to the folding intermediates are better conserved than their structures. Although the TIM barrel motif appears to define the basic features of the folding free energy surface, the structures of the partially folded states that appear during the folding reaction depend on the amino acid sequence. Markedly, the good

  19. Preliminary phytochemical screening and alpha-glucosidase inhibitory activity of Philippine taro (Colocasia esculenta (L.) Schott var. PSB-VG #9)

    Science.gov (United States)

    Lebosada, Richemae Grace R.; Librando, Ivy L.

    2017-01-01

    The study was conducted to determine the anti-hyperglycemic property in terms of α-glucosidase inhibitory activity of the various parts (corm, leaf and petiole) of Colocasia esculenta (L.) Schott var. PSB-VG #9. Each of the plant parts were extracted with 95% ethanol and concentrated using a rotary evaporator at 40 °C. The crude extracts were screened for the presence of alkaloids, flavonoids, glycosides and saponins using Thin Layer Chromatography. The α-glucosidase inhibitory activity of the crude extracts (50 mg/L) were assayed spectrophotometrically using a microplate reader. The results of the phytochemical screening revealed the presence of alkaloids, flavonoids, and saponins in the leaf part while flavonoids and saponins were detected in the petiole and only saponins were present in the corm. The assay showed that the percentage α-glucosidase inhibition of the 50 mg/L ethanolic crude extract of the corm, leaves and petiole of C. esculenta are 68.03, 71.64 and 71.39%, respectively. Statistical analysis shows significant differences in the α-glucosidase inhibition among the various plant parts. It can be concluded that the ethanolic crude extracts of the different parts of C. esculenta (L.) Schott var. PSB-VG #9 exhibited inhibitory activity against α-glucosidase and the presence of phytochemicals like alkaloids, flavonoids and saponins may have contributed greatly to the inhibitory activity of the plant extract and can be further subjected for isolation of the therapeutically active compounds with antidiabetes potency.

  20. In vitro anti-diabetic activity of flavonoids and pheophytins from Allophylus cominia Sw . on PTP1B, DPPIV, alpha-glucosidase and alpha-amylase enzymes.

    Science.gov (United States)

    Semaan, D G; Igoli, J O; Young, L; Marrero, E; Gray, A I; Rowan, E G

    2017-05-05

    Ethno-botanical information from diabetic patients in Cuba led to the identification of Allophylus cominia as a possible source of new drugs for the treatment of type 2 diabetes mellitus (T2-DM). Chemical characterization of the extracts from A. cominia was carried out using chromatographic and spectroscopic methods. The extracts were tested for their activity on PTP1B, DPPIV, α-glucosidase enzymes and α-amylase. The flavonoid rich fractions from A. cominia inhibited DPPIV enzyme (75.3±2.33%) at 30µg/ml and produced a concentration-dependent inhibition against DPPIV with a Ki value of 2.6µg/ml. At 30µg/ml, flavonoids and pheophytins extracts significantly inhibited PTP1B enzyme (100±2.6% and 68±1% respectively). The flavonoids, pheophytin A and pheophytin B fractions showed significant concentration-dependent inhibition against PTP1B with Ki values of 3µg/ml, 0.64µg/ml and 0.88µg/ml respectively. At 30µg/ml, the flavonoid fraction significantly inhibited α-glucosidase enzyme (86±0.3%) in a concentration-dependent pattern with a Ki value of 2µg/ml. None of the fractions showed significant effects on α-amylase. Fatty acids, tannins, pheophytins A and B, and a mixture of flavonoids were detected in the methanolic extract from A. cominia. The identified flavonoids were mearnsitrin, quercitrin, quercetin-3-alloside, and naringenin-7-glucoside. The pharmacological effects of the extracts from A. cominia earlier observed in experimental diabetic models was confirmed in this study. Thus a new drug or formulation for the treatment of T2-DM could be developed from A. cominia. Copyright © 2017 Elsevier Ireland Ltd. All rights reserved.

  1. Differential effects of sugars and the alpha-glucosidase inhibitor acarbose (Bay g 5421) on satiety in the Zucker obese rat.

    Science.gov (United States)

    Maggio, C A; Decarr, L B; Vasselli, J R

    1987-01-01

    To examine the satiety responses of Zucker obese and lean rats to simple sugars, adult male rats were given equicaloric intragastric infusions of fructose, glucose, and sucrose. All three sugars reduced the short-term intakes of both genotypes, although no reliable between-genotype differences in the satiety effects of the sugars were observed. Within each genotype, fructose had a larger satiety effect than sucrose. To examine a potential basis for the observed effects, rats were given sucrose infusions containing the intestinal glucosidase inhibitor acarbose (Bay g 5421). In obese rats, addition of a low dose of acarbose increased the satiety effect of sucrose infusion. Delaying carbohydrate absorption via acarbose administration may alter gastrointestinal and/or postabsorptive satiety processes, and may prove useful as a probe for investigating the nature of satiety signals.

  2. In vitro evaluation and determination of responsible fraction of coffee beans and dried sugar beet leaves for alpha-glucosidase inhibition.

    OpenAIRE

    K. Singh; A. Kafka; B-H Kang; R. Goundra; Y-I Kwon; E. Apostolidis

    2013-01-01

    Summary. Recent studies have identified that hydrophobic phenolic phytochemicals and hydrophilic Amadori compounds have potential for type 2 diabetes management via inhibition of carbohydrate hydrolysis enzymes. Here, we determined the phenolic content, α-glucosidase inhibitory activity, and pancreatic α-amylase inhibitory activity of water extracts of roasted and unroasted coffee beans and dried sugar beet leaves. Sugar beet leaves appeared to have the lowest total phenolic content while unr...

  3. Implicative Algebras

    African Journals Online (AJOL)

    Tadesse

    Department of Mathematics, Faculty of Computer and Mathematical Sciences, Addis Ababa. University, Addis Ababa, Ethiopia(*drkvenkateswarlu@gmail.com, **berhanufk@yahoo.co.uk). ABSTRACT. In this paper we introduce the concept of implicative algebras which is an equivalent definition of lattice implication algebra ...

  4. Implicative Algebras

    African Journals Online (AJOL)

    Tadesse

    metric space. Also we prove that every implicative algebra can be made into a regular. Autometrized Algebra of Swamy (1964) (see theorem 2.9). We recall the definition of Xu (1993). Defintion [2]: Let (L,∨,∧,0,1) be a bounded lattice with order reversing involution. “ ' ”and a binary operation → satisfying the following ...

  5. Flagellar motility and structure in the hyperthermoacidophilic archaeon Sulfolobus solfataricus

    NARCIS (Netherlands)

    Szabo, Zalan; Sani, Musa; Groeneveld, Maarten; Zolghadr, Benham; Schelert, James; Albers, Sonja-Verena; Blum, Paul; Boekema, Egbert J.; Driessen, Arnold J. M.

    Flagellation in archaea is widespread and is involved in swimming motility. Here, we demonstrate that the structural flagellin gene from the crenarchaeaon Suffolobus soffiataricus is highly expressed in stationary-phase-grown cells and under unfavorable nutritional conditions. A mutant in a

  6. Functional genomics of the thermo-acidophilic archaeon Sulfolobus solfataricus

    NARCIS (Netherlands)

    Oost, van der J.; Walther, J.; Brouns, S.J.J.; Werken, van de H.J.G.; Snijders, A.P.L.; Wright, P.C.; Andersson, A.; Bernander, R.; Vos, de W.M.

    2006-01-01

    Archaea and bacteria that optimally grow at temperatures above 60C and 80C are referred to as thermophiles and hyperthermophiles, respectively (Stetter, 1996). Since their discovery in the late 1960s (Brock and Freeze, 1969), attempts were made to reveal the secrets of the thermal resistance of

  7. Synthèses enzymatiques de néoglucoconjugués catalysées par l'alpha-glucosidase purifiée de la blatte Periplaneta americana (Linnaeus

    Directory of Open Access Journals (Sweden)

    Kamenan A.

    2005-01-01

    Full Text Available Enzymatic synthesis of neoglucoconjugates by purified α-glucosidase from cockroach Periplaneta americana (Linnaeus. Cockroach Periplaneta americana (Linnaeus contains in his digestive tract an acid (pH 5,0 and mesophile (50°C α-glucosidase. This enzyme, purified to homogeneity, hydrolyses highly maltose, sucrose and p-nitrophenyl-α-Dglucopyranoside. The ability of α-glucosidase from cockroach purified to homogeneity to catalyse transglucosylation reactions was tested using maltose and saccharose as glucosyl donors and 2-phenylethanol and phenol as acceptors. The experimental conditions were optimized in relation to the time course of the reaction, pH and concentrations of glucosyl donors and acceptors. The yields in transglucosylation reactions at 37 °C were very high and could attain 67% and 48% with 2-phenylethanol and phenol respectively as glucosyl acceptors. This α-glucosidase hydrolyzed the products formed. It seems that the products formed were the phenylethyl-α-D-glucoside and phenyl-α-D-glucoside. These results suggest that α- glucosidase from cockroach is an exoglucosidase which catalyse the splitting of the α-glucosyl residue from the non reducing terminal of the substrate to liberate α-glucose. This comportment indicates that this enzyme operated by a mechanism involving the retention of the anomeric configuration. On the basis of this work, α-glucosidase from P. americana appears to be a valuable tool for the preparation of α-neoglucoconjugates.

  8. alpha-Glucosidase inhibition (acarbose) fails to enhance secretion of glucagon-like peptide 1 (7-36 amide) and to delay gastric emptying in Type 2 diabetic patients

    DEFF Research Database (Denmark)

    Hücking, K; Kostic, Z; Pox, C

    2005-01-01

    and gastric emptying in Type 2 diabetic patients after a mixed test meal. PATIENTS AND METHODS: Ten Type 2 diabetic patients were tested with 100 mg acarbose or placebo served with a mixed meal that was labelled with 100 mg 13C-octanoic acid. Plasma concentrations of glucose, insulin, C-peptide, glucagon, GLP......-1 and GIP were determined over 6 h. Gastric emptying was measured by determining breath 13CO2 using infrared absorptiometry. Statistics repeated-measures anova. RESULTS: Gastric emptying rates (t1/2: 162 +/- 45 vs. 163 +/- 62 min, P = 0.65) and plasma concentrations (increasing from approximately 12...... to approximately 25 pmol/l, P = 0.37) and integrated responses of GLP-1 (P = 0.37) were not changed significantly by acarbose treatment. Postprandial plasma glucose concentrations (P concentrations of insulin and C...

  9. Drug: D09779 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D09779 Drug Emiglitate (JAN/INN) ... C17H25NO7 D09779.gif ... Antidiabetic agent ... DG01...663 ... alpha-Glucosidase inhibitor ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor Unclassified ... DG02044 ... Hypoglycemics ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor ... GAA [HSA:2548] [KO:K12316]; GANC [HS

  10. Drug: D01665 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01665 Drug Voglibose (JP17/USAN/INN); Basen (TN) ... C10H21NO7 D01665.gif ... Antidiabetic... agent ... DG01663 ... alpha-Glucosidase inhibitor ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor Uncla...ssified ... DG02044 ... Hypoglycemics ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor Therapeutic category: 3

  11. Drug: D00625 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00625 Drug Miglitol (JP17/USAN/INN); Glyset (TN) ... C8H17NO5 D00625.gif ... Antidiabetic... agent ... DG01663 ... alpha-Glucosidase inhibitor ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor Unclas...sified ... DG02044 ... Hypoglycemics ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor Same as: C07708 Therapeu

  12. Industrial implications of hydrogen

    International Nuclear Information System (INIS)

    Pressouyre, G.M.

    1982-01-01

    Two major industrial implications of hydrogen are examined: problems related to the effect of hydrogen on materials properties (hydrogen embrittlement), and problems related to the use and production of hydrogen as a future energy vector [fr

  13. Unemployed Youth: The Implications.

    Science.gov (United States)

    Goodland, M. C.

    1979-01-01

    Never has youth been better educated or more qualified to enter the job market, yet never has youth known such lack of employment. Ramifications of effects of unemployment on youth make unemployment a great values issue of today. Implications presented indicate Canada may be on the verge of social crisis. (Author/BEF)

  14. implications in neurodegenerative diseases

    Indian Academy of Sciences (India)

    SONALI SENGUPTA

    REVIEW ARTICLE. Noncoding RNAs in protein clearance pathways: implications in neurodegenerative diseases. SONALI SENGUPTA. ∗. Division of Biomolecules and Genetics, School of Biosciences and Technology, VIT University, Vellore 632 014, India. Abstract. The importance of noncoding genome has become more ...

  15. Psoriasis : implications of biologics

    NARCIS (Netherlands)

    Lecluse, L.L.A.

    2010-01-01

    Since the end of 2004 several specific immunomodulating therapies: ‘biologic response modifiers’ or ‘biologics’ have been registered for moderate to severe psoriasis in Europe. This thesis is considering the implications of the introduction of the biologics for psoriasis patients, focusing on safety

  16. Epigenetics: ambiguities and implications.

    Science.gov (United States)

    Stotz, Karola; Griffiths, Paul

    2016-12-01

    Everyone has heard of 'epigenetics', but the term means different things to different researchers. Four important contemporary meanings are outlined in this paper. Epigenetics in its various senses has implications for development, heredity, and evolution, and also for medicine. Concerning development, it cements the vision of a reactive genome strongly coupled to its environment. Concerning heredity, both narrowly epigenetic and broader 'exogenetic' systems of inheritance play important roles in the construction of phenotypes. A thoroughly epigenetic model of development and evolution was Waddington's aim when he introduced the term 'epigenetics' in the 1940s, but it has taken the modern development of molecular epigenetics to realize this aim. In the final sections of the paper we briefly outline some further implications of epigenetics for medicine and for the nature/nurture debate.

  17. Drug: D03342 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03342 Drug Camiglibose (USAN) ... (C13H25NO9)2. 3H2O D03342.gif ... Antidiabetic agen...t ... DG01663 ... alpha-Glucosidase inhibitor ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor Unclassified ... D...G02044 ... Hypoglycemics ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor ... CAS: 132438-21-2 PubChem: 17397492 LigandBox: D03342 ...

  18. Advances in fuzzy implication functions

    CERN Document Server

    Beliakov, Gleb; Sola, Humberto; Pradera, Ana

    2013-01-01

    Fuzzy implication functions are one of the main operations in fuzzy logic. They generalize the classical implication, which takes values in the set {0,1}, to fuzzy logic, where the truth values belong to the unit interval [0,1]. These functions are not only fundamental for fuzzy logic systems, fuzzy control, approximate reasoning and expert systems, but they also play a significant role in mathematical fuzzy logic, in fuzzy mathematical morphology and image processing, in defining fuzzy subsethood measures and in solving fuzzy relational equations. This volume collects 8 research papers on fuzzy implication functions. Three articles focus on the construction methods, on different ways of generating new classes and on the common properties of implications and their dependencies. Two articles discuss implications defined on lattices, in particular implication functions in interval-valued fuzzy set theories. One paper summarizes the sufficient and necessary conditions of solutions for one distributivity equation...

  19. Gene : CBRC-CJAC-01-0177 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available TED: similar to related to glucan 1, 4-alpha-glucosidase [Pan troglodytes] 4e-08 30% MLRSLQNHFLPSQGTHSLKAHTVPVGEAVSLHHSCQRLPIPFLSERLS...PYTIPVGGCLPTPFLSEAVFLHCSCRRLPTPFLSERLSPYTIPVGGCLPTPFLSEAVSLHRSCQRLSPYTIPVGGCLPTPFLSEAVSLHRSCRRLS...PYTVPVGEAVSLHRSCRRGCLHTPFLSEAVSLHRSCRRGCLPTPFLSERLSPYTVPVGGCLPTPFLSERLS...PYTVPVGEAVSLHRSCRRGCLPTPFLSERLSPYTVPVGEAVSLHRSCRRGCLHTPFLSEAVSIHRSCRRGCLPTPFLVGEAVSLHRSCPVAVSLHRSLSKAVSLPVSCRRLS...SPTPFPVGGWSSLTPVPXXXLHRSCRRGCLPTPFLSERLSPYTVPVGGCLPTPFLSERLSPYTVPVGEAVSLHRSCRRGCLPTPFLSERLSPYTVPVGEAV

  20. A Rare Case of Benign Pneumatosis Intestinalis with Portal Venous Gas and Pneumoperitoneum Induced by Acarbose.

    Science.gov (United States)

    Rottenstreich, Amihai; Agmon, Yahel; Elazary, Ram

    2015-01-01

    Alpha glucosidase inhibitors have been shown to be associated with pneumatosis intestinalis (PI) in recent reports. We herein report the case of a 73-year old man who received treatment with an alpha glucosidase inhibitor (acarbose) and presented with acute abdomen. A computed tomography scan demonstrated PI in addition to intrahepatic portal air and pneumoperitoneum. During exploratory laparotomy, we found no evidence of hollow organ perforation or bowel necrosis. The patient recovered after conservative treatment with cessation of the alpha glucosidase inhibitor. This is the first report to describe the combination of PI with portal venous gas and pneumoperitoneum caused by an alpha-glucosidase inhibitor.

  1. Implications of social structure

    DEFF Research Database (Denmark)

    Brask, Josefine Bohr

    and evolution of behaviour, and for individual fitness. In this thesis I investigated implications of social structure for fitness and behaviour, with focus on three main areas: social structure & fitness, social structure & communication, and social structure & cooperation. These areas were investigated...... in four separate studies. In the first study, we propose a simple framework that may be used as a base when studying the link between social structure and fitness. We furthermore review current evidence for fitness effects of social structure, and find good support for such effects. In the second study......, we investigate empirically the role of the social environment of individuals for their communication patterns. Our study species is a song bird, the black-capped chickadee (Poecile atricapillus). The results suggest that individual communication in this species is influenced by features of the local...

  2. (Implications, Motivations and Functions

    Directory of Open Access Journals (Sweden)

    Mahmood Shahabi

    2015-03-01

    Full Text Available A major concern in the last few years has been the fact that the Cultural Centers are keeping distance with what they have been established for, and instead of reproducing the hegemony, they have turned into a place for resistance and reproduction of resistance against hegemony. Cultural Centers, as urban public spaces in the last two decades, have been the subject of ideological discussions and debates. In such spaces, consumption is not just limited to the utilization of programs in cultural centers, but the consumption of Cultural Center’s spaces prevail the consumption of activities and programs in these Cultural Centers. Such consumption is associated with the introduction of several social and cultural definitions. The main purpose of this study is to identify the application and implications of the Cultural Centers for the youth in Tehran and the motivations and functions resulting from the consumption of these spaces. The study uses the method of basic theorization for the data collection and analysis. For this purpose, 25 of clients in Bahman, Shafagh, Honar, Kar, Quran and Eshragh Cultural Centers located in Tehran have been the subjects of in-depth interview. Totally, the results of this study show that Cultural Centers are a part of rites of transition to the adulthood for the youth of Tehran. They satisfy many of the needs related to their age, and in one word, they draw their own painting on the canvass of this public space. The Present study is going to describe and elaborate the painting patterns and interference in and intervention with the public space of the Cultural Centers. In this study, Cultural Center is considered as a context and its several implications for the users of this space are analyzed.

  3. The architects of crenarchaeal chromatin : A biophysical characterization of chromatin proteins from Sulfolobus solfataricus

    NARCIS (Netherlands)

    Driessen, Rosalie Paula Catharina

    2014-01-01

    Understanding of chromatin organization and compaction in Archaea is currently limited. The genome of several megabasepairs long is folded by a set of small chromatin proteins to fit into the micron-sized cell. A first step in understanding archaeal chromatin organization is to study the action of

  4. Mutations and Rearrangements in the Genome of Sulfolobus solfataricus P2

    DEFF Research Database (Denmark)

    Redder, P.; Garrett, R. A.

    2006-01-01

    of different types of mutation and possible rearrangements that can occur in the genome, the pyrEF locus was examined for mutations that were isolated after selection with 5-fluoroorotic acid. About two-thirds of the 130 mutations resulted from insertions of mobile elements, including insertion sequence (IS...... deletions, insertions, and a duplication, were observed, and about one-fifth of the mutations occurred elsewhere in the genome, possibly in an orotate transporter gene. One mutant exhibited a 5-kb genomic rearrangement at the pyrEF locus involving a two-step IS element-dependent reaction, and its boundaries...

  5. Glycemic variability: Clinical implications

    Directory of Open Access Journals (Sweden)

    Surabhi Venkata Satya Krishna

    2013-01-01

    Full Text Available Glycemic control and its benefits in preventing microvascular diabetic complications are convincingly proved by various prospective trials. Diabetes control and complications trial (DCCT had reported variable glycated hemoglobin (HbA1C as a cause of increased microvascular complications in conventional glycemic control group versus intensive one. However, in spite of several indirect evidences, its link with cardiovascular events or macrovascular complications is still not proved. Glycemic variability (GV is one more tool to explain relation between hyperglycemia and increased cardiovascular risk in diabetic patients. In fact GV along with fasting blood sugar, postprandial blood sugar, HbA1C, and quality of life has been proposed to form glycemic pentad, which needs to be considered in diabetes management. Postprandial spikes in blood glucose as well as hypoglycemic events, both are blamed for increased cardiovascular events in Type 2 diabetics. GV includes both these events and hence minimizing GV can prevent future cardiovascular events. Modern diabetes management modalities including improved sulfonylureas, glucagon like peptide-1 (GLP-1-based therapy, newer basal insulins, and modern insulin pumps address the issue of GV effectively. This article highlights mechanism, clinical implications, and measures to control GV in clinical practice.

  6. Implications of antisocial parents.

    Science.gov (United States)

    Torry, Zachary D; Billick, Stephen B

    2011-12-01

    Antisocial behavior is a socially maladaptive and harmful trait to possess. This can be especially injurious for a child who is raised by a parent with this personality structure. The pathology of antisocial behavior implies traits such as deceitfulness, irresponsibility, unreliability, and an incapability to feel guilt, remorse, or even love. This is damaging to a child's emotional, cognitive, and social development. Parents with this personality makeup can leave a child traumatized, empty, and incapable of forming meaningful personal relationships. Both genetic and environmental factors influence the development of antisocial behavior. Moreover, the child with a genetic predisposition to antisocial behavior who is raised with a parental style that triggers the genetic liability is at high risk for developing the same personality structure. Antisocial individuals are impulsive, irritable, and often have no concerns over their purported responsibilities. As a parent, this can lead to erratic discipline, neglectful parenting, and can undermine effective care giving. This paper will focus on the implications of parents with antisocial behavior and the impact that this behavior has on attachment as well as on the development of antisocial traits in children.

  7. Strategic Implications of Global Health

    National Research Council Canada - National Science Library

    Monaghan, Karen

    2008-01-01

    "Strategic Implications of Global Health" responds to a request from the Undersecretary of State for Democratization and Global Affairs for an intelligence assessment on the connections between health and U.S. national interests...

  8. Maritime Violence : Implications to Malaysia

    OpenAIRE

    Zubir, Nurulizwan Ahmad

    2012-01-01

    Abstract Maritime Piracy has been a serious threat to the international community especially in the SoutheastAsia region. This threat has caused tremendous implications towards the world economy, environment,political stability of the nations involved because 45% of the shipping company passes through theSoutheast Asia. The worrying fact is that these attacks were committed by terrorists as well as traditionalmaritime pirates. This paper examines on the implications of maritime crime in M...

  9. Dgroup: DG01803 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available DG01803 DGroup Antidiabetic, alpha-glucosidase inhibitor -bose ... D00216 ... Acarbose (...e (USAN) D09779 ... Emiglitate (JAN/INN) Antidiabetic agent ... DG01663 ... alpha-Glucosidase inhibitor Unclassified ... DG02044 ... Hypoglycemics ATC code: A10BF Antidiabetics GAA [HSA:2548] [KO:K12316] GANC [HSA:2595] [KO:K12317] MGAM [HSA:8972] [KO:K12047] ...

  10. Drug: D00216 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available etic agent ... DG01663 ... alpha-Glucosidase inhibitor ... DG01803 ... Antidiabetic, alpha-glu...cosidase inhibitor Unclassified ... DG02044 ... Hypoglycemics ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor... D00216 Drug Acarbose (JAN/USAN/INN); Precose (TN) ... C25H43NO18 D00216.gif ... Actinoplanes [TAX:1865] Antidiab

  11. Dgroup: DG01663 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available DG01663 DGroup alpha-Glucosidase inhibitor -bose, -glustat ... DG01803 ... Antidiabetic,...at ... D09605 ... Duvoglustat (USAN/INN) ... D09606 ... Duvoglustat hydrochloride (USAN) Antidiabetic agent ... alpha-glucosidase [KO:K12316 K12317 K12047] ...

  12. Cloning and characterization of two a-glucosidases from Bifidobacterium adolescentis DSM20083.

    NARCIS (Netherlands)

    Broek, van den L.A.M.; Struijs, K.; Verdoes, J.C.; Beldman, G.; Voragen, A.G.J.

    2003-01-01

    Two alpha-glucosidase encoding genes (aglA and aglB) from Bifidobacterium adolescentis DSM 20083 were isolated and characterized. Both alpha-glucosidases belong to family 13 of the glycosyl hydrolases. Recombinant AglA (EC 3.2.1.10) and AglB (EC 3.2.1.20), expressed in Escherichia coli, showed high

  13. Quantum histories and their implications

    International Nuclear Information System (INIS)

    Kent, A.

    2000-01-01

    Classical mechanics and standard Copenhagen quantum mechanics respect subspace implications. For example, if a particle is confined in a particular region R of space, then in these theories we can deduce that it is confined in regions containing R. However, subspace implications are generally violated by versions of quantum theory that assign probabilities to histories, such as the consistent histories approach. I define here a new criterion, ordered consistency, which refines the criterion of consistency and has the property that inferences made by ordered consistent sets do not violate subspace relations. This raises the question: do the operators defining our observations form an ordered consistent history? If so, ordered consistency defines a version of quantum theory with greater predictive power than the consistent histories formalism. If not, and our observations are defined by a non-ordered consistent quantum history, then subspace implications are not generally valid. (orig.)

  14. THE ACTUAL IMPLICATIONS OF INFLATION

    Directory of Open Access Journals (Sweden)

    Murăriţa Ilie

    2011-12-01

    Full Text Available The authors have started from the idea that inflationary phenomenon is a companion, the cause and the effect of the globalization of poverty in the broader context of world economy globalization. Therefore, starting from a common definition of inflation, the first objective was to identify causal relationships that singularize contemporary inflationary process. After that, attention was focused on the implications of inflation in the current stage, bearing in mind that monetary financial theory and practice are operating with perfectly anticipated inflation or imperfectly anticipated inflation. Inflation has great implications on the long-term contracts and wage contracts.

  15. Educational Implications of the Bender.

    Science.gov (United States)

    Petti, Michael

    1988-01-01

    Examples of diagnostic formulations of the "Bender Visual-Motor Gestalt" are outlined and their instructional implications are delineated. The difficulties in paper and pencil copying of geometric designs focus primarily on: separation and overlapping of figures, repetition of design elements, pencil grip, visual perceptions, pattern…

  16. Tuberculosis: the implications for anaesthesia

    African Journals Online (AJOL)

    S19. Anaesthetics Supplement: Tuberculosis: the implications for anaesthesia. S Afr Fam Pract 2014. Vol 56 No 2 Supplement 1. Introduction. Tuberculosis is a common problem, especially in the developing world. In 2010, the World Health Organization estimated 8.8 million new cases worldwide.1 South Africa is one of the ...

  17. Nutritional implications of food allergies

    African Journals Online (AJOL)

    diets are frequently adopted in the treatment of atopic dermatitis when the actual prevalence of cow's milk allergy in patients on milk elimination diets may be significantly lower than the number of patients prescribed such diets.2 Elimination of any major food, without considering its nutritional implications, has the potential to.

  18. Implications of SNOMED CT versioning

    NARCIS (Netherlands)

    Lee, Dennis; Cornet, Ronald; Lau, Francis

    2011-01-01

    To determine the changes each Systematized Nomenclature of Medicine Clinical Terms (SNOMED CT) release undergoes and the implications of those changes. (1) We reviewed the SNOMED CT Component History documentation and analyzed the Component History table in detail. (2) We outlined a list of semantic

  19. OSHA: Implications for Higher Education.

    Science.gov (United States)

    National Association of College and University Business Officers, Washington, DC.

    Presented in this document are several articles concerning recommendations about the Occupational Safety and Health Act of 1970 (OSHA) and its implications for higher education. It is time for an educated look at facilities and programs and the beginning of plans which, in the long run, will bring colleges and universities into compliance with…

  20. The Educational Implications of NAFTA.

    Science.gov (United States)

    1994

    The transcript provided in this document is from a symposium set up to explore the educational implications of the North American Free Trade Agreement (NAFTA). NAFTA, which will remove trade barriers between the United States, Mexico, and Canada contains no educational provisions. The panelists discuss the new educational challenges that NAFTA may…

  1. Astrosociological Implications of Astrobiology (Revisited)

    Science.gov (United States)

    Pass, Jim

    2010-01-01

    Supporters of astrobiology continue to organize the field around formalized associations and organizations under the guise of the so-called ``hard'' sciences (e.g., biology and the related physical/natural sciences). The so-called ``soft'' sciences-including sociology and the other social sciences, the behavioral sciences, and the humanities-remain largely separated from this dynamically growing field. However, as argued in this paper, space exploration involving the search for extraterrestrial life should be viewed as consisting of two interrelated parts (i.e., two sides of the same coin): astrobiology and astrosociology. Together, these two fields broadly combine the two major branches of science as they relate to the relationship between human life and alien life, as appropriate. Moreover, with a formalized system of collaboration, these two complimentary fields would also focus on the implications of their research to human beings as well as their cultures and social structures. By placing the astrosociological implications of astrobiology at a high enough priority, scientists interested in the search for alien life can augment their focus to include the social, cultural, and behavioral implications that were always associated with their work (yet previously overlooked or understated, and too often misunderstood). Recognition of the astrosociological implications expands our perception about alien life by creating a new emphasis on their ramifications to human life on Earth.

  2. MARITIME VIOLENCE : IMPLICATIONS TO MALAYSIA

    Directory of Open Access Journals (Sweden)

    Nurulizwan Ahmad Zubir

    2014-04-01

    Full Text Available Abstract Maritime Piracy has been a serious threat to the international community especially in the SoutheastAsia region. This threat has caused tremendous implications towards the world economy, environment,political stability of the nations involved because 45% of the shipping company passes through theSoutheast Asia. The worrying fact is that these attacks were committed by terrorists as well as traditionalmaritime pirates. This paper examines on the implications of maritime crime in Malaysia and discusseswhether the definition of piracy under the International Law could be applied to these attacks. Thispaper concludes that cooperation between the region’s states and the enhancement of a good securitysystem of one state are needed to combat maritime violence. Thus it is imperative that the internationallaw need to be changed in order to enhance the meaning of piracy and also to include sea terrorism. Key words: piracy, maritime, terrorist

  3. Safety implications of control systems

    International Nuclear Information System (INIS)

    Smith, O.L.

    1983-01-01

    The Safety Implications of Control Systems Program has three major activities in support of USI-A47. The first task is a failure mode and effects analysis of all plant systems which may potentially induce control system disturbance that have safety implications. This task has made a preliminary study of overfill events and recommended cases for further analysis on the hybrid simulator. Work continues on overcooling and undercooling. A detailed investigation of electric power network is in progress. LERs are providing guidance on important failure modes that will provide initial conditions for further simulator studies. The simulator taks is generating a detailed model of the control system supported by appropriate neutronics, hydraulics, and thermodynamics submodels of all other principal plant components. The simulator is in the last stages of development. Checkout calculations are in progress to establish model stability, robustness, and qualitative credibility. Verification against benchmark codes and plant data will follow

  4. Clinical implications of underactive bladder

    Directory of Open Access Journals (Sweden)

    Kwang Jin Ko

    2017-12-01

    Full Text Available Underactive bladder (UAB is a common urologic condition but a complex disease that causes troublesome lower urinary tract symptoms. Currently, management of UAB remains unsatisfactory. Also, many urological diseases can be combined with UAB. In these combined cases, the treatment results may be affected by UAB component. This review focuses on the clinical implications of UAB in patients with common urologic conditions, including bladder outlet obstruction, overactive bladder syndrome and stress urinary incontinence.

  5. The Security Implications of Microdisarmament

    Science.gov (United States)

    2000-01-01

    Albania was confronted by a general uprising engendered by the collapse of a series of Ponzi -type fraud schemes . During the uprising, the arsenals of...install street lighting and enact much needed road repairs. In parallel with the scheme a major publicity campaign aimed at educating the population... THE SECURITY IMPLICATIONS OF MICRODISARMAMENT By Dr. Christopher D. Carr The Counterproliferation Papers Future Warfare Series No. 5 USAF

  6. Research findings with clinical implications.

    Science.gov (United States)

    Bjugn, Roger

    2015-05-05

    Medical and health research may yield findings that are of direct clinical significance for project participants. The Council of Europe has stated that information on such findings shall be offered to participants, and that applications to research ethics committees shall include plans for managing such findings. The purpose of the study was to investigate how the management of such findings had been described in research projects that had been granted prior approval by a regional committee for medical and health research ethics (REK). Research projects that were associated with Oslo University Hospital and had a start-up date in 2011 were identified in the database of the regional ethics committee. Copies of the application form submitted to the committee, project protocols, participant information/consent forms and letters of approval were reviewed with regard to information on the management of findings with possible clinical implications. Of the 87 projects found in the database, 70 were included in the study. Of these, 57 studies involved direct interaction with humans, whereof 45 with intended use of biological material. In 21 studies, the management of findings with possible clinical implications was described in one or more documents. In all of these projects, the applicant him-/herself had referred to this topic in the initial application. The absence of written information on the management of research findings with possible clinical implications is not in conformity with the recommendations issued by the Council of Europe. By introducing a separate item for this in the form to be submitted to the regional ethics committee for application of prior approval, this issue could be made subject to better assessment.

  7. Inflationary implications of supersymmetry breaking

    Energy Technology Data Exchange (ETDEWEB)

    Borghese, Andrea; Roest, Diederik; Zavala, Ivonne [Centre for Theoretical Physics, University of Groningen, Nijenborgh 4, 9747 AG Groningen (Netherlands)

    2013-07-23

    We discuss a general bound on the possibility to realise inflation in any minimal supergravity with F-terms. The derivation crucially depends on the sGoldstini, the scalar field directions that are singled out by spontaneous supersymmetry breaking. The resulting bound involves both slow-roll parameters and the geometry of the Kähler manifold of the chiral scalars. We analyse the inflationary implications of this bound, and in particular discuss to what extent the requirements of single field and slow-roll can both be met in F-term inflation.

  8. John Dewey: implications for schooling.

    Science.gov (United States)

    Silva, D

    1977-01-01

    Propositions, whether great and lasting or insignificant and passing, reside in the "guts of the living." Each age rediscovers its Plato, Dickens, Newton, or Dewey. Each age rewrites history, redefines science, develops its own theoretical perspectives. Propositions are tentative, conditional, or relative. They depend on contemporary priorities, and on a personal space and time context. At any future moment propositions may change, perspectives alter, new choices emerge. John Dewey provided for constructive innovation in schooling and the battles about his suggested criteria continue unabated. The purpose here, however, is only to examine some of Dewey's theoretical propositions and their probable implications (1).

  9. Networking activism: implications for Greece

    Directory of Open Access Journals (Sweden)

    Pantelis Vatikiotis

    2011-12-01

    Full Text Available The outbreak of December 2008 against police brutality through a wave of demonstrations and street protests in Athens, which was strongly advocated by protest activities and practices across the world, addresses several issues in relation to the transformative potentials of mediated collective action. The paper critically evaluates different accounts of December events, probing then into thevery networking of that movement. From this perspective, it points out another aspect of the local-global interplay in protest culture along new mediating practices (beyond the creation of transnational publics, that of the implications of transnational networking for local social activism and identification, addressing relevant questions in the Greek context.

  10. Practical implications of 'postmodern philosophy'

    Directory of Open Access Journals (Sweden)

    Savić Mile V.

    2002-01-01

    Full Text Available The article examines the implications of the discourse about postmodernity. Postmodernity is analyzed as a complex discursive figure. Within the discourse about postmodernity three levels are distinguished: the postmodern condition, postmodernism, and reflection of the postmodern condition. Special attention is paid to globalization and the problem of the enforcement of modern projects in East-European societies, particularly Serbia. These societies are termed object-societies, while their modification of modernity is called eastmodernity. The author's answer to the complexity of the postmodern condition is a conception of the politics of subsistence.

  11. Professional implications of climate change

    International Nuclear Information System (INIS)

    Boyd, J.

    2009-01-01

    'Full text:' The pundits say that we have already changed our climate by the cumulative effects of mankind's activities over the past century or so and anything we do now should be intended to reverse the process. By definition therefore we are actually engaged in an attempt to engineer a better climate for the world of the future than the one that we think faces us based on our current understanding. The presentation examines some of the implications and conflicts that this perspective brings to the evaluation of engineering projects and on ethical considerations for the profession. (author)

  12. Cosmological Implications of Electroweak Monopole

    Science.gov (United States)

    Cho, Y. M.

    2018-01-01

    In this talk we review the basic features of the electroweak monopole, and estimate the remnant electroweak monopole density of the standard model in the present universe. We show that, although the electroweak phase transition is of the first order, the monopole production comes from the thermal fluctuations of the Higgs field after the phase transition, not the vacuum bubble collisions during the phase transition. Moreover, most of the monopoles produced initially are annihilated as soon as created, and this annihilation continues very long time, longer than the muon pair annihilation time. As the result the remnant monopole density at present universe becomes very small, of 10-11 of the critical density, too small to be the dark matter. We discuss the physical implications of our results on the ongoing monopole detection experiments.

  13. MARKETING IMPLICATION IN WINE ECONOMY

    Directory of Open Access Journals (Sweden)

    Ştefan MATEI

    2014-11-01

    Full Text Available The wine, a very complex product in viticulture, has proved its tremendous importance not only to the individual but rational nutrition and increasing national income of a country cultivators (evidenced by the upward trend of the share of crop production horticulture and viticulture in the global economy agricultural. More interesting is, given the continued growth in the number of scientific publications and their quality (at least since the 1980s - where "wine" is the centerpiece of these studies - we can not but be witnessing a growing interest more to this "potion" and found that the growing popularity of wine in the science reveals the emergence of a new academic field, ie "wine economy" (or wine-economy. This study aims to make a foray into "wine economy" and to outline some of the implications of marketing in this area.

  14. Conflict management: importance and implications.

    Science.gov (United States)

    McKibben, Laurie

    2017-01-26

    Conflict is a consistent and unavoidable issue within healthcare teams. Despite training of nurse leaders and managers around areas of conflict resolution, the problem of staff relations, stress, sickness and retention remain. Conflict arises from issues with interpersonal relationships, change and poor leadership. New members of staff entering an already established healthcare team should be supported and integrated, to encourage mutual role respect between all team members and establish positive working relationships, in order to maximise patient care. This paper explores the concept of conflict, the importance of addressing causes of conflict, effective management, and the relevance of positive approaches to conflict resolution. Good leadership, nurturing positive team dynamics and communication, encourages shared problem solving and acceptance of change. Furthermore mutual respect fosters a more positive working environment for those in healthcare teams. As conflict has direct implications for patients, positive resolution is essential, to promote safe and effective delivery of care, whilst encouraging therapeutic relationships between colleagues and managers.

  15. Acculturation: implications for perinatal research.

    Science.gov (United States)

    Beck, Cheryl Tatano

    2006-01-01

    It is estimated that by 2009, Hispanics will have the highest birthrates for any minority group in the United States. Acculturation in Hispanic women of childbearing age is a critical aspect that researchers and clinicians need to consider with this population. Conceptualization and measurement issues of acculturation are addressed in this article. A framework for the complex task of acculturation research is presented. In the latter part of the article, a review of perinatal studies, in which measurement of acculturation in Hispanic women was included, is summarized for research on birthweight, breastfeeding, and postpartum depression. Implications for clinical practice with Hispanic women are hindered owing to methodological limitations of perinatal acculturation research identified in this article.

  16. "Implicate order" and the good life

    DEFF Research Database (Denmark)

    Ravn, Ib

    and explicate order which draws on compatible work in cosmology, embryogenesis, visual perception, brain memory, decision making and phenomenology. Two important characteristics of the implicate order are then identified: in an implicate order, the whole is enfolded (or represented) in each of its parts...

  17. ON THE IMPLICATIONS OF DEVELOPMENT FOR MORAL ...

    African Journals Online (AJOL)

    Dean SPGS NAU

    ON THE IMPLICATIONS OF DEVELOPMENT FOR. MORAL EDUCATION. Emmanuel Jerome Udokang* http://dx.doi.org/10.4314/og.v12i 1.12. Abstract. This paper examines the concept of development and the implication it has for moral education. While using the word “development” in its general understanding as ...

  18. Implications of deforestation and desertification on sustainable ...

    African Journals Online (AJOL)

    This paper examines the implications of deforestation and desertification in sustainable agriculture. The problems of deforestation and desertification were examined as they affect land and agricultural productivity. The socio-economic implications of deforestation and desertification in sustainable agriculture were equally ...

  19. Identification and sequence analysis of Sulfolobus solfataricus purE and purK genes

    DEFF Research Database (Denmark)

    Sørensen, Iben Schildt; Dandanell, Gert

    1997-01-01

    of the genes is expressed from an E. coli promoter they can complement the corresponding purE and purK mutations in E. coli. PurE seems to be more closely related to eubacteria than to other archaea and to eukaryotes. Also the purK gene, which has not yet been found in other archaea, is more closely related...... to eubacteria than to eukaryotes....

  20. The chaperonin of the archaeon Sulfolobus solfataricus is an RNA-binding protein that participates in ribosomal RNA processing.

    OpenAIRE

    Ruggero, D; Ciammaruconi, A; Londei, P

    1998-01-01

    The 60 kDa molecular chaperones (chaperonins) are high molecular weight protein complexes having a characteristic double-ring toroidal shape; they are thought to aid the folding of denatured or newly synthesized polypeptides. These proteins exist as two functionally similar, but distantly related families, one comprising the bacterial and organellar chaperonins and another (the so-called CCT-TRiC family) including the chaperonins of the archaea and the eukaryotes. Although some evidence exist...

  1. A new type of didhydroorotate dehydrogenase, type 1S, from the thermoacidophilic archaeon Sulfolobus solfataricus

    DEFF Research Database (Denmark)

    Sørensen, P. G.; Dandanell, Gert

    2002-01-01

    ,6-dichlorophenolindophenol (DCIP), Q0, and molecular oxygen as electron acceptor. Kinetic studies employing ferricyanide indicate a two-site ping-pong mechanism with KM values of 44.2-1.9 µM for the substrate dihydroorotate and 344-21 µM for the electron acceptor ferricyanide, as well as competitive product inhibition...

  2. A Bac Library and Paired-PCR Approach to Mapping and Completing the Genome Sequence of Sulfolobus Solfataricus P2

    DEFF Research Database (Denmark)

    She, Qunxin; Confalonieri, F.; Zivanovic, Y.

    2000-01-01

    The original strategy used in the Sulfolobus solfatnricus genome project was to sequence non overlapping, or minimally overlapping, cosmid or lambda inserts without constructing a physical map. However, after only about two thirds of the genome sequence was completed, this approach became counter...... selected for walking over small gaps and preparing template libraries for larger ones. It is concluded that an optimal strategy for sequencing microorganism genomes involves construction of a high-resolution physical map by BAC end analyses, PCR screening and paired-PCR chromosome walking after about half......-productive because there was a high sequence bias in the cosmid and lambda libraries. Therefore, a new approach was devised for linking the sequenced regions which may be generally applicable. BAC libraries were constructed and terminal sequences of the clones were determined and used for both end mapping and PCR...

  3. National and international social implications

    International Nuclear Information System (INIS)

    Zablocki, B.D.

    1980-01-01

    Every new technology since slash-and-burn has required new social institutions to go along with it, and nuclear technology is no exception. There is, therefore, a need to go beyond decisionmaking among alternative peaceful proliferation schemes. There is a need also to look at the needs for new national and/or transnational institutions that will have to accompany any proliferations in area. There are five social implications that bear on the need to develop new social institutions. First is the issue of Great Power relations, in an era of nuclear proliferation. Second is the conflict between nationalism and internationalism. The third is the issue of the military and diplomatic strategies of small nations, particularly small nations on the threshold of nuclear capacity, and the question of military versus civilian rule in those nations. Fourth, and possibly the most important is the role of multinational corporations in nuclear regulation, and fifth, the question of secrecy and how that bears on power values of primacy in democratic states

  4. Implications of increased ethanol production

    International Nuclear Information System (INIS)

    1992-06-01

    The implications of increased ethanol production in Canada, assuming a 10% market penetration of a 10% ethanol/gasoline blend, are evaluated. Issues considered in the analysis include the provision of new markets for agricultural products, environmental sustainability, energy security, contribution to global warming, potential government cost (subsidies), alternative options to ethanol, energy efficiency, impacts on soil and water of ethanol crop production, and acceptance by fuel marketers. An economic analysis confirms that ethanol production from a stand-alone plant is not economic at current energy values. However, integration of ethanol production with a feedlot lowers the break-even price of ethanol by about 35 cents/l, and even further reductions could be achieved as technology to utilize lignocellulosic feedstock is commercialized. Ethanol production could have a positive impact on farm income, increasing cash receipts to grain farmers up to $53 million. The environmental impact of ethanol production from grain would be similar to that from crop production in general. Some concerns about ethanol/gasoline blends from the fuel industry have been reduced as those blends are now becoming recommended in some automotive warranties. However, the concerns of the larger fuel distributors are a serious constraint on an expansion of ethanol use. The economics of ethanol use could be improved by extending the federal excise tax exemption now available for pure alcohol fuels to the alcohol portion of alcohol/gasoline blends. 9 refs., 10 tabs

  5. On the implications of confinement

    International Nuclear Information System (INIS)

    Roberts, C.D.

    1992-01-01

    In this paper, the authors consider some implications of confinement starting from the basic observation that cross-sections for the production of colored asymptotic states, such as free quarks and gluons, from color singlet initial states must be zero if QCD is to be confining. The authors discuss two pictures of confinement: the failure of the cluster decomposition property and the absence of a pole at timelike momenta in the propagator of a confined particle. The authors use QCD-based models as a framework to relate the failure of the cluster decomposition property to other ideas, such as the role of a nonzero gluon condensate. The authors' primary interest is to address the question of the absence of a mass pole through a study of model Schwinger-Dyson equations. These equations contain some of the dynamical information that is present in the study of the cluster decomposition property. The authors discuss the problems within this idea and its study using the Schwinger-Dyson equations

  6. Health implications of hydropower development

    International Nuclear Information System (INIS)

    Biswas, A.K.

    1982-01-01

    Hydropower development had been neglected in many countries during the past few decades, but the situation dramatically changed during the 1970s owing to the constantly increasing costs of electricity generation by fossil-fuel and nuclear power plants. Currently, hydroelectric generation accounts for approximately 23% of total global electricity supply. Much of the hydropower potential in developing countries of Africa, Asia and Latin America still remains to be exploited. Like any other source of energy, hydropower development has several health impacts. Conceptually, health implications of hydropower development can be divided into two broad categories: short-term and long-term problems. Short-term health impacts occur during the planning, construction and immediate post-construction phases, whereas long-term impacts stem from the presence of large man-made lakes, development of extensive canal systems, alteration of the ecosystem of the area, and changing socio-economic conditions. Longer-term impacts are further classified into two categories: introduction of new diseases and/or intensification of existing ones due to the improvements of the habitats of disease-carrying vectors, and health problems arising from resettlement of the people whose homes and land-holdings are inundated by the reservoirs. All these impacts are discussed in detail. Health impacts of hydropower developments have not yet been studied extensively. It is often implicitly assumed that health impacts of major dams are minor compared with other social and environmental impacts. Future studies could possibly reverse this assumption. (author)

  7. Human genomics: implications for health.

    Science.gov (United States)

    Wasi, P

    1997-01-01

    Human genome research which tries to map and sequence all the 3 billion nucleotides in the entire DNA is progressing rapidly. Completion of the human genome sequencing is expected before the year 2005. Human genes, totalling 50,000-100,000, will be identified, allowing the complete set of proteins--'the proteome' to be known. This together with genomic research in other species will lead to complete understanding of life at the molecular level and also its evolutionary history of 3,500 million years. Genomics will bring about a revolution in biology and health, because it is equivalent to having a 'Biological Periodic Table' which is a foundation for understanding life, health, disease and for deriving of new tools for diagnosis, treatment, prognosis and prevention. Human genomics will give rise to Predictive--Preventive Medicine and Precision Medicine. It will have profound social implications. Preparation for the future is needed for societies to cope with and make proper use of the tremendous changes to be brought about by genomics.

  8. Gender equality mainstreaming: Implications for poverty reduction ...

    African Journals Online (AJOL)

    Gender equality mainstreaming: Implications for poverty reduction and sustainable development in Abia State of Nigeria. ... Empowerment of women when pursued beyond mere rhetoric and instrumentation, it will improve their wellbeing, self esteem, resource allocation, political voice and increased productivity generally.

  9. Surveillance theory and its implications for law

    NARCIS (Netherlands)

    Timan, Tjerk; Galic, Masa; Koops, Bert-Jaap; Brownsword, Roger; Scotford, Eloise; Yeung, Karen

    2017-01-01

    This chapter provides an overview of key surveillance theories and their implications for law and regulation. It presents three stages of theories that characterise changes in thinking about surveillance in society and the disciplining, controlling, and entertaining functions of surveillance.

  10. Corporate Language and Implications for Organizational Learning

    DEFF Research Database (Denmark)

    Zølner, Mette

    2013-01-01

    This paper explores empirically implications of language use for MNCs’ learning from subsidiaries. Drawing on sociolinguistic literature, the article argues that while employing a single corporate language facilitates quick and direct communication of explicit knowledge, such a language design...

  11. A behaviorological thanatology: Foundations and implications

    Science.gov (United States)

    Fraley, Lawrence E.

    1998-01-01

    Foundation principles supporting a behaviorological thanatology are reviewed, including concepts of life, person, death, value, right, ethic, and body/person distinctions. These natural science foundations are contrasted with traditional foundations, and their respective implications are speculatively explored. PMID:22478293

  12. Epistemological and Treatment Implications of Nonlinear Dynamics

    Science.gov (United States)

    Stein, A. H.

    The treatment implications of understanding mind as solely epiphenomenal to nonlinearly founded neurobiology are discussed. G. Klimovsky's epistemological understanding of psychoanalysis as a science is rejected and treatment approaches integrating W. R. Bion's and D. W. Winnicott's work are supported.

  13. Implications for Forest Resource Degradation and Deforestation ...

    African Journals Online (AJOL)

    Effects of Socio-Economic Status and Food Consumption Pattern on Household Energy uses: Implications for Forest Resource Degradation and Deforestation around Wondo Genet Catchments, South-Central Ethiopia.

  14. Business ethics: implications for managed care contracts.

    Science.gov (United States)

    Stahl, D A

    1997-01-01

    Business ethics is a specialized study that emphasizes how moral standards apply to organizations, policies, procedures and behavior. Moral standards must be considered to understand the implications of business ethics in subacute care.

  15. Possible implications of exponential decay

    International Nuclear Information System (INIS)

    Steyerl, A.; Malik, S.S.

    1992-01-01

    Semiclassical concepts are developed which could make the appearance of a logarithmic nonlinearity in a Schroedinger-type equation plausible. This approach is based on the introduction of a novel wave function describing the center of mass (CM) motion of unstable particles or composite systems subject to statistical changes of their internal quantum state. The element of statistical randomness associated with a purely exponential decay law suggests the use of thermodynamic concepts like entropy and free energy. These concepts are applied only to a domain open-quotes blurredclose quotes by the quantum uncertainty principle where the problematic definition of a time and entropy operator might be possible. The paper consists of three main parts. Section 1 develops an extended nonrelativistic equation of motion. The proposed equation contains yet reinterprets the BBM equation, and for stable systems is reduced to the Schroedinger equation. Definite predictions are made for observable quantities. In Section 2, the family of localized, nonspreading ground-state solutions to the BBM equation is extended, in two and three spatial dimensions, to states classified by finite quantized angular momenta and definite values of entropy. The statistical behavior of CM systems and their electromagnetic interaction are investigated. In Section 3, implications of these concepts are outlined with emphasis on possible experimental manifestations. Suggested laboratory tests include high-precision measurements of unstable particle diffraction on linear gratings as well as neutron interferometer experiments of the type previously attempted to test the BBM equation. A further testing possibility is the investigation of particle resonances. An important feature of the present model is a subtle combination of quantum and classical aspects, achieved without compromising fundamental principles, while reinterpreting microreversibility. 46 refs., 6 figs., 4 tabs

  16. Venous chest anatomy: clinical implications

    International Nuclear Information System (INIS)

    Chasen, M.H.; Charnsangavej, C.

    1998-01-01

    This article provides a practical approach to the clinical implications and importance of understanding the collateral venous anatomy of the thorax. Routine radiography, conventional venography, computed tomography (CT), and magnetic resonance (MR) imaging studies provide correlative anatomic models for the demonstration of how interconnecting collateral vascular networks within the thorax maintain venous stability at all times. Five major systems comprise the collateral venous network of the thorax ( Fig. 1 ). These include the paravertebral, azygos-hemiazygos, internal mammary, lateral thoracic, and anterior jugular venous systems (AJVS). The five systems are presented in the following sequence: (a) a brief introduction to the importance of catheter position and malposition in understanding access to the thoracic venous system, (b) the anatomy of the azygos-hemiazygos systems and their relationship with the paravertebral plexus, (c) the importance of the AJVS, (d) 'loop' concepts interconnecting the internal mammary and azygos-hemiazygos systems by means of the lateral thoracic and intercostal veins, and (e) the interconnecting venous networks on the thoracic side of the thoracoabdominal junction. Certain aspects of the venous anatomy of the thorax will not be discussed in this chapter and include (a) the intra-abdominal anastomoses between the superior and inferior vena cavae (IVC) via the internal mammary, lateral thoracic, and azygos-hemiazygos systems (beyond the scope of this article), (b) potential collateral vessels involving vertebral, parascapular, thyroidal, thymic, and other smaller veins that might anastomose with the major systems, and (c) anatomic variants and pitfalls that may mimic pathologic conditions (space limitations). (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)

  17. The Arab Spring: Causes, Consequences, and Implications

    Science.gov (United States)

    2012-03-18

    January 16, 2011, linked from Arabic Literature (in English) Home Page, at http://arablit.wordpress.com/2011/01/16/two-translations- of-abu-al-qasim-al...The Arab Spring: Causes, Consequences, and Implications by Lieutenant Colonel El Hassane Aissa Moroccan Army...TITLE AND SUBTITLE 5a. CONTRACT NUMBER The Arab Spring: Causes, Consequences, and Implications 5b. GRANT NUMBER 5c. PROGRAM ELEMENT

  18. Vague Congruences and Quotient Lattice Implication Algebras

    Directory of Open Access Journals (Sweden)

    Xiaoyan Qin

    2014-01-01

    Full Text Available The aim of this paper is to further develop the congruence theory on lattice implication algebras. Firstly, we introduce the notions of vague similarity relations based on vague relations and vague congruence relations. Secondly, the equivalent characterizations of vague congruence relations are investigated. Thirdly, the relation between the set of vague filters and the set of vague congruences is studied. Finally, we construct a new lattice implication algebra induced by a vague congruence, and the homomorphism theorem is given.

  19. Vague Congruences and Quotient Lattice Implication Algebras

    Science.gov (United States)

    Qin, Xiaoyan; Xu, Yang

    2014-01-01

    The aim of this paper is to further develop the congruence theory on lattice implication algebras. Firstly, we introduce the notions of vague similarity relations based on vague relations and vague congruence relations. Secondly, the equivalent characterizations of vague congruence relations are investigated. Thirdly, the relation between the set of vague filters and the set of vague congruences is studied. Finally, we construct a new lattice implication algebra induced by a vague congruence, and the homomorphism theorem is given. PMID:25133207

  20. Implicational (Semilinear) Logics I: A New Hierarchy

    Czech Academy of Sciences Publication Activity Database

    Cintula, Petr; Noguera, C.

    2010-01-01

    Roč. 49, č. 4 (2010), s. 417-446 ISSN 1432-0665 R&D Projects: GA ČR GEICC/08/E018 Institutional research plan: CEZ:AV0Z10300504 Keywords : abstract algebraic logic * hierarchy of implicational logics * implicative logics * Leibniz hierarchy * linearly ordered logical matrices * mathematical fuzzy logic * non-classical logics * semilinear logics Subject RIV: BA - General Mathematics Impact factor: 0.414, year: 2010

  1. Economic and policy implications of pandemic influenza.

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Braeton J.; Starks, Shirley J.; Loose, Verne W.; Brown, Theresa Jean; Warren, Drake E.; Vargas, Vanessa N.

    2010-03-01

    Pandemic influenza has become a serious global health concern; in response, governments around the world have allocated increasing funds to containment of public health threats from this disease. Pandemic influenza is also recognized to have serious economic implications, causing illness and absence that reduces worker productivity and economic output and, through mortality, robs nations of their most valuable assets - human resources. This paper reports two studies that investigate both the short- and long-term economic implications of a pandemic flu outbreak. Policy makers can use the growing number of economic impact estimates to decide how much to spend to combat the pandemic influenza outbreaks. Experts recognize that pandemic influenza has serious global economic implications. The illness causes absenteeism, reduced worker productivity, and therefore reduced economic output. This, combined with the associated mortality rate, robs nations of valuable human resources. Policy makers can use economic impact estimates to decide how much to spend to combat the pandemic influenza outbreaks. In this paper economists examine two studies which investigate both the short- and long-term economic implications of a pandemic influenza outbreak. Resulting policy implications are also discussed. The research uses the Regional Economic Modeling, Inc. (REMI) Policy Insight + Model. This model provides a dynamic, regional, North America Industrial Classification System (NAICS) industry-structured framework for forecasting. It is supported by a population dynamics model that is well-adapted to investigating macro-economic implications of pandemic influenza, including possible demand side effects. The studies reported in this paper exercise all of these capabilities.

  2. Prime implicants in dynamic reliability analysis

    International Nuclear Information System (INIS)

    Tyrväinen, Tero

    2016-01-01

    This paper develops an improved definition of a prime implicant for the needs of dynamic reliability analysis. Reliability analyses often aim to identify minimal cut sets or prime implicants, which are minimal conditions that cause an undesired top event, such as a system's failure. Dynamic reliability analysis methods take the time-dependent behaviour of a system into account. This means that the state of a component can change in the analysed time frame and prime implicants can include the failure of a component at different time points. There can also be dynamic constraints on a component's behaviour. For example, a component can be non-repairable in the given time frame. If a non-repairable component needs to be failed at a certain time point to cause the top event, we consider that the condition that it is failed at the latest possible time point is minimal, and the condition in which it fails earlier non-minimal. The traditional definition of a prime implicant does not account for this type of time-related minimality. In this paper, a new definition is introduced and illustrated using a dynamic flowgraph methodology model. - Highlights: • A new definition of a prime implicant is developed for dynamic reliability analysis. • The new definition takes time-related minimality into account. • The new definition is needed in dynamic flowgraph methodology. • Results can be represented by a smaller number of prime implicants.

  3. Implications of the sexual revolution.

    Science.gov (United States)

    Dominian, J

    1982-06-01

    2 sexual revolutions have occurred in the last 30 years: an immense increase in knowledge of sexual matters and the accompanying expansion of providing therapy for sexual disorders; and a radical change in sexual attitudes and behavior. Discussion focuses on the ethical implications of these changes. The standards of sexual morality in this society are derived from the Judeo Christian tradition. In the beginning of Genesis there are 2 passages which are fundamental for the origin and understanding of traditional morality. In these 2 passages sexuality is first linked with establishing a man woman permanent relationship and secondly as the means of giving rise to new life. The origins of the standard Christian mortality about sex was that it was good for procreation and procreation was confined to marriage. All sexual activity before marriage and outside marriage was condemned; fornication and adultery were both wrong. This tradition of confining sex to marriage for the purpose of procreation has continued to the present when it has been widely challenged and contravened. The advent of birth control has had a pronounced effect. For the 1st time sexual intercourse and procreation are totally and effectively separated. As a result sexual activity in previously forbidden situations is now rampant. There exists an extensive preoccupation with sex. Many lavish praise on love making, yet it all depends on what is meant by lovemaking. There are at least 3 ways of understanding lovemaking: solitary sex; transient sex between a couple; and sexual intercourse within marriage. There are single people who extol solitary sex, people who insist that they do not need other people in their life. Masturbation has a place in the life of adolescents and may reassert itself when men and women are separated, but the pleasure of mutual involvement is so much greater that masturbation readily yields to heterosexual activity in the majority of cases and homosexual activity in a small

  4. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

  5. Risk Implications of Energy Policy Instruments

    DEFF Research Database (Denmark)

    Kitzing, Lena

    papers and a working paper), based on a combination of micro-economic and policy analysis. Financial theory is used for the quantitative analysis of investment problems under uncertainty, including mean-variance portfolio theory, real option analysis, Monte Carlo simulations and time series analysis...... show, both qualitatively and quantitatively, that policy makers cannot neglect risk implications when designing RES support instruments without compromising either on effectiveness or cost-efficiency of energy policy. The central research questions are: how can risk implications of RES policy...... instruments be integrated into policy design, so that the policies provide adequate investment incentives? And can the consideration of such risk implications in policy design make overall energy policy more successful? These questions are answered in seven research papers (four journal papers, two conference...

  6. The economic implications of carbon cycle uncertainty

    International Nuclear Information System (INIS)

    Smith, Steven J.; Edmonds, James A.

    2006-01-01

    This paper examines the implications of uncertainty in the carbon cycle for the cost of stabilizing carbon dioxide concentrations. Using a state of the art integrated assessment model, we find that uncertainty in our understanding of the carbon cycle has significant implications for the costs of a climate stabilization policy, with cost differences denominated in trillions of dollars. Uncertainty in the carbon cycle is equivalent to a change in concentration target of up to 100 ppmv. The impact of carbon cycle uncertainties are smaller than those for climate sensitivity, and broadly comparable to the effect of uncertainty in technology availability

  7. Assisted Reproductive Technologies : Implications for Women's ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Assisted Reproductive Technologies : Implications for Women's Reproductive Rights and Social Citizenship. There is a general perception that assisted reproductive technologies (ARTs) affect only a small number of affluent women in India. However, the ART industry - tied as it is to the vigorously pushed medical tourism ...

  8. Population growth: Implications for environmental sustainability ...

    African Journals Online (AJOL)

    The impact of population growth on environment and its implication for survival is an important issue. Although considerable attention has been paid to this problem but systematic studies have been inadequate. Rapid population growth and economic development and daily demand for natural resources for domestic and ...

  9. Alternative Families and Children: Implications for Education.

    Science.gov (United States)

    Alexander, Jannette; Eiduson, Bernice T.

    1980-01-01

    Since 1973, the UCLA Family Styles Project has studied a sample of nontraditional Caucasian families (single mothers, social contract families, communal families) plus a comparison group of conventional nuclear families. Findings are reported on parents' personal/social values and changes in childrearing practices. Implications for education are…

  10. Understanding predation: implications toward forest management

    Science.gov (United States)

    Harvey R. Smith

    1991-01-01

    It is generally accepted that when gypsy moths rest in the litter survival is low due to predation by ground-foraging generalist predators and that predation can maintain these populations indefinitely. Forest Service research on predators of gypsy moth continues to focus on population dynamics, the mechanisms of predation and forest management implications.

  11. Professional Counselling as Development: Implications for Training.

    Science.gov (United States)

    Rigazio-DiGillio, Sandra; Ivey, Allen E.

    1994-01-01

    Derived from a committee report prepared for the American Mental Health Counselor's Association, a new definition of professional counseling is presented. Generated from a developmental lifespan foundation, special attention is given to multicultural issues, a broad array of services, and a network approach to service delivery. Implications of…

  12. Fertigation with domestic wastewater: Uses and implications

    African Journals Online (AJOL)

    Jose Geraldo

    2016-05-18

    May 18, 2016 ... http://www.academicjournals.org/AJB. African Journal of Biotechnology. Review. Fertigation with domestic wastewater: Uses and implications. José Geraldo ... human health and environmental impact (Batstone et al.,. 2015). Proper ...... Revista Brasileira de Engenharia Agrícola e Ambiental. 16:200-208.

  13. EDITORIAL Methodological Implications of Longitudinal Studies in ...

    African Journals Online (AJOL)

    user

    EDITORIAL. Methodological Implications of Longitudinal Studies in Public. Health Research: Examples from Jimma Longitudinal Family. Survey of Youth. Tefera Belachew1. State of the ... security, nutrition, reproductive health, mental health, life ... of risky adolescent sexual behaviour and perceived access to condoms than.

  14. Spatial planning, infrastructure and implementation: Implications for ...

    African Journals Online (AJOL)

    Spatial planning, infrastructure and implementation: Implications for planning school curricula. ... Town and Regional Planning ... A matrix of knowledge and skills is produced, and the way these fields of study have been taken up in the undergraduate/honours planning programme at the University of the Witwatersrand is ...

  15. Spatial planning, infrastructure and implementation: Implications for ...

    African Journals Online (AJOL)

    and their spatial implications, to socio-political, governance and institutional dimensions, such as the ..... is a mere 3% compliance level, with only. 32 out of ...... tools. 3 IDP. 4 IPP. 2 Land management. 3 Regional Planning –. Integrated planning. Spatial Frameworks. Land use systems, infrastructure management. Regional ...

  16. Mainstreaming academic literacy teaching: Implications for how ...

    African Journals Online (AJOL)

    This article draws on research into the role of academic literacies within a range of disciplines and its implications for academic literacy teaching in Higher Education. The study explored ways of transforming current academic literacy teaching practices with a view to developing better synergy between the academic ...

  17. Cultural Implications of Human Resource Development.

    Science.gov (United States)

    Hiranpruk, Chaiskran

    A discussion of the cultural effects of economic and, by extension, human resource development in Southeast Asia looks at short- and long-term implications. It is suggested that in the short term, increased competition will affect distribution of wealth, which can promote materialism and corruption. The introduction of labor-saving technology may…

  18. Implications of Telecommuting in a Library Environment.

    Science.gov (United States)

    Meglio, Delores

    1991-01-01

    Discussion of telecommuting possibilities focuses on a program at Information Access Company that allows indexers and abstractors to work at home. Employer and employee expectations are discussed, equipment provisions are described, employee benefits are examined, and implications for the library environment are suggested. (LRW)

  19. AND THEIR IMPLICATIONS TO MANTLE DYNAMICS

    African Journals Online (AJOL)

    ... the southwest Indian ridge appears to be tapping the same portion of mantle as did the Central Indian ridge. These results have important thermo-chemical implications, such as variations in the extent of melting and mineralogicalcomposition of the mantle beneath diflerent ridges, which may influence mantle dynamics.

  20. Early reionization and its cosmological implications

    Indian Academy of Sciences (India)

    E-mail: kaplinghat@ucdavis.edu. Abstract. We discuss how future CMB polarization measurements will provide detailed information about the reionization history and the implications of early reionization for cosmology. Keywords. Cosmology; reionization; inflation. PACS Nos 98.80.Bp; 98.80.Cq; 98.80.Es. 1. Introduction.

  1. Wood Flour Moulding Technology: Implications for Technical ...

    African Journals Online (AJOL)

    User

    2011-04-19

    Apr 19, 2011 ... selected dry wood by grinding. Interest in this modern industrial practice in wood anchors ... flour moulding technology minimizes atmospheric pollution, reduces cost of wood waste disposal and curbs, ... Zhang and Wolcott,. 2007). Wood Flour Moulding Technology: Implications for Technical Education ...

  2. Wood Flour Moulding Technology: Implications for Technical ...

    African Journals Online (AJOL)

    Wood Flour Moulding Technology: Implications for Technical Education in Nigeria. ... Interest in this modern industrial practice in wood anchors around the high level of unemployment among the youths in. Nigeria. ... flour moulding technology minimizes atmospheric pollution, reduces cost of wood waste disposal and curbs, ...

  3. Constructivism and Education: Misunderstandings and Pedagogical Implications

    Science.gov (United States)

    Hyslop-Margison, Emery J.; Strobel, Johannes

    2008-01-01

    Constructivism is a popular concept in contemporary teacher education programs. However, a genuine concern arises with the concept's application because many teachers and teacher educators claim that knowledge is constructed, without appreciating the epistemological and pedagogical implications such a claim entails. This article employs Phillips'…

  4. Globalisation; Its Implications and Consequences for Developing ...

    African Journals Online (AJOL)

    This paper attempts to look at the concept of globalisations and analyse its implications and consequences for developing nations in Africa. It is premised on the general perception that globalisations is a positive and powerful force for the improved material well-being of humankind, that would aid the developing countries ...

  5. Reconfiguration on nanocrossbar using material implication

    Indian Academy of Sciences (India)

    ... a new nonvolatile memory element, can be usedto overcome these limitations. In this paper, we propose an implication-NOR logic-gate-based FPGA architecture using memristors for implementation of logic functions and with embedded memory for storing data. The automation algorithm for the same is presented.

  6. Corporal Punishment: Legalities, Realities, and Implications.

    Science.gov (United States)

    Hinchey, Patricia H.

    2003-01-01

    Presents a quiz that will help readers determine the reliability of their own perceptions relating to corporal punishment in schools. Discusses U.S. Courts and corporal punishment, worldwide and nationwide legality, and the realities of corporal punishment in the United States. Discusses implications for what teachers can do to address corporal…

  7. Alcohol-pentazocine combination: implication on the ...

    African Journals Online (AJOL)

    Alcohol-pentazocine combination: implication on the cytoarchitectural profile of the medial prefrontal cortex and cerebellum of juvenile male rats. D.A. Adekomi, O.S. Adewole, B.J. Dare, O.O. Olaniyan, R.M. Ojebisi, M.S. Ajao ...

  8. Implications of Risk Management Practices on Financial ...

    African Journals Online (AJOL)

    This study focuses on the implications of risk management practices on financial performance of sugar firms in Kenya. The respondents were functional heads of the companies under the survey. We used exploratory design using survey research methodology that included structuredquestionnaires and interviews. Pearson ...

  9. Environmental conflicts: Key issues and management implications ...

    African Journals Online (AJOL)

    Environmental crises and problems throughout the world are widespread and increasing rapidly. In relation to these concerns, the article discusses the following aspects: people and the environment, environmental conflicts, climate change and environmental conflicts, and management implications. The section on people ...

  10. Particle physics implications of Wilkinson microwave anisotropy ...

    Indian Academy of Sciences (India)

    microwave anisotropy project measurements. U A YAJNIK. Indian Institute of Technology Bombay, Mumbai 400 076, India. E-mail: yajnik@phy.iitb.ac.in. Abstract. We present an overview of the implications of the WMAP data for particle physics. The standard parameter set ϵ, η and ξ characterising the inflaton potential can.

  11. Paradigm Shift In Career Counselling: Implications For ...

    African Journals Online (AJOL)

    However, many of the respondents were aware of the need for a new approach to career counselling. The implication of this finding to entrepreneurship development is the need to adopt a paradigm shift in career counselling. Retraining of practicing counsellors and new training guides for student counsellors as well as the ...

  12. Nonstandard Employment Relations and Implications for Decent ...

    African Journals Online (AJOL)

    gold

    2012-07-26

    Jul 26, 2012 ... (ILO) decent work agenda are rarely investigated by the industrial and work sociologists. Conceptualizing ... prerequisite skills to hold full time jobs with varying implications for decent work deficits (ILO, 2005). ..... Job Satisfaction among Contract Workers in Intercontinental and First Banks in Ibadan, Nigeria, ...

  13. Tour Guiding Research Insights, Issues and Implications

    DEFF Research Database (Denmark)

    Meged, Jane Widtfeldt

    2017-01-01

    The book Tour guiding research – insights, issues and implications by Betty Weiler and Rosemary Black is a most welcome contribution to the specific research field of guided tours within tourism studies. It sets forth to “give an authoritative state-of-art review of the scholarly literature on tour...

  14. Computer forensics investigation; implications for improved cyber ...

    African Journals Online (AJOL)

    Computer forensics investigation is relatively new in Nigeria but promises to serve as a watch dog in curbing and checkmating cyber-crimes and ensuring cyber security. This paper aimed at examining the concepts of cyber-crime, cyber security and the implications of computer forensics investigation on cyber security in ...

  15. Mycobacterial Species Identification and Public Health Implications ...

    African Journals Online (AJOL)

    Mycobacterial Species Identification and Public Health Implications of Tuberculosis Among Nomadic Pastoralists in Three Local Governments of Plateau State, North ... Bovine and human tuberculosis is endemic in Nigeria, and apart from meat inspection at the abattoir, which is not very effective, no control measures are ...

  16. Environmental conflicts: Key issues and management implications

    African Journals Online (AJOL)

    Environmental conflicts: Key issues and management implications. 15 or not managed, conflicts are likely to escalate and intensify. White et al. (2009:244) state: 'What distinguishes conflicts from mere disagreement is thus a behavioural expression of formerly latent attitudes where one party is perceived to take action at the ...

  17. Cult Affiliation and Disaffiliation: Implications for Counseling.

    Science.gov (United States)

    Robinson, Beth; Frye, Ellen M.; Bradley, Loretta J.

    1997-01-01

    Data on cult membership and the characteristics of cults are provided. The process of cult affiliation and its relationship to family dynamics are reviewed. Defection, the processes of disaffiliation (voluntary and involuntary), and clinical symptoms after cult disaffiliation are discussed. Implications and recommendations for counselors are…

  18. The nuclear and its psychological implications

    International Nuclear Information System (INIS)

    Blanc, D.

    2001-01-01

    From the 13. to 15. january 1977, the S.F.R.P. has organised at Paris, with the patronage of The National Institute of Health and Medical Research, the French Society of Radiology, a colloquium devoted to the nuclear and its psycho-implications sociological. It is a second edition, realised at the demand of the Antoine Beclere Center. (N.C.)

  19. Neurotoxin Exposure and MMPI Forensic Implications.

    Science.gov (United States)

    Storm, Heidi A.

    The Minnesota Multiphasic Personality Inventory (MMPI) has been widely used as an objective personality test, in addition to being used in forensic assessments, especially involving claims of physical or emotional damage. It now appears that questions must be raised concerning the MMPI's forensic implications given the advent of new disease…

  20. Insecurity and national economic development implications for ...

    African Journals Online (AJOL)

    Insecurity and national economic development implications for Nigeria's vision 20: 2020. ... International Journal of Development and Management Review ... These social menace trigger off a worrisome sense of insecurity that challenge Nigeria's efforts towards national economic development and consequently its vision ...

  1. The epidemiological implications of cockroaches ( Periplaneta ...

    African Journals Online (AJOL)

    The epidemiological implications of cockroaches ( Periplaneta americana ) in the dissemination of human diseases in Owerri, south-east, Nigeria. ... Overall, 14 parasites were recovered which included helminthes, protozoa and acanthocephalans. One hundred and thirty (65.0%) of 200 cockroaches examined were ...

  2. Proof complexity of intuitionistic implicational formulas

    Czech Academy of Sciences Publication Activity Database

    Jeřábek, Emil

    2017-01-01

    Roč. 168, č. 1 (2017), s. 150-190 ISSN 0168-0072 EU Projects: European Commission(XE) 339691 - FEALORA Institutional support: RVO:67985840 Keywords : proof complexity * intuitionistic logic * implicational fragment Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.647, year: 2016 http://www. sciencedirect .com/science/article/pii/S0168007216301154

  3. Ritalin Update: Implications for Reading Teachers.

    Science.gov (United States)

    Cotter, Robert B., Jr.; Werner, Patrice Holden

    1987-01-01

    Investigates how Ritalin, a powerful stimulant drug frequently prescribed for children exhibiting hyperactive behavior, poor attention span, and/or distractibility, is prescribed for children in educational settings, what doses seem appropriate, and what effect Ritalin has on reading achievement. Discusses the implications of Ritalin research for…

  4. Climate Change: Generic Implications for Agriculture

    Indian Academy of Sciences (India)

    First page Back Continue Last page Overview Graphics. Climate Change: Generic Implications for Agriculture. Increasing carbon dioxide: Good for most crops. Increase in mean temperature: orter crop durations, higher evapotranspiration, other effects on growth and yield. Intermittent periods of extreme heat stress: highly ...

  5. Ethical Implications of Digital Imaging in Photojournalism.

    Science.gov (United States)

    Terry, Danal; Lasorsa, Dominic L.

    Arguing that the news media are about to adopt digital imaging systems that will have far-reaching implications for the practice of journalism, this paper discusses how the news media is expected to adopt the new technology and explains why the marriage of journalism and digital imaging will create ethical issues with respect to photo manipulation…

  6. Clinical Implications Of Childhood Bilingualism | Southwood ...

    African Journals Online (AJOL)

    Stellenbosch Papers in Linguistics Plus. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 32 (2003) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register. Clinical Implications Of Childhood Bilingualism.

  7. Genetic Counseling: Ethical and Professional Role Implications.

    Science.gov (United States)

    Witmer, J. Melvin; And Others

    1986-01-01

    Genetic counseling assists people in identifying potential or manifest genetic problems, understanding their implications, making decisions about what course to follow, and working through psychological and social aspects as they affect individuals or couples. Four ethical principles and related ethical issues pertaining to autonomy, beneficence…

  8. Genetic Counseling: Implications for Community Counselors.

    Science.gov (United States)

    Bodenhorn, Nancy; Lawson, Gerard

    2003-01-01

    Special issue of the "Journal of Health Psychology" (Vol. 7, No. 2, 2002) was reviewed. Articles covered a variety of qualitative studies conducted using an interpretive phenomenological analysis method to examine the interviews with people who had received genetic testing and counseling. Implications for the broader counseling field…

  9. Teacher's Experiences in PBL: Implications for Practice

    Science.gov (United States)

    Alves, Anabela C.; Sousa, Rui M.; Fernandes, Sandra; Cardoso, Elisabete; Carvalho, Maria Alice; Figueiredo, Jorge; Pereira, Rui M. S.

    2016-01-01

    Project-Based Learning (PBL) has been implemented in the first year of the Industrial Engineering and Management programme at the University of Minho, Portugal, since 2004/2005. The purpose of this paper is to analyse and discuss teachers' experiences in PBL in this programme and to explore its implications for student learning and for teaching…

  10. EDITORIAL Methodological Implications of Longitudinal Studies in ...

    African Journals Online (AJOL)

    user

    State of the art public health evidence is a critical element for health policy and program development. The implication and level of use of the evidence for policy ... generated and communicated to key stakeholders including the general community. Multi-disciplinary and trans disciplinary long term follow studies, randomised ...

  11. Psychiatric disorders and general medical conditions: implications ...

    African Journals Online (AJOL)

    Psychiatric disorders and general medical conditions: implications for the clinician. ... Patients with severe mental illness have higher than expected prevalence rates of co-morbid general medical conditions, particularly metabolic and cardiovascular disease. They are ... planning of treatment for either group of disorders.

  12. First Planck results and cosmological implications

    CERN Multimedia

    CERN. Geneva

    2013-01-01

    The Planck satellite has measured CMB anisotropies over the full sky with unprecedented sensitivity. The collaboration has released its first CMB temperature maps and cosmological analysis on the 21st of March. I will present a summary of these new CMB results, focusing mainly on their implications for our understanding of the Universe.

  13. Environmental Implications of Nanotechnology—An Update

    OpenAIRE

    Stander, Leo; Theodore, Louis

    2011-01-01

    Some engineers and scientists are either directly or indirectly involved with nanotechnology issues. Nanotechnology concerns dealing with environmental implications and regulatory compliance encompass practicing areas for these technical individuals. Areas of particular concern include current/proposed environmental regulations and procedures for quantifying both health risks and hazard risks. This article addresses both of these issues.

  14. Environmental Implications of Nanotechnology—An Update

    Science.gov (United States)

    Stander, Leo; Theodore, Louis

    2011-01-01

    Some engineers and scientists are either directly or indirectly involved with nanotechnology issues. Nanotechnology concerns dealing with environmental implications and regulatory compliance encompass practicing areas for these technical individuals. Areas of particular concern include current/proposed environmental regulations and procedures for quantifying both health risks and hazard risks. This article addresses both of these issues. PMID:21556197

  15. Environmental implications of nanotechnology--an update.

    Science.gov (United States)

    Stander, Leo; Theodore, Louis

    2011-02-01

    Some engineers and scientists are either directly or indirectly involved with nanotechnology issues. Nanotechnology concerns dealing with environmental implications and regulatory compliance encompass practicing areas for these technical individuals. Areas of particular concern include current/proposed environmental regulations and procedures for quantifying both health risks and hazard risks. This article addresses both of these issues.

  16. Current Trends In Educational Technology: Implication On ...

    African Journals Online (AJOL)

    This paper presents the current trends in educational technology and the implication on educational managers in Nigeria. The current trends in the field of educational technology are centred on the influence of information and communication technology on the development of educational management. Various challenges ...

  17. Early Adolescent Childbearing: Some Social Implications.

    Science.gov (United States)

    Hoeppner, Marie

    This paper reviews some of the current research findings on fertility among adolescents which indicate that illegitimacy may be becoming increasingly concentrated in the teenage years, and considers the implications of this phenomenon for mothers, children and society. The relationship of the changing sexual activity of American teenagers, the…

  18. Proof complexity of intuitionistic implicational formulas

    Czech Academy of Sciences Publication Activity Database

    Jeřábek, Emil

    2017-01-01

    Roč. 168, č. 1 (2017), s. 150-190 ISSN 0168-0072 EU Projects: European Commission(XE) 339691 - FEALORA Institutional support: RVO:67985840 Keywords : proof complexity * intuitionistic logic * implicational fragment Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.647, year: 2016 http://www.sciencedirect.com/science/article/pii/S0168007216301154

  19. Transnational Education: Current Developments and Policy Implications

    Science.gov (United States)

    Gu, Jianxin

    2009-01-01

    Ever since the transnational education trend took off since the 1980s, transnational education has come to bearing political, economic and cultural implications. Different approaches have been formulated to achieve specific policy objectives by both importing and exporting countries. Such approaches demonstrate a four dimensional composition,…

  20. Exploring health implications associated with irregular migration ...

    African Journals Online (AJOL)

    Although there have been several negative media reports on the plight of irregular migrants from Ghana, research on issues related to their health has been rather scanty. The study assesses health implications associated with irregular migration from Ghana using both the Techiman and Nkoranza Municipalities as a case ...

  1. Particle physics implications of Wilkinson microwave anisotropy ...

    Indian Academy of Sciences (India)

    ... Journals; Pramana – Journal of Physics; Volume 63; Issue 6. Particle physics implications of Wilkinson microwave anisotropy project measurements. U A Yajnik. Volume 63 Issue 6 December 2004 pp 1317-1330 ... Keywords. Cosmic microwave background radiation; inflation; Wilkinson microwave anisotropy project.

  2. The pedagogical implications of information and communication ...

    African Journals Online (AJOL)

    This research work therefore seeks to find out the pedagogical implication of Information and Communication Technology (ICT) on Adult Education in Osun State College of Education, Nigeria. One hundred (100) lecturers and one hundred (100) students of Osun State College of Education were used for the study.

  3. Proof-graphs for Minimal Implicational Logic

    Directory of Open Access Journals (Sweden)

    Marcela Quispe-Cruz

    2014-03-01

    Full Text Available It is well-known that the size of propositional classical proofs can be huge. Proof theoretical studies discovered exponential gaps between normal or cut free proofs and their respective non-normal proofs. The aim of this work is to study how to reduce the weight of propositional deductions. We present the formalism of proof-graphs for purely implicational logic, which are graphs of a specific shape that are intended to capture the logical structure of a deduction. The advantage of this formalism is that formulas can be shared in the reduced proof. In the present paper we give a precise definition of proof-graphs for the minimal implicational logic, together with a normalization procedure for these proof-graphs. In contrast to standard tree-like formalisms, our normalization does not increase the number of nodes, when applied to the corresponding minimal proof-graph representations.

  4. Public health implications of altered puberty timing

    DEFF Research Database (Denmark)

    Golub, M.S.; Collman, G.W.; Foster, P.M.

    2008-01-01

    Changes in puberty timing have implications for the treatment of individual children, for the risk of later adult disease, and for chemical testing and risk assessment for the population. Children with early puberty are at a risk for accelerated skeletal maturation and short adult height, early...... sexual debut, potential sexual abuse, and psychosocial difficulties. Altered puberty timing is also of concern for the development of reproductive tract cancers later in life. For example, an early age of menarche is a risk factor for breast cancer. A low age at male puberty is associated....... Altered timing of puberty also has implications for behavioral disorders. For example, an early maturation is associated with a greater incidence of conduct and behavior disorders during adolescence. Finally, altered puberty timing is considered an adverse effect in reproductive toxicity risk assessment...

  5. Climate Change and Interacting Stressors: Implications for ...

    Science.gov (United States)

    EPA announced the release of the final document, Climate Change and Interacting Stressors: Implications for Coral Reef Management in American Samoa. This report provides a synthesis of information on the interactive effects of climate change and other stressors on the reefs of American Samoa as well as an assessment of potential management responses. This report provides the coral reef managers of American Samoa, as well as other coral reef managers in the Pacific region, with some management options to help enhance the capacity of local coral reefs to resist the negative effects of climate change. This report was designed to take advantage of diverse research and monitoring efforts that are ongoing in American Samoa to: analyze and compile the results of multiple research projects that focus on understanding climate-related stressors and their effects on coral reef ecosystem degradation and recovery; and assess implications for coral reef managment of the combined information, including possible response options.

  6. Chinese Cultural Implications for ERP Implementation

    Directory of Open Access Journals (Sweden)

    Mukesh Srivastava

    2009-05-01

    Full Text Available Implementation of an enterprise resource planning (ERP system in a global environment can be fragmented due to the internal enterprise culture, which is representative of societal culture. In China, this is especially true due to the nationalistic culture of business. The way ERP systems are perceived, treated, and integrated within the business plays a critical role in the success or failure of the implementation. When a Western developed ERP system is implemented in a country where the culture differs greatly from that of the developer, implementation may require localization in order to be successful. In doing so, strategic benefits of ERP systems may be diminished. This research paper looks into the characteristics of Chinese localization by Western vendors and the implications to the Chinese enterprise. Keywords: ERP, Chinese Cultural Implications, Societal Culture, Strategy

  7. Mirror neurons: their implications for group psychotherapy.

    Science.gov (United States)

    Schermer, Victor L

    2010-10-01

    Recently discovered mirror neurons in the motor cortex of the brain register the actions and intentions of both the organism and others in the environment. As such, they may play a significant role in social behavior and groups. This paper considers the potential implications of mirror neurons and related neural networks for group therapists, proposing that mirror neurons and mirror systems provide "hard-wired" support for the group therapist's belief in the centrality of relationships in the treatment process and exploring their value in accounting for group-as-a-whole phenomena. Mirror neurons further confirm the holistic, social nature of perception, action, and intention as distinct from a stimulus-response behaviorism. The implications of mirror neurons and mirroring processes for the group therapist role, interventions, and training are also discussed.

  8. Cognitive Reserve: Implications for Assessment and Intervention

    Science.gov (United States)

    Stern, Yaakov

    2014-01-01

    The concept of reserve is used to explain the observation that some individuals function better than others in the presence of brain pathology. This paper reviews the concept of reserve from its theoretical basis to the implication of reserve for clinical practice. A distinction between brain reserve, referring to individual differences in the anatomic substrate, and cognitive reserve, referring to differences in the flexibility or adaptivity of cognitive networks, is useful. Epidemiologic evidence indicates that a set of life exposures including higher educational and occupational attainment, and engaging in leisure activities is associated with a lower risk of incident dementia, suggesting that these life exposures may enhance cognitive reserve. This provides a basis for controlled clinical studies can test specific exposures that may enhance reserve. The concept of cognitive reserve also has important implications for clinical practice in terms of diagnosis and prognosis. PMID:23941972

  9. Public health implications of altered puberty timing

    DEFF Research Database (Denmark)

    Golub, M.S.; Collman, G.W.; Foster, P.M.

    2008-01-01

    sexual debut, potential sexual abuse, and psychosocial difficulties. Altered puberty timing is also of concern for the development of reproductive tract cancers later in life. For example, an early age of menarche is a risk factor for breast cancer. A low age at male puberty is associated....... Altered timing of puberty also has implications for behavioral disorders. For example, an early maturation is associated with a greater incidence of conduct and behavior disorders during adolescence. Finally, altered puberty timing is considered an adverse effect in reproductive toxicity risk assessment......Changes in puberty timing have implications for the treatment of individual children, for the risk of later adult disease, and for chemical testing and risk assessment for the population. Children with early puberty are at a risk for accelerated skeletal maturation and short adult height, early...

  10. Teacher's experiences in PBL: implications for practice

    Science.gov (United States)

    Alves, Anabela C.; Sousa, Rui M.; Fernandes, Sandra; Cardoso, Elisabete; Carvalho, Maria Alice; Figueiredo, Jorge; Pereira, Rui M. S.

    2016-03-01

    Project-Based Learning (PBL) has been implemented in the first year of the Industrial Engineering and Management programme at the University of Minho, Portugal, since 2004/2005. The purpose of this paper is to analyse and discuss teachers' experiences in PBL in this programme and to explore its implications for student learning and for teaching practices in higher education. For data collection, the research method used was written narratives to these teachers, at the end of the PBL semester. Findings suggest that teachers express a positive view of PBL as a learning approach. They identify student motivation and engagement, along with a better understanding of the application of concepts in real-life situations, as important outcomes of the project for students. Besides this, teachers also highlight the importance of the development of transversal skills by students throughout the project. Recommendations for future work and implications for practice will also be discussed.

  11. Inferring Genetic Ancestry: Opportunities, Challenges, and Implications

    OpenAIRE

    Royal, Charmaine D.; Novembre, John; Fullerton, Stephanie M.; Goldstein, David B.; Long, Jeffrey C.; Bamshad, Michael J.; Clark, Andrew G.

    2010-01-01

    Increasing public interest in direct-to-consumer (DTC) genetic ancestry testing has been accompanied by growing concern about issues ranging from the personal and societal implications of the testing to the scientific validity of ancestry inference. The very concept of “ancestry” is subject to misunderstanding in both the general and scientific communities. What do we mean by ancestry? How exactly is ancestry measured? How far back can such ancestry be defined and by which genetic tools? How ...

  12. High Power Laser Weapons and Operational Implications

    OpenAIRE

    Roso, Nelson Alex; Moreira, Romero da Costa; Oliveira, José Edimar Barbosa

    2014-01-01

    ABSTRACT: The operational implications of high power laser weapons are constantly growing in countries with advanced military technological level. As well as on progress in integration with air, land and naval platforms, this paper discusses the necessary development and implementation of the operational concepts into Armed Forces, which should target orientation in the improvement process of the appropriate warfare material, i.e. the laser, as well as remodeling the existing combat's doctrin...

  13. Civil implications of commercial nuclear power

    International Nuclear Information System (INIS)

    Wilkinson, P.; Gallie, N.

    1985-01-01

    The following aspects are discussed; spent fuel transport by rail, routes and possible accidents; reactors, possible accidents and effects of radioactive releases to the environment; possible effects of sabotage and terrorist attacks; possible hazards from fuel reprocessing plants; radioactive wastes, inventories and possible effects of escape to environment; biological radiation effects; civil war effects and democratic freedoms; the miners' strike and its implications. (U.K.)

  14. Molecular heterogeneity in glioblastoma: potential clinical implications

    Directory of Open Access Journals (Sweden)

    Nicole Renee Parker

    2015-03-01

    Full Text Available Glioblastomas, (grade 4 astrocytomas, are aggressive primary brain tumors characterized by histopathological heterogeneity. High resolution sequencing technologies have shown that these tumors also feature significant inter-tumoral molecular heterogeneity. Molecular subtyping of these tumors has revealed several predictive and prognostic biomarkers. However, intra-tumoral heterogeneity may undermine the use of single biopsy analysis for determining tumor genotype and has implications for potential targeted therapies. The clinical relevance and theories of tumoral molecular heterogeneity in glioblastoma are discussed.

  15. Cognitive Reserve: Implications for Assessment and Intervention

    OpenAIRE

    Stern, Yaakov

    2013-01-01

    The concept of reserve is used to explain the observation that some individuals function better than others in the presence of brain pathology. This paper reviews the concept of reserve from its theoretical basis to the implication of reserve for clinical practice. A distinction between brain reserve, referring to individual differences in the anatomic substrate, and cognitive reserve, referring to differences in the flexibility or adaptivity of cognitive networks, is useful. Epidemiologic ev...

  16. Breast cancer heterogeneity: mechanisms, proofs, and implications

    Directory of Open Access Journals (Sweden)

    Yi-Hsuan Hsiao, Ming-Chih Chou, Carol Fowler, Jeffrey T. Mason, Yan-gao Man

    2010-01-01

    Full Text Available Human breast cancer represents a group of highly heterogeneous lesions consisting of about 20 morphologically distinct subtypes with substantially different molecular and/or biochemical signatures, clinical courses, and prognoses. This study analyzed the possible correlation between the morphological presentations of breast cancer and two hypothesized models of carcinogenesis, in order to identify the intrinsic mechanism(s and clinical implications of breast cancer heterogeneity.

  17. Breast cancer heterogeneity: mechanisms, proofs, and implications

    OpenAIRE

    Hsiao, Yi-Hsuan; Chou, Ming-Chih; Fowler, Carol; Mason, Jeffrey T.; Man, Yan-gao

    2010-01-01

    Human breast cancer represents a group of highly heterogeneous lesions consisting of about 20 morphologically distinct subtypes with substantially different molecular and/or biochemical signatures, clinical courses, and prognoses. This study analyzed the possible correlation between the morphological presentations of breast cancer and two hypothesized models of carcinogenesis, in order to identify the intrinsic mechanism(s) and clinical implications of breast cancer heterogeneity.

  18. Piaget's Theory and Its Educational Implications

    OpenAIRE

    Atay, Mesude

    1998-01-01

    In this work, an attempt is made to assess Piaget’s theory and its educational implications. A review of the assess literature reveals a number of arguments against Piagetian approaches in the field of education. It is, however, accepted that Piaget’s theory has many positive effects on educational programmes. The suggestion that Piaget’s theory is “bleakly negative" in education can only provoke Piagetian researchers to investigate and display other workable and much more beneficial aspects ...

  19. 2014 and beyond: implications for displacement

    Directory of Open Access Journals (Sweden)

    Aidan O’Leary

    2014-05-01

    Full Text Available 2014 marks a watershed for Afghanistan, with the withdrawal of the International Security Assistance Force after twelve years, and the very real risks this withdrawal poses to the capacity of the Afghan state to meet the many internal and external challenges faced by the country. These challenges have significant implications for displaced and returning Afghans and for the potential for displacement in the future.

  20. Physician-Rating Web Sites: Ethical Implications.

    Science.gov (United States)

    Samora, Julie Balch; Lifchez, Scott D; Blazar, Philip E

    2016-01-01

    To understand the ethical and professional implications of physician behavior changes secondary to online physician-rating Web sites (PRWs). The American Society for Surgery of the Hand (ASSH) Ethics and Professionalism Committee surveyed the ASSH membership regarding PRWs. We sent a 14-item questionnaire to 2,664 active ASSH members who practice in both private and academic settings in the United States. We received 312 responses, a 12% response incidence. More than 65% of the respondents had a slightly or highly unfavorable impression of these Web sites. Only 34% of respondents had ever updated or created a profile for PRWs, although 62% had observed inaccuracies in their profile. Almost 90% of respondents had not made any changes in their practice owing to comments or reviews. One-third of respondents had solicited favorable reviews from patients, and 3% of respondents have paid to improve their ratings. PRWs are going to become more prevalent, and more research is needed to fully understand the implications. There are several ethical implications that PRWs pose to practicing physicians. We contend that it is morally unsound to pay for good reviews. The recourse for physicians when an inaccurate and potentially libelous review has been written is unclear. Some physicians have required patients to sign a waiver preventing them from posting negative comments online. We propose the development of a task force to assess the professional, ethical, and legal implications of PRWs, including working with companies to improve accuracy of information, oversight, and feedback opportunities. It is expected that PRWs will play an increasing role in the future; it is unclear whether there will be a uniform reporting system, or whether these online ratings will influence referral patterns and/or quality improvement. Copyright © 2016 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.

  1. Constructing refinement operators by decomposing logical implication

    OpenAIRE

    Nienhuys-Cheng, Shan-Hwei; Laag, P.R.J.; Torre, L.W.N.

    1993-01-01

    textabstractInductive learning models [Plotkin 1971; Shapiro 1981] often use a search space of clauses, ordered by a generalization hierarchy. To find solutions in the model, search algorithms use different generalization and specialization operators. In this article we will decompose the quasi-ordering induced by logical implication into six increasingly weak orderings. The difference between two successive orderings will be small, and can therefore be understood easily. Using this decomposi...

  2. Bioavailability: implications for science/cleanup policy

    Energy Technology Data Exchange (ETDEWEB)

    Denit, Jeffery; Planicka, J. Gregory

    1998-12-01

    This paper examines the role of bioavailability in risk assessment and cleanup decisions. Bioavailability refers to how chemicals ''behave'' and their ''availability'' to interact with living organisms. Bioavailability has significant implications for exposure risks, cleanup goals, and site costs. Risk to human health and the environment is directly tied to the bioavailability of the chemicals of concern.

  3. Digital technology and journalism: implications for Democracy

    Directory of Open Access Journals (Sweden)

    John V. Pavlik

    2011-12-01

    Full Text Available Digital technology has brought sweeping changes to journalism  and the social institutions it serves. Journalism has historically played a central role in the U.S. and other democracies, serving as a primary source of news and information for citizens on matters of public importance. This paper examines the implications of these changes for democracy. It explores the question of whether a more interactive form of journalism will produce a more engaged and informed electorate.

  4. DIGITAL TECHNOLOGY AND JOURNALISM: implications for Democracy

    Directory of Open Access Journals (Sweden)

    John V. Pavlik

    2011-12-01

    Full Text Available Digital technology has brought sweeping changes to journalism  and the social institutions it serves. Journalism has historically played a central role in the U.S. and other democracies, serving as a primary source of news and information for citizens on matters of public importance. This paper examines the implications of these changes for democracy. It explores the question of whether a more interactive form of journalism will produce a more engaged and informed electorate.

  5. Data Network Effects: Implications for Data Business

    OpenAIRE

    Mitomo, Hitoshi

    2017-01-01

    This paper aims to investigate the existence of “data network effects” in data platform services such as Big Data, Internet-of-Things (IoT) and Artificial Intelligence (AI) and their influence on the diffusion of the services. It intendsto present a preliminary formal analysis ofthe effects of data network externalities.Policy implications will be discussed in terms of the diffusion of services.

  6. Energy Drinks: Implications for the Breastfeeding Mother.

    Science.gov (United States)

    Thorlton, Janet; Ahmed, Azza; Colby, David A

    2016-01-01

    Breastfeeding women may experience disrupted sleep schedules and be tempted to turn to popular energy drinks to reduce fatigue and enhance alertness, prompting the question: What are the maternal and child health implications for breastfeeding mothers consuming energy drinks? Caffeine and vitamin-rich energy drinks contain a variety of herbal ingredients and vitamins; however, ingredient amounts may not be clearly disclosed on product labels. Interactions between herbal ingredients and caffeine are understudied and not well defined in the literature. Some infants can be sensitive to caffeine and display increased irritability and sleep disturbances when exposed to caffeine from breastmilk. Breastfeeding women who consume energy drinks may be ingesting herbal ingredients that have not undergone scientific evaluation, and if taking prenatal vitamins, may unknowingly exceed the recommended daily intake. Caffeinated products are marketed in newer ways, fueling concerns about health consequences of caffeine exposure. We present implications associated with consumption of caffeine and vitamin-rich energy drinks among breastfeeding women. Product safety, labeling, common ingredients, potential interactions, and clinical implications are discussed. Healthcare providers should encourage breastfeeding women to read product labels for ingredients, carbohydrate content, serving size, and to discourage consumption of energy drinks when breastfeeding and/or taking prenatal vitamins, to avoid potential vitamin toxicity.

  7. Investigating Variations in Gameplay: Cognitive Implications

    Directory of Open Access Journals (Sweden)

    Kamran Sedig

    2015-01-01

    Full Text Available There is increasing interest in creating computer games for learning, problem solving, and other high-level cognitive activities. When investigating whether gameplay is conducive to such activities, gameplay is often studied as a whole. As a result, cognitive implications can be linked to the game but not to its structural elements. Given that gameplay arises from interaction between the player and the game, it is the structural components of interaction that should be investigated to better understand the design of gameplay. Furthermore, minor variations in the components of interaction can have significant cognitive implications. However, such variation has not been studied yet. Thus, to gain a better understanding of how we can study the effect of interaction on the cognitive aspect of gameplay, we conducted an exploratory investigation of two computer games. These games were isomorphic at a deep level and only had one minor difference in the structure of their interaction. Volunteers played these games and discussed the cognitive processes that emerged. In one game, they primarily engaged in planning, but in the other game they primarily engaged in visualizing. This paper discusses the results of our investigation as well as its implications for the design of computer games.

  8. [Gut microbiota: Description, role and pathophysiologic implications].

    Science.gov (United States)

    Landman, C; Quévrain, E

    2016-06-01

    The human gut contains 10(14) bacteria and many other micro-organisms such as Archaea, viruses and fungi. Studying the gut microbiota showed how this entity participates to gut physiology and beyond this to human health, as a real "hidden organ". In this review, we aimed to bring information about gut microbiota, its structure, its roles and its implication in human pathology. After bacterial colonization in infant, intestinal microbial composition is unique for each individual although more than 95% can be assigned to four major phyla. The use of culture independent methods and more recently the development of high throughput sequencing allowed to depict precisely gut microbiota structure and diversity as well as its alteration in diseases. Gut microbiota is implicated in the maturation of the host immune system and in many fundamental metabolic pathways including sugars and proteins fermentation and metabolism of bile acids and xenobiotics. Imbalance of gut microbial populations or dysbiosis has important functional consequences and is implicated in many digestive diseases (inflammatory bowel diseases, colorectal cancer, etc.) but also in obesity and autism. These observations have led to a surge of studies exploring therapeutics which aims to restore gut microbiota equilibrium such as probiotics or fecal microbiota transplantation. But recent research also investigates biological activity of microbial products which could lead to interesting therapeutics leads. Copyright © 2015 Société Nationale Française de Médecine Interne (SNFMI). Published by Elsevier SAS. All rights reserved.

  9. Myasthenia Gravis and Its Aeromedical Implications.

    Science.gov (United States)

    Jagathesan, Tania; O'Brien, Michael D

    2017-01-01

    Myasthenia gravis is an autoimmune condition where antibodies form against the acetylcholine receptors at the neuromuscular junction, eventually causing damage to the motor end plate. The clinical features include muscle fatigability as well as ocular, bulbar, and limb weakness, which can have implications on the role of a pilot or air traffic controller. This retrospective study reviewed the United Kingdom Civil Aviation Authority (UK CAA) experience of myasthenia gravis. A search of the United Kingdom Civil Aviation Authority medical records database from 1990 to 2016 identified 11 individuals with a diagnosis of myasthenia gravis. Data were extracted for the class of medical certificate, age at diagnosis, symptoms, acetylcholine receptor antibody status, treatment, the time from diagnosis to loss of medical certification, and the reasons for loss of certification. There were two Class 1 certificate holders (for professional flying) and six Class 2 certificate holders (for private pilot flying) and three air traffic controllers. The mean and median ages at diagnosis were 53 and 57 yr, respectively, with a range of 28-67 yr. The mean and median intervals from diagnosis to loss of certification were 22 and 11 mo, respectively, with a range of 0 to 108 mo. The aeromedical implications of myasthenia gravis, including complications, types of treatment, and functional impact, are considered. A policy for medical certification following a diagnosis of myasthenia gravis is proposed.Jagathesan T, O'Brien MD. Myasthenia gravis and its aeromedical implications. Aerosp Med Hum Perform. 2017; 88(1):30-33.

  10. Reliability implications for commercial Plowshare applications

    International Nuclear Information System (INIS)

    Brumleve, T.D.

    1970-01-01

    Based on the premise that there will always be a finite chance of a Plowshare project failure, the implications of such a failure are examined. It is suggested that the optimum reliability level will not necessarily be the highest attainable, but rather that which results in minimum average project cost. The type of performance guarantee that the U. S. should provide for nuclear explosive services, the determination of nuclear yield, courses of action to take in the event of failure, and methods to offset remedial costs are discussed. (author)

  11. Adolescent Health Implications of New Age Technology.

    Science.gov (United States)

    Jacobson, Cara; Bailin, Alexandra; Milanaik, Ruth; Adesman, Andrew

    2016-02-01

    This article examines the health implications of new age technology use among adolescents. As Internet prevalence has increased, researchers have found evidence of potential negative health consequences on adolescents. Internet addiction has become a serious issue. Pornography is now easily accessible to youth and studies have related pornography with several negative health effects. Cyberbullying has become a large problem as new age technologies have created a new and easy outlet for adolescents to bully one another. These technologies are related to increased morbidity and mortality, such as suicides due to cyberbullying and motor vehicle deaths due to texting while driving. Copyright © 2016 Elsevier Inc. All rights reserved.

  12. Some Cosmological Implications of Hidden Sectors

    CERN Document Server

    Espinosa, J R; No, J M; Quirós, Mariano

    2008-01-01

    We discuss some cosmological implications of extensions of the Standard Model with hidden sector scalars coupled to the Higgs boson. We put special emphasis on the conformal case, in which the electroweak symmetry is broken radiatively with a Higgs mass above the experimental limit. Our refined analysis of the electroweak phase transition in this kind of models strengthens the prediction of a strongly first-order phase transition as required by electroweak baryogenesis. We further study gravitational wave production and the possibility of low-scale inflation as well as a viable dark matter candidate.

  13. Dust and radon: the legal implications

    International Nuclear Information System (INIS)

    Van Sittert, J.M.O.

    1990-01-01

    It is known that radon gas is not generally considered to be a major problem when encountered in the working environment. However, in its process of decay, a series of four short lived daughter products are formed. In a dust-laden atmosphere these daughter products, which are ionized readily, attach to the particulate material and when inhaled are deposited in the alveoli of the lungs. Therefore, if respirable dust is controlled, the effects of radon daughters will also be minimized. The legal requirements for dust control in South Africa and their implications are discussed. 1 ill

  14. Lunar dust - Implications for astronomical observatories

    Science.gov (United States)

    Johnson, Stewart W.; Chua, Koon M.; Burns, Jack O.; Slane, Frederic A.

    1991-01-01

    The properties, origins, and previous operational experiences with lunar dust are discussed, with emphasis on the implications for world-class astronomy on the moon. The mechanisms that may govern the behavior of the fine particles are suggested, and working hypotheses for mitigating the dust hazard are advanced. Future experiments, both on the moon and in terrestrial simulations, that will assist in establishing effective and suitable means of limiting deleterious effects of dust on observatory operations are outlined. Dust studies of components returned by Surveyor 3 are presented. The performance of laser retroreflectors under conditions of moon dust is discussed.

  15. Ionization potentials some variations, implications and applications

    CERN Document Server

    Ahrens, L H

    1983-01-01

    Ionization Potentials: Some Variations, Implications and Applications covers several aspects of ionization potential that is a highly significant parameter in controlling the properties of electric discharge. Comprised of 17 chapters, the book covers topic relevant to ionization potentials, such as properties, concepts, and applications, in order to understand and fully comprehend all aspects of ionization potential. The opening chapter is a review of ionization potentials and a discussion of trends and features. The succeeding chapters then tackle complex topics such as the s and p electrons;

  16. Preeclampsia: pathophysiology and implications for care.

    Science.gov (United States)

    Townsend, Nancy S; Drummond, Susan B

    2011-01-01

    Nurses are increasingly encountering pregnant/postpartum women with hypertensive disorders of pregnancy, of which preeclampsia is one of the most common. The Joint Commission published a Sentinel Event Alert in 2010 on prevention of maternal death. This report notes that one of the 5 leading causes of pregnancy-related mortality between 1991 and 1997 was "hypertensive disorder." Preeclampsia presents significant risk to the health of the mother and the fetus. Clearly, nurses must understand the pathophysiology, assessment, management, recurrence risk, and long-term implications of preeclampsia to participate fully in a management plan that promotes safe patient care.

  17. Cosmological implications of Higgs near-criticality

    Science.gov (United States)

    Espinosa, J. R.

    2018-01-01

    The Standard Model electroweak (EW) vacuum, in the absence of new physics below the Planck scale, lies very close to the boundary between stability and metastability, with the last option being the most probable. Several cosmological implications of this so-called `near-criticality' are discussed. In the metastable vacuum case, the main challenges that the survival of the EW vacuum faces during the evolution of the Universe are analysed. In the stable vacuum case, the possibility of implementing Higgs inflation is critically examined. This article is part of the Theo Murphy meeting issue `Higgs cosmology'.

  18. Literature and the Sarau: Political Implications

    Directory of Open Access Journals (Sweden)

    Rejane Pivetta de Oliveira

    2017-06-01

    Full Text Available This paper discusses the phenomenon of the cultural gatherings that currently take place in the urban peripheries of Brazil’s larger cities, such as, for example, Sarau da Cooperifa, organized by Sérgio Vaz, and Sarau Suburbano, managed by Alessandro Buzo, both in São Paulo. We attempt to understand how they are organized and the cultural functions they perform in the context of a debate on literature as a cultural practice (Williams 1977; 2015 with aesthetic and political implications (Rancière 1996; 2009.

  19. Constructivism: The Implications for Laboratory Work

    Science.gov (United States)

    Shiland, Thomas W.

    1999-01-01

    An explicit theory of constructivism for science education is defined using references from the literature. This theory is used to suggest ways to modify laboratory activities to increase student understanding. Modification is suggested as a practical alternative to completely rewriting laboratory activities in a guided-discovery or full-inquiry format. The theory is shown to be consistent with generalizations derived from the classroom examples given in National Science Education Standards in the United States and a related document, NSTA Pathways to the Science Standards. It is argued that explicit theories of education with specific implications are useful to the classroom teacher, as they allow use, discussion, and modification.

  20. Implicational (semilinear) logics III: completeness properties

    Czech Academy of Sciences Publication Activity Database

    Cintula, Petr; Noguera, Carles

    2018-01-01

    Roč. 57, 3-4 (2018), s. 391-420 ISSN 0933-5846 R&D Projects: GA ČR GA13-14654S EU Projects: European Commission(XE) 689176 - SYSMICS Institutional support: RVO:67985807 ; RVO:67985556 Keywords : abstract algebraic logic * protoalgebraic logics * implicational logics * disjunctional logics * semilinear logics * non-classical logics * completeness theorems * rational completeness Subject RIV: BA - General Mathematics; BA - General Mathematics (UTIA-B) OBOR OECD: Computer sciences, information science, bioinformathics (hardware development to be 2.2, social aspect to be 5.8) Impact factor: 0.394, year: 2016

  1. Cosmological implications of Higgs near-criticality.

    Science.gov (United States)

    Espinosa, J R

    2018-03-06

    The Standard Model electroweak (EW) vacuum, in the absence of new physics below the Planck scale, lies very close to the boundary between stability and metastability, with the last option being the most probable. Several cosmological implications of this so-called 'near-criticality' are discussed. In the metastable vacuum case, the main challenges that the survival of the EW vacuum faces during the evolution of the Universe are analysed. In the stable vacuum case, the possibility of implementing Higgs inflation is critically examined.This article is part of the Theo Murphy meeting issue 'Higgs cosmology'. © 2018 The Author(s).

  2. Implicational (semilinear) logics III: completeness properties

    Czech Academy of Sciences Publication Activity Database

    Cintula, Petr; Noguera, Carles

    2018-01-01

    Roč. 57, 3-4 (2018), s. 391-420 ISSN 0933-5846 R&D Projects: GA ČR GA13-14654S EU Projects: European Commission(XE) 689176 - SYSMICS Institutional support: RVO:67985807 ; RVO:67985556 Keywords : abstract algebraic logic * protoalgebraic logics * implicational logics * disjunctional logics * semilinear logics * non-classical logics * completeness theorems * rational completeness Subject RIV: BA - General Mathematics; BA - General Mathematics (UTIA-B) OBOR OECD: Computer science s, information science , bioinformathics (hardware development to be 2.2, social aspect to be 5.8) Impact factor: 0.394, year: 2016

  3. Transformation of University Organizations:Leadership and Managerial Implications

    Directory of Open Access Journals (Sweden)

    Cemil ULUKAN

    2005-10-01

    Full Text Available Transformation of University Organizations:Leadership and Managerial Implications Cemil ULUKAN, Ph.D Anadolu UniversityOpen Education Faculty Eskisehir-TURKEYABSTRACT Technology and globalization are forcing higher education institutions to transform themselves. This paper aims to contribute to a better understanding the leadership and managerial implications of recent developments for higher education. Reviewing unique characteristics and the fundamental changes shaping higher education, the paper examines the need for organizational transformation and the major managerial implications.

  4. Epilepsy and menopause: potential implications for pharmacotherapy.

    Science.gov (United States)

    Sveinsson, Olafur; Tomson, Torbjörn

    2014-09-01

    Being a woman with epilepsy is not the same as being a man with the disease. There is a complex multidirectional interaction between sex hormones, seizures and antiepileptic drugs (AEDs) with gender-specific implications. Estrogen can be a potent proconvulsant, whereas progesterone is an anticonvulsant in experimental models. It is well established that women with epilepsy can have changes in seizure propensity related to their menstrual cycle (catamenial epilepsy). There is good evidence that the gonadotropin-releasing hormone cell population in the hypothalamus can be affected by seizures originating in the limbic system, possibly leading to anovulatory menses, possibly contributing to lower fertility, and earlier menopause among women with epilepsy. Data on the effects of menopause on epilepsy are scarce. In general, menopause appears to have limited effects on seizure control, with the possible exception of women with catamenial epilepsy who may experience an increase in seizure frequency during perimenopause and a decrease after menopause. Hormone replacement therapy has the potential to increase seizure frequency and thus cannot be recommended for women with epilepsy. Of particular relevance for menopause is the adverse effect on bone mineral density caused by enzyme inducers and other AEDs. In general, there is a remarkable shortage of studies on the impact of menopause on epilepsy and on its implications for epilepsy treatment.

  5. Clinical implications of angiogenesis in cancers

    Directory of Open Access Journals (Sweden)

    Roberta WC Pang

    2006-06-01

    Full Text Available Roberta WC Pang1, Ronnie TP Poon2 Departments of 1Medicine and 2Surgery, The University of Hong Kong, Pokfulam, Hong Kong, ChinaAbstract: Angiogenesis plays an important role in the growth and progression of cancer. The regulation of tumor angiogenesis depends on a net balance of angiogenic factors and antiangiogenic factors, which are secreted by both tumor cells and host-infiltrating cells. Numerous studies have indicated that assessment of angiogenic activity by either microvessel density or expression of angiogenic factors in cancer can provide prognostic information independent of conventional clinicopathological factors such as tumor staging. Some studies also suggested that assessment of tumor angiogenesis may predict cancer response to chemotherapy or radiotherapy. However, the most important clinical implication of tumor angiogenesis is the development of a novel strategy of anticancer therapy targeting tumor vessels instead of cancer cells. Antiangiogenic therapy aims to inhibit the growth of tumor, and current evidence suggests that it works best in combination with conventional cytotoxic chemotherapy. Recently, a monoclonal antibody against vascular endothelial growth factor, which is one of the most potent angiogenic factors, has been approved for clinical use in colorectal cancer patients after a clinical trial confirmed that combining the antibody with standard chemotherapy regimen could prolong patient survival. The clinical implications of angiogenesis in cancer are reviewed in this article.Keywords: angiogenesis, antiangiogenic therapy, cancer, prognosis

  6. Global implications of China's healthcare reform.

    Science.gov (United States)

    Yan, Fei; Tang, Shenglan; Zhang, Jian

    2016-01-01

    The ongoing healthcare reform in China has a powerful spillover effect beyond the health sector and the borders of China. A successful completion of the Chinese reform will offer a new model for social justice development, shift the global economy toward sustainability and create a new hub for science and technology in medical and health science. However, reforming the healthcare system in the most populated country is a daunting task. China will not live up to its promise, and all the potentials may end with hype not hope if coherent national strategies are not constructed and state-of-the-art navigation is not achieved with staggering domestic and global challenges. The cost of failure will be immensely high, socioeconomic costs for Chinese and an opportunity cost for the world as a whole. A full appreciation of the global implications of China's healthcare reform is crucial in keeping China receptive toward good practices evidence-approved elsewhere and open minded to fulfill its international obligations. More critically, the appreciation yields constructive engagements from global community toward a joint development and global prosperity. The current report provides a multiple disciplinary assessment on the global implications of the healthcare reform in China. Copyright © 2014 John Wiley & Sons, Ltd.

  7. Forensic implications: adolescent sexting and cyberbullying.

    Science.gov (United States)

    Korenis, Panagiota; Billick, Stephen Bates

    2014-03-01

    Adolescence is marked by establishing a sense of identity, core values, a sense of one's relationship to the outside world and heightened peer relationships. In addition, there is also risk taking, impulsivity, self exploration and dramatic increase in sexuality. The dramatic increase in the use of cell phones and the Internet has additional social implications of sexting and cyberbullying. Sexting refers to the practice of sending sexually explicit material including language or images to another person's cell phone. Cyberbullying refers to the use of this technology to socially exclude, threaten, insult or shame another person. Studies of cell phone use in the 21st century report well over 50% of adolescents use them and that text messaging is the communication mode of choice. Studies also show a significant percentage of adolescents send and receive sex messaging, both text and images. This paper will review this expanding literature. Various motivations for sexting will also be reviewed. This new technology presents many dangers for adolescents. The legal implications are extensive and psychiatrists may play an important role in evaluation of some of these adolescents in the legal context. This paper will also make suggestions on future remedies and preventative actions.

  8. The Process of Immigrant Acculturation: Recent Findings and Policy Implications.

    Science.gov (United States)

    Rubin, Gary

    1980-01-01

    Describes new perspectives on immigrant acculturation in the disciplines of history, mental health, and language studies. Discusses the implications of these new perspectives for national policymaking. (ST)

  9. Destination image: Origins, Developments and Implications

    Directory of Open Access Journals (Sweden)

    Sérgio Dominique Ferreira Lopes

    2011-04-01

    Full Text Available Over the last few decades, tourism has become one of the main sectors of the global economy, not only because of its contribution to the Gross Domestic Product (GDP of different countries, but also because of the employment it generates. Since 2009, however, the results of tourism have been severely affected by the economic and financial crisis and it is now essential to analyze the key elements of tourist consumer behavior. In this context, the image that a destination transmits to the market becomes one of the elements which influence tourists the most when choosing a tourist destination. The authors therefore aim to identify the main elements that characterize the image of a tourist destination, as well as their implications for the management of tourist destinations.

  10. Implications of LHCb measurements and future prospects

    CERN Document Server

    Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Anelli, M; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Baldini, W; Band, H; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Beigbeder-Beau, C; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernard, F; Bernet, R; Bettler, M -O; van Beuzekom, M; van Beveren, V; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bochin, B; Boer Rookhuizen, H; Bogdanova, G; Bonaccorsi, E; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Brarda, L; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cacérès, T; Cachemiche, J -P; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casajus Ramo, A; Casse, G; Cattaneo, M; Cauet, Ch; Ceelie, L; Chadaj, B; Chanal, H; Charles, M; Charlet, D; Charpentier, Ph; Chebbi, M; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciambrone, P; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corajod, B; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; D'Antone, I; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, Michel; De Groen, P; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Decreuse, G; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Diniz Batista, P; Dogaru, M; Domingo Bonal, F; Domke, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Drancourt, C; Duarte, O; Dumps, R; Dupertuis, F; Duval, P -Y; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Evangelisti, F; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Faulkner, P J W; Fave, V; Felici, G; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Föhr, C; Fontana, M; Fontanelli, F; Forty, R; Fournier, C; Francisco, O; Frank, M; Frei, C; Frei, R; Frosini, M; Fuchs, H; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Gets, S; Ghez, Ph; Giachero, A; Gibson, V; Gligorov, V V; Göbel, C; Golovtsov, V; Golubkov, D; Golutvin, A; Gomes, A; Gong, G; Gong, H; Gordon, H; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gromov, V; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Guzik, Z; Gys, T; Hachon, F; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; van der Heijden, B; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hofmann, W; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jamet, O; Jans, E; Jansen, F; Jansen, L; Jansweijer, P; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karavichev, O; Karbach, T M; Kashchuk, A; Kechadi, T; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kihm, T; Kluit, R; Kochebina, O; Komarov, V; Koopman, R F; Koppenburg, P; Korolev, M; Kos, J; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Kristic, R; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudenko, Y; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Landi, L; Lanfranchi, G; Langenbruch, C; Laptev, S; Latham, T; Lax, I; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, Y; Li Gioi, L; Likhoded, A; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Luo, H; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Maino, M; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mauricio, J; Mazurov, A; McCarthy, J; McNulty, R; Meadows, B; Meissner, M; Mejia, H; Mendez-Munoz, V; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Mul, F; Müller, K; Munneke, B; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Nawrot, A; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nikolaiko, Y; Nisar, S; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Ostankov, A; Otalora Goicochea, J M; van Overbeek, M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; van Petten, O; Phan, A; Picatoste Olloqui, E; Piedigrossi, D; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, M; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Rethore, F; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roeland, E; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; de Roo, K; Rouvinet, J; Roy, L; Rudloff, K; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Saornil Gamarra, S; Sapunov, M; Saputi, A; Sarti, A; Satriano, C; Satta, A; Savidge, T; Savrie, M; Schaack, P; Schiller, M; Schimmel, A; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schneider, T; Schopper, A; Schuijlenburg, H; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shao, B; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Sigurdsson, S; Silva Coutinho, R; Skwarnicki, T; Slater, M W; Sluijk, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Squerzanti, S; Stagni, F; Stahl, S; Steinkamp, O; Stenyakin, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; Tikhonov, A; van Tilburg, J; Tisserand, V; Tobin, M; Tocut, V; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ullaland, O; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vink, W; Volkov, S; Volkov, V; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Vouters, G; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Warda, K; Watson, N K; Webber, A D; Websdale, D; Wenerke, P; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Xue, T; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zappon, F; Zavertyaev, M; Zeng, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zverev, E; Zvyagin, A; Zwart, A; Bharucha, A; Bigi, I.I.; Bobeth, C; Bobrowski, M; Brod, Joachim; Buras, A J; Davies, C T H; Datta, A.; Delaunay, C; Descotes-Genon, S; Ellis, J; Feldmann, T; Fleischer, R; Gedalia, O; Girrbach, J; Guadagnoli, D; Hiller, G; Hochberg, Y; Hurth, T; Isidori, G; Jager, S; Jung, M; Kagan, A; Kamenik, J F; Lenz, A; Ligeti, Z; London, D; Mahmoudi, F; Matias, J; Nandi, S; Nir, Y; Paradisi, P; Perez, G; Petrov, A A; Rattazzi, R; Sharpe, S R; Silvestrini, L; Soni, A; Straub, D M; van Dyk, D; Virto, J; Wang, Y M; Weiler, A; Zupan, J

    2013-01-01

    During 2011 the LHCb experiment at CERN collected $1.0 {\\mbox{fb}^{-1}}$ of $\\sqrt{s} = 7 {\\mathrm{\\,Te\\kern -0.1em V}}$ $pp$ collisions. Due to the large heavy quark production cross-sections, these data provide unprecedented samples of heavy flavoured hadrons. The first results from LHCb have made a significant impact on the flavour physics landscape and have definitively proved the concept of a dedicated experiment in the forward region at a hadron collider. This document discusses the implications of these first measurements on classes of extensions to the Standard Model, bearing in mind the interplay with the results of searches for on-shell production of new particles at ATLAS and CMS. The physics potential of an upgrade to the LHCb detector, which would allow an order of magnitude more data to be collected, is emphasised.

  11. The Risk Implications of Multinational Enterprise

    DEFF Research Database (Denmark)

    Andersen, Torben Juul

    2011-01-01

    Purpose – Multinational structure has been linked to operational flexibilities that can improve corporate adaptability and a knowledge-based view suggests that multinational resource diversity can facilitate responsive opportunities. The enhanced maneuverability from this can reduce earnings...... volatility and hence the corporate performance risk. But, the internationalization process may also require irreversible investments that increase corporate exposures and leave the risk implications of multinational enterprize somewhat ambiguous. Hence, the purpose of the paper is to present an empirical...... debate about the risk effects of a multinational corporate structure and confirms that a diverse multinational presence is associated with positive risk outcomes. Originality/value – The paper complements a limited number of studies with equivocal results and adopts alternative risk outcome measures...

  12. Implications of the Human Genome Project

    Energy Technology Data Exchange (ETDEWEB)

    Kitcher, P.

    1998-11-01

    The Human Genome Project (HGP), launched in 1991, aims to map and sequence the human genome by 2006. During the fifteen-year life of the project, it is projected that $3 billion in federal funds will be allocated to it. The ultimate aims of spending this money are to analyze the structure of human DNA, to identify all human genes, to recognize the functions of those genes, and to prepare for the biology and medicine of the twenty-first century. The following summary examines some of the implications of the program, concentrating on its scientific import and on the ethical and social problems that it raises. Its aim is to expose principles that might be used in applying the information which the HGP will generate. There is no attempt here to translate the principles into detailed proposals for legislation. Arguments and discussion can be found in the full report, but, like this summary, that report does not contain any legislative proposals.

  13. Gestalt theory: implications for radiology education.

    Science.gov (United States)

    Koontz, Nicholas A; Gunderman, Richard B

    2008-05-01

    The Gestalt theory of modern psychology is grounded in the ideas that holistic rather than atomistic approaches are necessary to understand the mind, and that the mental whole is greater than the sum of its component parts. Although the Gestalt school fell out of favor due to its descriptive rather than explanatory nature, it permanently changed our understanding of perception. For the radiologist, such fundamental Gestalt concepts as figure-ground relationships and a variety of "grouping principles" (the laws of closure, proximity, similarity, common region, continuity, and symmetry) are ubiquitous in daily work, not to mention in art and personal life. By considering the applications of these principles and the stereotypical ways in which humans perceive visual stimuli, a radiology learner may incur fewer errors of diagnosis. This article serves to introduce several important principles of Gestalt theory, identify examples of these principles in widely recognizable fine art, and highlight their implications for radiology education.

  14. IMPLICATIONS OF MYCOTOXINS IN LIVESTOCK FEEDS

    Directory of Open Access Journals (Sweden)

    Muzaffer DENLI

    2015-10-01

    Full Text Available The contamination of foods and feeds is a significant problem in worldwide. Mycotoxins are secondary metabolites of fungi, particularly by many species of Aspergillus, Fusarium, Penicillium, Claviceps and Alternaria in many agricultural crops, especially in cereals and most oilseeds. Aflatoxins, ochratoxins, trichothecenes, zearelenone and fumonisins are the mycotoxins of greatest agro-economic importance. Mycotoxins have various acute and chronic effects on animals (especially monogastrics depending on species and susceptibility of an animal within a species. The most applied method to prevent mycotoxicosis in animals involves the addition to the diet of additives with the ability to bind or metabolize mycotoxin in the gastrointestinal digesta, aluminosilicates, activated charcoal, yeast and several polymers have been tested regarding the adsorption of mycotoxins in the gastrointestinal tract of different species. The efficiency of mycotoxin binders, however, differs considerably depending mainly on the chemical structure of both the adsorbent and the toxin. This review describes the most implications of mycotoxins in livestock feeds.

  15. Exploring Forensic Implications of the Fusion Drive

    Directory of Open Access Journals (Sweden)

    Shruti Gupta

    2014-09-01

    Full Text Available This paper explores the forensic implications of Apple's Fusion Drive. The Fusion Drive is an example of auto-tiered storage. It uses a combination of a flash drive and a magnetic drive. Data is moved between the drives automatically to maximize system performance. This is different from traditional caches because data is moved and not simply copied. The research included understanding the drive structure, populating the drive, and then accessing data in a controlled setting to observe data migration strategies. It was observed that all the data is first written to the flash drive with 4 GB of free space always maintained. If data on the magnetic drive is frequently accessed, it is promoted to the flash drive while demoting other information. Data is moved at a block-level and not a file-level. The Fusion Drive didn't alter the timestamps of files with data migration.

  16. Motherhood in adolescents’ lives: Implications for action

    Directory of Open Access Journals (Sweden)

    Magaly Nóblega Mayorga

    2009-06-01

    Full Text Available Based on the findings from two qualitative studies, this article analyzes motherhood’s mean­ings for those young women living in poverty. One study explored motherhood’s meanings attributed by 25 mothers from 18 to 20 years old who had a pregnancy during adolescence. The other study examined social representations about the characteristics of early mother­hood in 24 non-parents men and women teenagers, in order to understand the culture in which the young mothers live. Results suggest that motherhood represents a positive change for most young women and it structures their identity. The implications of these findings for primary and secondary prevention in this field are discussed.

  17. [Mental Imagery: Neurophysiology and Implications in Psychiatry].

    Science.gov (United States)

    Martínez, Nathalie Tamayo

    2014-03-01

    To provide an explanation about what mental imagery is and some implications in psychiatry. This article is a narrative literature review. There are many terms in which imagery representations are described in different fields of research. They are defined as perceptions in the absence of an external stimulus, and can be created in any sensory modality. Their neurophysiological substrate is almost the same as the one activated during sensory perception. There is no unified theory about its function, but it is possibly the way that our brain uses and manipulates the information to respond to the environment. Mental imagery is an everyday phenomenon, and when it occurs in specific patterns it can be a sign of mental disorders. Copyright © 2014 Asociación Colombiana de Psiquiatría. Publicado por Elsevier España. All rights reserved.

  18. e-Science and its implications.

    Science.gov (United States)

    Hey, Tony; Trefethen, Anne

    2003-08-15

    After a definition of e-science and the Grid, the paper begins with an overview of the technological context of Grid developments. NASA's Information Power Grid is described as an early example of a 'prototype production Grid'. The discussion of e-science and the Grid is then set in the context of the UK e-Science Programme and is illustrated with reference to some UK e-science projects in science, engineering and medicine. The Open Standards approach to Grid middleware adopted by the community in the Global Grid Forum is described and compared with community-based standardization processes used for the Internet, MPI, Linux and the Web. Some implications of the imminent data deluge that will arise from the new generation of e-science experiments in terms of archiving and curation are then considered. The paper concludes with remarks about social and technological issues posed by Grid-enabled 'collaboratories' in both scientific and commercial contexts.

  19. Implications of inherent safe nuclear power system

    International Nuclear Information System (INIS)

    Song, Yo-Taik

    1987-01-01

    The safety of present day nuclear power reactors and research reactors depends on a combination of design features of passive and active systems, and the alert judgement of their operators. A few inherently safe designs of nuclear reactors for power plants are currently under development. In these designs, the passive systems are emphasized, and the active systems are minimized. Also efforts are made to eliminate the potential for human failures that initiate the series of accidents. If a major system fails in these designs, the core is flooded automatically with coolants that flow by gravity, not by mechanical pumps or electromagnetic actuators. Depending on the choice of the coolants--water, liquid metal and helium gas--there are three principal types of inherently safe reactors. In this paper, these inherently safe reactor designs are reviewed and their implications are discussed. Further, future perspectives of their acceptance by nuclear industries are discussed. (author)

  20. IPAD products and implications for the future

    Science.gov (United States)

    Miller, R. E., Jr.

    1980-01-01

    The betterment of productivity through the improvement of product quality and the reduction of cost is addressed. Productivity improvement is sought through (1) reduction of required resources, (2) improved ask results through the management of such saved resources, (3) reduced downstream costs through manufacturing-oriented engineering, and (4) lowered risks in the making of product design decisions. The IPAD products are both hardware architecture and software distributed over a number of heterogeneous computers in this architecture. These IPAD products are described in terms of capability and engineering usefulness. The future implications of state-of-the-art IPAD hardware and software architectures are discussed in terms of their impact on the functions and on structures of organizations concerned with creating products.

  1. Waste management implications of concentrating slimes

    International Nuclear Information System (INIS)

    1988-02-01

    The anticipated increase in demand for sand-size tailings from the uranium industry suggests that the fine-grained or 'slime' fraction will require special attention for disposal. The Atomic Energy Control Board (AECB) required information on the behaviour and environmental significance of the fine-grained tailings fraction in disposal facilities. Beak Consultants and Golder Associates were contracted to review the significant characteristics of slimes disposal and prepare a report on the physical and chemical characteristics of fine-grained tailings (Phase 1). This report (Phase 2) presents a summary of disposal and management practices for slimes and outlines potential concerns related to these practices. The report also presents an approach to disposal planning and the implications of available and potential management techniques. Experience with the disposal of uranium slimes is scarce and, therefore, relevant information was borrowed from the other mining sectors to predict the consequences of various disposal scenarios

  2. Prescription drug abuse: problem, policies, and implications.

    Science.gov (United States)

    Phillips, Janice

    2013-01-01

    This article provides an overview on prescription drug abuse and highlights a number of related legislative bills introduced during the 112th Congress in response to this growing epidemic. Prescription drug abuse has emerged as the nation's fastest growing drug problem. Although prescription drugs have been used effectively and appropriately for decades, deaths from prescription pain medicine in particular have reached epidemic proportions. Bills related to prescription drug abuse introduced during the 112th Congress focus on strengthening provider and consumer education, tracking and monitoring prescription drug abuse, improving data collection on drug overdose fatalities, combating fraud and abuse in Medicare and Medicaid programs, reclassifying drugs to make them more difficult to prescribe and obtain, and enforcing stricter penalties for individuals who operate scam pain clinics and sell pain pills illegitimately. This article underscores the importance of a multifaceted approach to combating prescription drug abuse and concludes with implications for nursing. Copyright © 2013. Published by Mosby, Inc.

  3. Income inequality: Implications and relevant economic policies

    Directory of Open Access Journals (Sweden)

    Arestis Philip

    2016-01-01

    Full Text Available The aim of this contribution is to discuss closely the implications of income inequality and the economic policies to tackle it, especially so in view of inequality being one of the main causes of the 2007/2008 international financial crisis and the “great recession” that subsequently emerged. Wealth inequality is also important in this respect, but the focus is on income inequality. Ever since the financial crisis and the subsequent “great recession”, inequality of income, and wealth, has increased and the demand for economic policy initiatives to produce a more equal distribution of income and wealth has become more urgent. Such reduction would help to increase the level of economic activity as has been demonstrated again more recently. A number of economic policy initiatives for this purpose will be the focus of this contribution.

  4. Nuclear power: Health implications of transuranium elements

    International Nuclear Information System (INIS)

    1982-01-01

    This report provides general guidelines for national public health and environmental authorities. It does not provide detailed technical data, but instead broadly surveys the whole field, indicating the present position as assessed by members of the Working Group. The Working Group considered three major facets: physiological, toxicological and dosimetric aspects of the transuranium elements; the application of occupational health control, including health physics; and environmental behaviour together with public health implications associated with the transuranium elements. The intention was to cover all aspects relevant to health, with respect both to those who are occupationally engaged in work with such elements and to the general public who might be affected as the result of such operations. Consideration was also given to routine and emergency situations

  5. Cognitive implications of facilitating echoic persistence.

    Science.gov (United States)

    Baldwin, Carryl L

    2007-06-01

    Seventeen participants performed a tone-pattern-matching task at different presentation levels while concurrently engaged in a simulated-driving task. Presentation levels of 60, 65, and 70 dBC (SPL) were combined factorially with tone-matching delays of 2, 3, and 4 sec. Intensity had no effect on performance in single-task conditions and short-delay conditions. However, when the participants were engaged concurrently in the driving task, a significant interaction between presentation level and delay was observed. In the longest delay condition, the participants performed the tone-pattern-matching task more efficiently (more quickly and without additional errors) as presentation intensity increased. These findings demonstrate the interaction between sensory and cognitive processes and point to a direct-intensity relationship where intensity affects the persistence of echoic memory. Implications for facilitating auditory processing and improving auditory interfaces in complex systems (i.e., transportation environments), particularly for older and hearing-impaired listeners, are discussed.

  6. Pharmacologic Implications of Marijuana Use During Pregnancy.

    Science.gov (United States)

    Fantasia, Heidi Collins

    Marijuana is the most commonly used recreational drug in the United States, including among women of childbearing age and women who are pregnant. Changing legal statutes that allow for the use of medical marijuana and the decriminalization of marijuana for personal use reflect more permissive societal views on the use of this drug. Active compounds in marijuana cross the placenta rapidly and are excreted in breast milk. Results of studies of the effects of marijuana on a developing fetus and neonate are conflicting, but researchers have identified chronic marijuana exposure as a risk factor for preterm birth and small-for-gestational-age infants. This article reviews the pharmacology of marijuana and discusses implications for nurses who work with women of childbearing age. © 2017 AWHONN, the Association of Women’s Health, Obstetric and Neonatal Nurses.

  7. Environmental implications of China's WTO accession

    International Nuclear Information System (INIS)

    Vennemo, Haakon; Aunan, Kristin; He, Jianwu; Hu, Tao; Li, Shantong; Rypdal, Kristin

    2005-01-01

    China's accession to the WTO in 2001 completed the country's entry into the global economy. We investigate environmental implications of WTO-accession. There are several hypotheses in this area: The scale hypothesis says that production is scaled up and in turn, pollution increases. The composition hypothesis says that composition of industries changes and pollution reflects the new composition. The technique hypothesis says that production methods become cleaner and pollution decreases. We analyze the relative strength of the hypotheses by means of an environmental CGE-model, and in the case of air pollution find support for a composition effect in favor of clean industries. Thanks to the composition effect, emissions to air of greenhouse gases fall. Emissions of particles and SO2 also fall, but emissions of NOx and VOC rise. Since particle and SO2-emissions fall we estimate that public health improves (author)

  8. Implications of Orientation in Sheared Cocoa Butter

    Science.gov (United States)

    Guthrie, Sarah E.; Mazzanti, Gianfranco; Marangoni, Alejandro; Idziak, Stefan H. J.

    2004-03-01

    We will present x-ray and mechanical studies of oriented phases of cocoa butter. The structural elements of foods play an important role in determining such things as quality and shelf stability. The specific structure and properties of cocoa butter, however, are complicated due to the ability of the cocoa butter to form crystals in six polymorphic forms. Recent work has shown that the application of shear not only accelerates the transitions to more stable polymorphs, but also causes orientation of the crystallites[1]. The implications of orientation on the structures formed under conditions of shear and cooling will be described using x-ray diffraction and mechanical measurements. 1 G. Mazzanti, S. E. Guthrie, E. B. Sirota et al., Crystal Growth & Design 3 (5), 721 (2003).

  9. False confessions: causes, consequences, and implications.

    Science.gov (United States)

    Leo, Richard A

    2009-01-01

    In the past two decades, hundreds of convicted prisoners have been exonerated by DNA and non-DNA evidence, revealing that police-induced false confessions are a leading cause of wrongful conviction of the innocent. In this article, empirical research on the causes and correlates of false confessions is reviewed. After a description of the three sequential processes that are responsible for the elicitation of false confessions--misclassification, coercion, and contamination--the three psychologically distinct types of false confession (voluntary, compliant, and persuaded) are discussed along with the consequences of introducing false-confession evidence in the criminal justice system. The article concludes with a brief discussion of the implications of empirical research for reducing the number of false confessions and improving the accuracy of confession evidence that is introduced against a defendant at trial.

  10. Promoting biofuels: Implications for developing countries

    International Nuclear Information System (INIS)

    Peters, Joerg; Thielmann, Sascha

    2008-01-01

    Interest in biofuels is growing worldwide as concerns about the security of energy supply and climate change are moving into the focus of policy makers. With the exception of bioethanol from Brazil, however, production costs of biofuels are typically much higher than those of fossil fuels. As a result, promotion measures such as tax exemptions or blending quotas are indispensable for ascertaining substantial biofuel demand. With particular focus on developing countries, this paper discusses the economic justification of biofuel promotion instruments and investigates their implications. Based on data from India and Tanzania, we find that substantial biofuel usage induces significant financial costs. Furthermore, acreage availability is a binding natural limitation that could also lead to conflicts with food production. Yet, if carefully implemented under the appropriate conditions, biofuel programs might present opportunities for certain developing countries

  11. Therapeutic Implications of PPARγ in Cardiovascular Diseases

    Directory of Open Access Journals (Sweden)

    Hiroshi Hasegawa

    2010-01-01

    Full Text Available Peroxisome proliferator-activated receptor-γ (PPARγ is the members of the nuclear receptor superfamily as a master transcriptional factor that promotes differentiation of preadipocytes by activating adipose-specific gene expression. Although PPARγ is expressed predominantly in adipose tissue and associated with adipocyte differentiation and glucose homeostasis, PPARγ is also present in a variety of cell types including vascular cells and cardiomyocytes. Activation of PPARγ suppresses production of inflammatory cytokines, and there is accumulating data that PPARγ ligands exert antihypertrophy of cardiomyocytes and anti-inflammatory, antioxidative, and antiproliferative effects on vascular wall cells and cardiomyocytes. In addition, activation of PPARγ is implicated in the regulation of endothelial function, proliferation and migration of vascular smooth muscle cells, and activation of macrophages. Many studies suggest that PPARγ ligands not only ameliorate insulin sensitivity, but also have pleiotropic effects on the pathophysiology of atherosclerosis, cardiac hypertrophy, ischemic heart, and myocarditis.

  12. Racism and cardiovascular disease: implications for nursing.

    Science.gov (United States)

    Jackson, Jennifer; McGibbon, Elizabeth; Waldron, Ingrid

    2013-01-01

    The social determinants of health (SDH) are recognized as a prominent influence on health outcomes across the lifespan. Racism is identified as a key SDH. In this article, the authors describe the concept of racism as an SDH, its impact in discriminatory actions and inactions, and the implications for cardiovascular nurses. Although research in Canada on the links among racism, stress, and cardiovascular disease is limited, there is growing evidence about the stress of racism and its long-term impact on cardiovascular health. The authors discuss how cardiovascular nursing could be enhanced through an understanding of racism-related stress, and race-based differences in cardiovascular care. The authors conclude with strategies for action to address this nursing concern.

  13. Implications of global warming on human health

    International Nuclear Information System (INIS)

    Singh, R.K.; Syam, P.V.S.

    1997-01-01

    Due to the build up of green house gases in atmosphere, less heat escapes through the atmosphere promoting global warming. This may result in world wide droughts, sea-level rise inundating islands and coastal countries, cataclysmic hurricanes etc. Human health as a result of these changes, will be affected both physiologically and psychologically. Physiological effects may be more pronounced in cases occurring due to changes in rainfall and temperature patterns, food production amounts, water availability, etc. Psychological impact may be more in cases of catastrophes like floods, hurricanes or famine. In this paper, an attempt has been made to highlight the implications of global warming on human health due to temperature change. Food production changes and ultra-violet radiation effects and cataclysmic disaster effects. (author)

  14. Persuasive Recommender Systems Conceptual Background and Implications

    CERN Document Server

    Yoo, Kyung-Hyan; Zanker, Markus

    2013-01-01

    Whether users are likely to accept the recommendations provided by a recommender system is of utmost importance to system designers and the marketers who implement them. By conceptualizing the advice seeking and giving relationship as a fundamentally social process, important avenues for understanding the persuasiveness of recommender systems open up. Specifically, research regarding influential factors in advice seeking relationships, which is abundant in the context of human-human relationships, can provide an important framework for identifying potential influence factors in recommender system context. This book reviews the existing literature on the factors in advice seeking relationships in the context of human-human, human-computer, and human-recommender system interactions. It concludes that many social cues that have been identified as influential in other contexts have yet to be implemented and tested with respect to recommender systems. Implications for recommender system research and design are dis...

  15. Learning to Listen - Implications for Interdisciplinary Instruction

    Science.gov (United States)

    Redish, Edward

    2015-04-01

    For more than twenty years, researchers in the University of Maryland Physics Education Research Group (UMd-PERG) have been developing a theoretical framework for trying to understand how students think about and learn physics - Resources. The Resources Framework provides tools for interpreting how our students respond to our instruction. What may appear on the surface to be serious misconceptions can turn out to have a subtler explanation once one takes into account the roles played in student thinking by (1) experiential knowledge, (2) the dynamic character of their cognitive responses, (3) epistemological assumptions and expectations, (4) framing of the activity along multiple dimensions. The Resources Framework also provides tools to help us understand what knowledge our students bring into our classes and how they use that knowledge to interpret what they are learning. What we have learned in this research has powerful implications for instruction, especially in service courses where an expert is charged with teaching a discipline to students from a different discipline, such as when physicists teach physics to biologists or engineers. For more than a decade, the UMd-PERG and our collaborators have been studying how life science students respond to physics instruction. We have found many surprising results by listening carefully to what students say: Often, ``student errors'' turn out to be failures of communication between teacher and student. Many common practices turn out to be counterproductive and misleading. I will give examples from NEXUS/Physics, an introductory physics class for life science students, and I will suggest implications for instruction and curriculum development. Support gratefully acknowledged for multiple NSF grants.

  16. Assessment of selected world bank policies and their implications ...

    African Journals Online (AJOL)

    The review x-rayed some World Bank policies and their implications on the fight against poverty in Nigeria. World Bank policies on education, structural adjustment programme, water privatization, deregulation/liberalization and their implications on the fight against poverty in Nigeria were analyzed. In the review it was found ...

  17. Investigation of previously implicated genetic variants in chronic tic disorders

    DEFF Research Database (Denmark)

    Abdulkadir, Mohamed; Londono, Douglas; Gordon, Derek

    2017-01-01

    with those from a large independent case-control cohort. After quality control 71 SNPs were available in 371 trios; 112 SNPs in 179 trios; and 3 SNPs in 192 trios. 17 were candidate SNPs implicated in TS and 2 were implicated in obsessive-compulsive disorder (OCD) or autism spectrum disorder (ASD); 142 were...

  18. Poverty and Brain Development in Children: Implications for Learning

    Science.gov (United States)

    Dike, Victor E.

    2017-01-01

    Debates on the effect of poverty on brain development in children and its implications for learning have been raging for decades. Research suggests that poverty affects brain development in children and that the implications for learning are more compelling today given the attention the issue has attracted. For instance, studies in the fields of…

  19. Paradoxical implications of personal social media use for work

    NARCIS (Netherlands)

    van Zoonen, W.; Rice, R.E.

    2017-01-01

    New information and communication technologies can have paradoxical implications: they may be liberating and constraining at the same time. This field study examines the direct implications of personal social media use for work on employees’ autonomy and work pressure, and the indirect effects on

  20. Education System Reform in China after 1978: Some Practical Implications

    Science.gov (United States)

    Sun, Miantao

    2010-01-01

    Purpose: This paper aims to provide an overview of education system reform in China since 1978, and its practical implications. Design/methodology/approach: Data were collected from literature review and interview. An overview of education system reform and its practical implications was found through data analysis. Findings: There has been two…

  1. The Current Global Economic Crisis: Implication for Best Teacher ...

    African Journals Online (AJOL)

    The study examines the current global economic recession and its implication for best teacher practices for university graduate capacity building in Nigeria. The main thrust of the paper is the causes of the present recession, solutions and its implications for university graduate capacity building in Nigeria. The paper ...

  2. Phenomenology of non-universal gaugino masses and implications ...

    Indian Academy of Sciences (India)

    We study the implications of such non-universal gaugino masses for the composition of the lightest neutralino in supersymmetric (SUSY) theories based on (5) gauge group. We also consider the phenomenological implications of non-universal gaugino masses for the phenomenology of Higgs bosons in the context of ...

  3. ORF Alignment: NC_002754 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... solfataricus ... Length = 119 ... Query: 17 ... ILIVVTHGPEDLDRTYAPLFMASISASME...YETSVFFMIKGPKLLDKKWQEEERKKGGNPF 76 ... ILIVVTHGPEDLDRTYAPLFMASISASMEYETSVFFMIKGPKLLDKKWQEEER...KKGGNPF Sbjct: 3 ... ILIVVTHGPEDLDRTYAPLFMASISASMEYETSVFFMIKGPKLLDKKWQEEERKKGGNPF 62 ...

  4. Environmental implications and applications of nanomaterials

    Science.gov (United States)

    Bhattacharya, Priyanka

    Recent advances in material science and nanotechnology have given rise to a myriad of developments, while in the meantime call for research into the impacts of nanomaterials on the environment and human health. Although considerable progress has been made in the past decade concerning the behavior of nanomaterials in biological systems, such understanding is critically lacking with respect to the fate of nanomaterials in ecosystems. Accordingly, this dissertation addresses the interactions between nanomaterials and algae---the major constituent of the aquatic food chain (Part I, Chapter two), and exploits the physicochemistry of nanoscaled synthetic dendritic polymers for environmental applications, especially for water purification that is a focused theme of the entire dossier (Part II, Chapters two--five). This dissertation is organized as follows. Chapter one presents a general review of the physical/physicochemical properties, characterizations, implications---especially ecological implication, and applications of a host of most produced and studied nanomaterials. In addition, advances in environmental applications of nanomaterials are discussed. Chapter two examines algal responses to two major types of engineered nanomaterials---quantum dots and polystyrene. Inhibited photosynthetic activities of green algae are observed as a result of the physical adsorption of the nanomaterials. Chapter three elucidates the physicochemical properties of poly(amidoamine)-tris(hydroxymethyl)amidomethane- and amine-terminated dendrimers towards their applications in water remediation. Here, the capacities and mechanisms of the dendrimers in hosting cationic copper, anionic nitrate, polyaromatic phenanthrene, and the more heterogeneous humic acids are discussed. Based on the results of Chapter three, Chapter four presents a dendrimer-based novel optical scheme for improving the detection sensitivity and selectivity of environmental pollutants. Specifically, the surface plasmon

  5. People management implications of virtual workplace arrangements

    Directory of Open Access Journals (Sweden)

    K. Ortlepp

    2006-12-01

    Full Text Available Purpose: The purpose of this paper is to investigate the factors that led to an organisation implementing a particular form of virtual workplace arrangement, namely, home-based work. The benefits and disadvantages associated with this form of work arrangement are explored from both the managers' and home-based employees' perspectives. Design/Methodology/Approach: Given the exploratory nature of the empirical study on which this paper is based, a qualitative research design was adopted so as to ensure that the data collection process was dynamic and probing in nature. Semi-structured in-depth interviews were therefore used as instruments for data collection. Findings: The research findings indicate that virtual work arrangements such as home-based work arrangements have advantages for both employers and employees. For instance, reduction of costs associated with office space and facilities, decrease in absenteeism rates, increased employee job satisfaction and improvements in employees' general quality of life. However, a number of negative experiences related to this form of virtual work arrangement are also evident, for example, feelings of isolation as well as stress related to the inability to have firm boundaries between work and family responsibilities. Implications: Based on the insights gained from the findings in the empirical study, a number of areas that need to be given specific attention when organisations are introducing virtual workplace arrangements of this nature are identified. Recommendations made in this article are important for human resource management specialists as well as core business policy makers considering different forms of organisational design. Originality/Value: Maximising the quality of production and service provided has become the prime objective in most organisations in the 21st century. Technology has made it possible for some jobs to be performed at any place at any time and has facilitated the

  6. Alexithymia in eating disorders: therapeutic implications

    Directory of Open Access Journals (Sweden)

    Pinna F

    2014-12-01

    Full Text Available Federica Pinna, Lucia Sanna, Bernardo Carpiniello Department of Public Health, Clinical and Molecular Medicine - Unit of Psychiatry, University of Cagliari, Cagliari, Italy Abstract: A high percentage of individuals affected by eating disorders (ED achieve incomplete recovery following treatment. In an attempt to improve treatment outcome, it is crucial that predictors of outcome are identified, and personalized care approaches established in line with new treatment targets, thus facilitating patient access to evidence-based treatments. Among the psychological factors proposed as predictors of outcome in ED, alexithymia is of outstanding interest. The objective of this paper is to undertake a systematic review of the literature relating to alexithymia, specifically in terms of the implications for treatment of ED. In particular, issues concerning the role of alexithymia as a predictor of outcome and as a factor to be taken into account in the choice of treatment will be addressed. The effect of treatments on alexithymia will also be considered. A search of all relevant literature published in English using PubMed, PsycINFO, and Scopus databases was carried out on the basis of the following keywords: alexithymia, anorexia nervosa, bulimia nervosa, eating disorders, and treatment; no time limits were imposed. Despite the clinical relevance of alexithymia, the number of studies published on the above cited aspects is somewhat limited, and these studies are largely heterogeneous and feature significant methodological weaknesses. Overall, data currently available mostly correlate higher levels of alexithymia with a less favorable outcome in ED. Accordingly, alexithymia is seen as a relevant treatment target with the aim of achieving recovery of these patients. Treatments focusing on improving alexithymic traits, and specifically those targeting emotions, seem to show greater efficacy, although alexithymia levels often remain high even after specific

  7. Policy implications of technologies for cognitive enhancement

    Energy Technology Data Exchange (ETDEWEB)

    Sarewitz, Daniel R. (Arizona State University, Tempe, AZ); Karas, Thomas H.

    2007-02-01

    The Advanced Concepts Group at Sandia National Laboratory and the Consortium for Science, Policy and Outcomes at Arizona State University convened a workshop in May 2006 to explore the potential policy implications of technologies that might enhance human cognitive abilities. The group's deliberations sought to identify core values and concerns raised by the prospect of cognitive enhancement. The workshop focused on the policy implications of various prospective cognitive enhancements and on the technologies/nanotechnology, biotechnology, information technology, and cognitive science--that enable them. The prospect of rapidly emerging technological capabilities to enhance human cognition makes urgent a daunting array of questions, tensions, ambitions, and concerns. The workshop elicited dilemmas and concerns in ten overlapping areas: science and democracy; equity and justice; freedom and control; intergenerational issues; ethics and competition; individual and community rights; speed and deliberations; ethical uncertainty; humanness; and sociocultural risk. We identified four different perspectives to encompass the diverse issues related to emergence of cognitive enhancement technologies: (1) Laissez-faire--emphasizes freedom of individuals to seek and employ enhancement technologies based on their own judgment; (2) Managed technological optimism--believes that while these technologies promise great benefits, such benefits cannot emerge without an active government role; (3) Managed technological skepticism--views that the quality of life arises more out of society's institutions than its technologies; and (4) Human Essentialism--starts with the notion of a human essence (whether God-given or evolutionary in origin) that should not be modified. While the perspectives differ significantly about both human nature and the role of government, each encompasses a belief in the value of transparency and reliable information that can allow public discussion and

  8. Language Learning Strategies: Classification and Pedagogical Implication

    Directory of Open Access Journals (Sweden)

    Ag. Bambang Setiyadi

    2001-01-01

    Full Text Available Many studies have been conducted to explore language learning strategies (Rubin, 1975, Naiman et . al ., 1978; Fillmore, 1979; O'Malley et . al ., 1985 and 1990; Politzer and Groarty, 1985; Prokop, 1989; Oxford, 1990; and Wenden, 1991. In the current study a total of 79 university students participating in a 3 month English course participated. This study attempted to explore what language learning strategies successful learners used and to what extent the strategies contributed to success in learning English in Indonesia . Factor analyses, accounting for 62.1 %, 56.0 %, 41.1 %, and 43.5 % of the varience of speaking, listening, reading and writing measures in the language learning strategy questionnaire, suggested that the questionnaire constituted three constructs. The three constructs were named metacognitive strategies, deep level cognitive and surface level cognitive strategies. Regression analyses, performed using scales based on these factors revealed significant main effects for the use of the language learning strategies in learning English, constituting 43 % of the varience in the posttest English achievement scores. An analysis of varience of the gain scores of the highest, middle, and the lowest groups of performers suggested a greater use of metacognitive strategies among successful learners and a greater use of surface level cognitive strategies among unsuccessful learners. Implications for the classroom and future research are also discussed.

  9. Terminal sedation: ethical implications in different situations.

    Science.gov (United States)

    Hallenbeck, J L

    2000-01-01

    Terminal sedation (TS) is a recently coined term that may apply to a variety of practices with differing ethical implications. Two hypothetical cases are presented and contrasted. The first presents the more common scenario in which sedation is used for severe distress in a patient very close to death, who has stopped eating and drinking. The second case is more problematic: a nonterminally ill spinal cord injury patient requests sedation because of psychic distress. Sedation is supported in the former, but not the latter case. Suggested principles guiding the ethical use of sedation are: (1) While respect for autonomy is important, we are not obliged under all circumstances to provide sedation. (2) Physician intent matters. In providing sedation the physician's primary intent should be to alleviate suffering. (3) Reasonable inferences of intent can be made from physician actions, providing safeguards to ensure proper care. Sedatives should be titrated to observable signs of distress. (4) Proximity to death is a more useful concept than terminality in weighing benefits and burdens of sedation. (5) The nature of physician action should depend upon the nature of the suffering. Not all suffering is appropriately treated with sedation. (6) In patients close to death who have already stopped eating and drinking, sedation cannot be said to hasten death through dehydration or starvation. (7) Where TS is otherwise appropriate and where dehydration may in fact hasten death, ethical concerns may be addressed through informed consent. If hydration is refused, TS cannot be considered synonymous with euthanasia.

  10. Ethical implications of diversity in disaster research.

    Science.gov (United States)

    Hunt, Matthew R; Anderson, James A; Boulanger, Renaud F

    2012-01-01

    Enhancing the effectiveness, efficiency, and fairness of interventions is an increasing source of concern in the field of disaster response. As a result, the expansion of the disaster relief evidence base has been identified as a pressing need. There has been a corresponding increase in discussions of ethical standards and procedures for disaster research. In general, these discussions have focused on elucidating how traditional research ethics concerns can be operationalized in disaster settings. Less attention has been given to the exploration of the ethical implications of heterogeneity within the field of disaster research. Hence, while current efforts to discuss the ethics of disaster research in low-resource settings are very encouraging, it is clear that further initiatives will be crucial to promote the ethical conduct of disaster research. In this article, we explore how the ethical review of disaster research conducted in low-resource settings should account for this diversity. More specifically, we consider how the nature of the project (what?), sociopolitical and physical environment of research sites (where?), temporal proximity to the disaster event (when?), objectives motivating the research (why?), and identity of the stakeholders involved in the research process (who?) all relate to the ethics of disaster research.

  11. Urbanization and its implications for health services.

    Science.gov (United States)

    Guest, P

    1998-07-01

    According to this study, living conditions and access to health services have improved in Thailand. However, improvements have been greater in urban areas, and migration from rural to urban areas has been responsive to the unequal distribution of economic opportunities. The health service needs vary between urban and rural populations. Migrants to cities are in good health. Disadvantaged populations in rural areas need the same opportunities as those available in cities. Cities need to strengthen health services targeted to the young, and especially females. Urbanization is likely to increase throughout Southeast Asia over the coming years. Southeast Asia is well advanced in the fertility and mortality transitions, but less advanced in the urbanization transition. The urban transition has implications for the supply and demand for health services. Described are the variation in demographic structures of urban and rural areas, the concentration of resources in urban areas, the patterns of urbanization, and the potential paths through which urbanization is related to the distribution of health services in Thailand. A broad overview is given for Southeast Asia. Demand for services is a function of the age and sex composition of population, resources available, and preferences for particular types of services. Supply of services is related to government health allocation decisions and private health supplier's locations of services. Urbanization affects the distribution of health services mainly through demand, and is an outcome of economic development. Migration is the main contributor to Thai urbanization.

  12. Prostate cancer epigenetics and its clinical implications

    Directory of Open Access Journals (Sweden)

    Srinivasan Yegnasubramanian

    2016-01-01

    Full Text Available Normal cells have a level of epigenetic programming that is superimposed on the genetic code to establish and maintain their cell identity and phenotypes. This epigenetic programming can be thought as the architecture, a sort of cityscape, that is built upon the underlying genetic landscape. The epigenetic programming is encoded by a complex set of chemical marks on DNA, on histone proteins in nucleosomes, and by numerous context-specific DNA, RNA, protein interactions that all regulate the structure, organization, and function of the genome in a given cell. It is becoming increasingly evident that abnormalities in both the genetic landscape and epigenetic cityscape can cooperate to drive carcinogenesis and disease progression. Large-scale cancer genome sequencing studies have revealed that mutations in genes encoding the enzymatic machinery for shaping the epigenetic cityscape are among the most common mutations observed in human cancers, including prostate cancer. Interestingly, although the constellation of genetic mutations in a given cancer can be quite heterogeneous from person to person, there are numerous epigenetic alterations that appear to be highly recurrent, and nearly universal in a given cancer type, including in prostate cancer. The highly recurrent nature of these alterations can be exploited for development of biomarkers for cancer detection and risk stratification and as targets for therapeutic intervention. Here, we explore the basic principles of epigenetic processes in normal cells and prostate cancer cells and discuss the potential clinical implications with regards to prostate cancer biomarker development and therapy.

  13. Atropa belladonna neurotoxicity: Implications to neurological disorders.

    Science.gov (United States)

    Kwakye, Gunnar F; Jiménez, Jennifer; Jiménez, Jessica A; Aschner, Michael

    2018-04-10

    Atropa belladonna, commonly known as belladonna or deadly nightshade, ranks among one of the most poisonous plants in Europe and other parts of the world. The plant contains tropane alkaloids, including atropine, scopolamine, and hyoscyamine, which are used as anticholinergics in Food and Drug Administration (FDA) approved drugs and homeopathic remedies. These alkaloids can be very toxic at high dose. The FDA has recently reported that Hyland's baby teething tablets contain inconsistent amounts of Atropa belladonna that may have adverse effects on the nervous system and cause death in children, thus recalled the product in 2017. A greater understanding of the neurotoxicity of Atropa belladonna and its modification of genetic polymorphisms in the nervous system is critical in order to develop better treatment strategies, therapies, regulations, education of at-risk populations, and a more cohesive paradigm for future research. This review offers an integrated view of the homeopathy and neurotoxicity of Atropa belladonna in children, adults and animal models, as well as its implications to neurological disorders. Particular attention is dedicated to the pharmaco/toxicodynamics, pharmaco/toxicokinetics, pathophysiology, epidemiological cases, and animal studies associated with the effects of Atropa belladonna on the nervous system. Additionally, we discuss the influence of active tropane alkaloids in Atropa belladonna and other similar plants on FDA-approved therapeutic drugs for treatment of neurological disorders. Copyright © 2018. Published by Elsevier Ltd.

  14. IMPLICATIONS OF ELECTRONIC COMMERCE LAW IN ROMANIA

    Directory of Open Access Journals (Sweden)

    Alice Cîrstea

    2014-11-01

    Full Text Available Abstract We live in an environment in which e-commerce continues to grow and evolve while state legislators attempt to catch up to the ever-changing technology. Today electronic transactions are more and more frequently supplementing or even entirely replacing traditional channels and business models. Even though, in theory, is easy to apply laws to Internet, in practice is harder. This article synthesizes a number of issues on the application of Romanian legislation on ecommerce and offers practical solutions both to managers and to authorities. The article use quantitative and qualitative methods in order to identify the information provided by catering web sites to their consumers in Romania, compared to United Kingdom. The research results raise question marks about how is written and applied Internet law in Romania and also about the limitations of Romanian electronic commerce legislation. Also it shows how companies fail to comply with applicable legislation and to attract their consumers. Managerial implications related to these findings are provided and future studies are encouraged to be investigated.

  15. Clinical implications of vitamin D deficiency

    Directory of Open Access Journals (Sweden)

    Beata Matyjaszek-Matuszek

    2015-06-01

    Full Text Available Vitamin D deficiency is a common medical problem worldwide and its prevalence rises along with latitude, obesity, sedentary lifestyle, limited sunlight exposure and aging. A great body of evidence has shown that patients with vitamin D deficiency have increased cardiovascular risks and total mortality. Conversely, the presence of comorbidities progressive with age such as abdominal obesity, insulin resistance, type 2 diabetes and hypertension places the patients at an increased risk of vitamin D deficiency. The multidirectional effect of vitamin D deficiency is present in different phases of the aging process. Based on the literature review, the risk factors for vitamin D insufficiency most often found in post-menopausal women include limited sun exposure and time spent outdoors, inadequate dietary vitamin D intake, winter season and increased age. Vitamin D supplementation in this group might offer prevention of falls and fractures and may be beneficial for cardiovascular health, what may be especially important in osteoporotic and elderly populations. Prevention and treatment processes involve education regarding sunlight exposure and pharmacological cholecalciferol supplementation according to the recommendations for Central Europe. This manuscript reviews the role of vitamin D and its deficiency and considers their clinical implications, with particular regard to peri- and postmenopausal women.

  16. Cosmological implications of primordial black holes

    Energy Technology Data Exchange (ETDEWEB)

    Luis Bernal, José; Bellomo, Nicola; Raccanelli, Alvise; Verde, Licia, E-mail: joseluis.bernal@icc.ub.edu, E-mail: nicola.bellomo@icc.ub.edu, E-mail: alvise@icc.ub.edu, E-mail: liciaverde@icc.ub.edu [ICC, University of Barcelona, IEEC-UB, Martí i Franquès, 1, E08028 Barcelona (Spain)

    2017-10-01

    The possibility that a relevant fraction of the dark matter might be comprised of Primordial Black Holes (PBHs) has been seriously reconsidered after LIGO's detection of a ∼ 30 M {sub ⊙} binary black holes merger. Despite the strong interest in the model, there is a lack of studies on possible cosmological implications and effects on cosmological parameters inference. We investigate correlations with the other standard cosmological parameters using cosmic microwave background observations, finding significant degeneracies, especially with the tilt of the primordial power spectrum and the sound horizon at radiation drag. However, these degeneracies can be greatly reduced with the inclusion of small scale polarization data. We also explore if PBHs as dark matter in simple extensions of the standard ΛCDM cosmological model induces extra degeneracies, especially between the additional parameters and the PBH's ones. Finally, we present cosmic microwave background constraints on the fraction of dark matter in PBHs, not only for monochromatic PBH mass distributions but also for popular extended mass distributions. Our results show that extended mass distribution's constraints are tighter, but also that a considerable amount of constraining power comes from the high-ℓ polarization data. Moreover, we constrain the shape of such mass distributions in terms of the correspondent constraints on the PBH mass fraction.

  17. Epigenetics and its implications for ecotoxicology.

    Science.gov (United States)

    Vandegehuchte, Michiel B; Janssen, Colin R

    2011-05-01

    Epigenetics is the study of mitotically or meiotically heritable changes in gene function that occur without a change in the DNA sequence. Interestingly, epigenetic changes can be triggered by environmental factors. Environmental exposure to e.g. metals, persistent organic pollutants or endocrine disrupting chemicals has been shown to modulate epigenetic marks, not only in mammalian cells or rodents, but also in environmentally relevant species such as fish or water fleas. The associated changes in gene expression often lead to modifications in the affected organism's phenotype. Epigenetic changes can in some cases be transferred to subsequent generations, even when these generations are no longer exposed to the external factor which induced the epigenetic change, as observed in a study with fungicide exposed rats. The possibility of this phenomenon in other species was demonstrated in water fleas exposed to the epigenetic drug 5-azacytidine. This way, populations can experience the effects of their ancestors' exposure to chemicals, which has implications for environmental risk assessment. More basic research is needed to assess the potential phenotypic and population-level effects of epigenetic modifications in different species and to evaluate the persistence of chemical exposure-induced epigenetic effects in multiple subsequent generations. © Springer Science+Business Media, LLC 2011

  18. Microbiota—implications for immunity and transplantation.

    Science.gov (United States)

    Bromberg, Jonathan S; Fricke, W Florian; Brinkman, C Colin; Simon, Thomas; Mongodin, Emmanuel F

    2015-06-01

    Each individual harbours a unique set of commensal microorganisms, collectively referred to as the microbiota. Notably, these microorganisms exceed the number of cells in the human body by 10-fold. This finding has accelerated a shift in our understanding of human physiology, with the realization that traits necessary for health are both encoded and influenced by the human genome and the microbiota. Our understanding of the aetiology of complex diseases has, therefore, evolved with increasing awareness that the human microbiota has an active and critical role in maintaining health and inducing disease. Indeed, findings from bioinformatic studies indicate that the microbiota and microbiome have multiple effects on the innate and adaptive immune systems, with effects on infection, autoimmune disease and cancer. In this Review, we first address the important statistical and informatics aspects that should be considered when characterizing the composition of microbiota. We next highlight the effects of the microbiota on the immune system and the implications of these effects on organ failure and transplantation. Finally, we reflect on the future perspectives for studies of the microbiota, including novel diagnostic tests and therapeutics.

  19. Environmental implications of carbon limits on market ...

    Science.gov (United States)

    Combined heat and power (CHP) is promoted as an economical, energy-efficient option for combating climate change. To fully examine the viability of CHP as a clean-technology solution, its market potential and impacts need to be analyzed as part of scenarios of the future energy system, particularly those with policies limiting greenhouse gas (GHG) emissions. This paper develops and analyzes scenarios using a bottom-up, technology rich optimization model of the U.S. energy system. Two distinct carbon reduction goals were set up for analysis. In Target 1, carbon emission reduction goals were only included for the electric sector. In Target 2, carbon emission reduction goals were set across the entire energy system with the target patterned after the U.S.’s commitment to reducing GHG emissions as part of the Paris Agreement reached at the COP21 summit. From a system-wide carbon reduction standpoint, Target 2 is significantly more stringent. In addition, these scenarios examine the implications of various CHP capacity expansion and contraction assumptions and energy prices. The largest CHP capacity expansion are observed in scenarios that included Target 1, but investments were scaled back in scenarios that incorporated Target 2. The latter scenario spurred rapid development of zero-emissions technologies within the electric sector, and purchased electricity increased dramatically in many end-use sectors. The results suggest that CHP may play a role in a carbon-c

  20. Climate change: potential implications for Ireland's biodiversity

    Science.gov (United States)

    Donnelly, Alison

    2018-03-01

    A national biodiversity and climate change adaptation plan is being developed for Ireland by the Department of Communications, Climate Action, and Environment. In order to inform such a plan, it was necessary to review and synthesize some of the recent literature pertaining to the impact of climate change on biodiversity in Ireland. Published research on this topic fell within three broad categories: (i) changes in the timing of life-cycle events (phenology) of plants, birds, and insects; (ii) changes in the geographic range of some bird species; and (iii) changes in the suitable climatic zones of key habitats and species. The synthesis revealed evidence of (i) a trend towards earlier spring activity of plants, birds, and insects which may result in a change in ecosystem function; (ii) an increase in the number of bird species; and (iii) both increases and decreases in the suitable climatic area of key habitats and species, all of which are expected to impact Ireland's future biodiversity. This process identified data gaps and limitations in available information both of which could be used to inform a focused research strategy. In addition, it raises awareness of the potential implications of climate change for biodiversity in Ireland and elsewhere and demonstrates the need for biodiversity conservation plans to factor climate change into future designs.

  1. Rehabilitation of executive functions: Implications and strategies

    Directory of Open Access Journals (Sweden)

    Bruno Kluwe-Schiavon

    2013-01-01

    Full Text Available Executive Functions (EF concern a range of abilities including problem-solving, planning, initiation, selfmonitoring,conscious attention, cope with new situations and the ability to modify plans if necessary. It’s a high cognitive function that is crucial for a person to get engaged and maintain daily activities whilst keeping a good quality of life. Problems in the EF were formerly known as Dysexecutive Syndrome (DS. There are many models concerning DS, although the literature on the subject still remains unclear. Several works appoint the effects brought by elderly life, as well as abuse of drugs and some psychopathologies. These factors are known to increase the distress of the frontal circuits and that could be associated to executive deficits. The effects of DS would compromise individuals in day-to-day routine, academic, social and labor fields. There is a growing body of studies trying to determine the causes, implications, associations and the best way to take care of these effects. This work intends to review DS, focusing on the most important fields related to this area, such as psychopathology associations, cognitive reserve, assessment and cognitive rehabilitation programs.

  2. Epigenetics: mechanisms and implications for diabetic complications.

    Science.gov (United States)

    Cooper, Mark E; El-Osta, Assam

    2010-12-10

    Epigenetic modifications regulate critical functions that underlie chromosome metabolism. Understanding the molecular changes to chromatin structure and the functional relationship with altered signaling pathways is now considered to represent an important conceptual challenge to explain diabetes and the phenomenon of metabolic or hyperglycemic memory. Although it remains unknown as to the specific molecular mechanisms whereby hyperglycemic memory leads to the development of diabetic vascular complications, emerging evidence now indicates that critical gene-activating epigenetic changes may confer future cell memories. Chemical modification of the H3 histone tail of lysine 4 and 9 has recently been identified with gene expression conferred by hyperglycemia. The persistence of these key epigenetic determinants in models of glycemic variability and the development of diabetic complications has been associated with these primary findings. Transient hyperglycemia promotes gene-activating epigenetic changes and signaling events critical in the development and progression of vascular complications. As for the role of specific epigenomic changes, it is postulated that further understanding enzymes involved in writing and erasing chemical changes could transform our understanding of the pathways implicated in diabetic vascular injury providing new therapeutic strategies.

  3. Science and religion: implications for science educators

    Science.gov (United States)

    Reiss, Michael J.

    2010-03-01

    A religious perspective on life shapes how and what those with such a perspective learn in science; for some students a religious perspective can hinder learning in science. For such reasons Staver's article is to be welcomed as it proposes a new way of resolving the widely perceived discord between science and religion. Staver notes that Western thinking has traditionally postulated the existence and comprehensibility of a world that is external to and independent of human consciousness. This has led to a conception of truth, truth as correspondence, in which our knowledge corresponds to the facts in this external world. Staver rejects such a conception, preferring the conception of truth as coherence in which the links are between and among independent knowledge claims themselves rather than between a knowledge claim and reality. Staver then proposes constructivism as a vehicle potentially capable of resolving the tension between religion and science. My contention is that the resolution between science and religion that Staver proposes comes at too great a cost—both to science and to religion. Instead I defend a different version of constructivism where humans are seen as capable of generating models of reality that do provide richer and more meaningful understandings of reality, over time and with respect both to science and to religion. I argue that scientific knowledge is a subset of religious knowledge and explore the implications of this for science education in general and when teaching about evolution in particular.

  4. Enamel Pearls Implications on Periodontal Disease

    Directory of Open Access Journals (Sweden)

    Elton Gonçalves Zenóbio

    2015-01-01

    Full Text Available Dental anatomy is quite complex and diverse factors must be taken into account in its analysis. Teeth with anatomical variations present an increase in the rate of severity periodontal tissue destruction and therefore a higher risk of developing periodontal disease. In this context, this paper reviews the literature regarding enamel pearls and their implications in the development of severe localized periodontal disease as well as in the prognosis of periodontal therapy. Radiographic examination of a patient complaining of pain in the right side of the mandible revealed the presence of a radiopaque structure around the cervical region of lower right first premolar. Periodontal examination revealed extensive bone loss since probing depths ranged from 7.0 mm to 9.0 mm and additionally intense bleeding and suppuration. Surgical exploration detected the presence of an enamel pearl, which was removed. Assessment of the remaining supporting tissues led to the extraction of tooth 44. Local factors such as enamel pearls can lead to inadequate removal of the subgingival biofilm, thus favoring the establishment and progression of periodontal diseases.

  5. Implications of recurrent disturbance for genetic diversity.

    Science.gov (United States)

    Davies, Ian D; Cary, Geoffrey J; Landguth, Erin L; Lindenmayer, David B; Banks, Sam C

    2016-02-01

    Exploring interactions between ecological disturbance, species' abundances and community composition provides critical insights for ecological dynamics. While disturbance is also potentially an important driver of landscape genetic patterns, the mechanisms by which these patterns may arise by selective and neutral processes are not well-understood. We used simulation to evaluate the relative importance of disturbance regime components, and their interaction with demographic and dispersal processes, on the distribution of genetic diversity across landscapes. We investigated genetic impacts of variation in key components of disturbance regimes and spatial patterns that are likely to respond to climate change and land management, including disturbance size, frequency, and severity. The influence of disturbance was mediated by dispersal distance and, to a limited extent, by birth rate. Nevertheless, all three disturbance regime components strongly influenced spatial and temporal patterns of genetic diversity within subpopulations, and were associated with changes in genetic structure. Furthermore, disturbance-induced changes in temporal population dynamics and the spatial distribution of populations across the landscape resulted in disrupted isolation by distance patterns among populations. Our results show that forecast changes in disturbance regimes have the potential to cause major changes to the distribution of genetic diversity within and among populations. We highlight likely scenarios under which future changes to disturbance size, severity, or frequency will have the strongest impacts on population genetic patterns. In addition, our results have implications for the inference of biological processes from genetic data, because the effects of dispersal on genetic patterns were strongly mediated by disturbance regimes.

  6. Biological behaviour and clinical implications of micrometastases.

    LENUS (Irish Health Repository)

    Kell, M R

    2012-02-03

    BACKGROUND: The most important prognostic determinant in cancer is the identification of disseminated tumour burden (metastases). Micrometastases are microscopic (smaller than 2 mm) deposits of malignant cells that are segregated spatially from the primary tumour and depend on neovascular formation (angiogenesis) to propagate. METHODS: The electronic literature (1966 to present) on micrometastases and their implications in malignant melanoma and epithelial cancers was reviewed. RESULTS: Immunohistochemical techniques combined with serial sectioning offer the best accuracy for detection of nodal micrometastases. Molecular techniques should be reserved for blood samples or bone marrow aspirates. Detection of micrometastases in regional lymph nodes and\\/or bone marrow confers a poor prognosis in epithelial cancers. The concept of sentinel node biopsy combined with serial sectioning and dedicated screening for micrometastases may improve staging procedures. Strategies against angiogenesis may provide novel therapies to induce and maintain micrometastatic dormancy. CONCLUSION: The concept of micrometastases has resulted in a paradigm shift in the staging of epithelial tumours and our overall understanding of malignant processes.

  7. Amazonian foods and implications for human biology.

    Science.gov (United States)

    Dufour, Darna L; Piperata, Barbara A; Murrieta, Rui S S; Wilson, Warren M; Williams, Drake D

    2016-07-01

    Diets of subsistence-based Amazonian populations have been linked to local resources, but are changing with market penetration. To review the available data on traditional Amazonian foods and diets and evaluate their implications for human biology as a step toward understanding nutrition transitions in the region. This study used the Human Relations Area Files for information on the diets of Amerindian groups in the Amazon Basin from 1950 to the present, and used other published sources and the authors' own data. Data on food use was identified for only nine groups and dietary intake data for individuals in only three of the groups. A diet based on starchy staples (manioc and plantains) and fish, supplemented with a limited variety of other plant and animal foods, was found. Bitter manioc-based foods were associated with the consumption of cyanogens and fish with the consumption of mercury. Diets of adults appear to be adequate in energy and protein and low in fats. Children's diets were not well documented. Based on the limited available data, Amazonian diets are restricted in variety, but appear to be adequate in energy and protein for adults, but likely insufficiently nutrient-dense for children.

  8. Big Data: Implications for Health System Pharmacy.

    Science.gov (United States)

    Stokes, Laura B; Rogers, Joseph W; Hertig, John B; Weber, Robert J

    2016-07-01

    Big Data refers to datasets that are so large and complex that traditional methods and hardware for collecting, sharing, and analyzing them are not possible. Big Data that is accurate leads to more confident decision making, improved operational efficiency, and reduced costs. The rapid growth of health care information results in Big Data around health services, treatments, and outcomes, and Big Data can be used to analyze the benefit of health system pharmacy services. The goal of this article is to provide a perspective on how Big Data can be applied to health system pharmacy. It will define Big Data, describe the impact of Big Data on population health, review specific implications of Big Data in health system pharmacy, and describe an approach for pharmacy leaders to effectively use Big Data. A few strategies involved in managing Big Data in health system pharmacy include identifying potential opportunities for Big Data, prioritizing those opportunities, protecting privacy concerns, promoting data transparency, and communicating outcomes. As health care information expands in its content and becomes more integrated, Big Data can enhance the development of patient-centered pharmacy services.

  9. Surgical orodental implications in ankylosing spondylitis

    Directory of Open Access Journals (Sweden)

    Mohammad Mehdizadeh

    2012-01-01

    Full Text Available Temporomandibular joint and the pelvic complex are bidirectionally related. Ankylosing spondylitis (AS is a seronegative arthropathy with the key feature of bony fusion of lumbar vertebrae. A 39 year old known case of AS was presented to private office for left lower impacted third molar surgical removal. Previously, he was rejected to receive oral care for pulpectomy and extraction due to limited mouth opening. Prior to the surgery, lateral neck radiography was obtained to exclude any subluxation of fracture of cervical vertebrae. Neck was supported to insure neck stability during surgical forces. In addition, considering consumption of immunosuppressive medications including corticosteroids, procedure was performed with a great care, with attention to higher possibility of infection and fracture. Access to the surgical site was not desirable, though surgery accomplished without any significant event and the patient discharged with routine analgesic and antibiotics recommendation. Sometimes, impaired access to the oral cavity in patients with AS leads to receive suboptimal or minimal orodental care. Long list of dental implications in these patients may be simplified by considering of careful neck and jaw support, applying at least possible forces and great attention to the infection control rules. It is wised to be performed under patient and skilled hands.

  10. Big Data: Implications for Health System Pharmacy

    Science.gov (United States)

    Stokes, Laura B.; Rogers, Joseph W.; Hertig, John B.; Weber, Robert J.

    2016-01-01

    Big Data refers to datasets that are so large and complex that traditional methods and hardware for collecting, sharing, and analyzing them are not possible. Big Data that is accurate leads to more confident decision making, improved operational efficiency, and reduced costs. The rapid growth of health care information results in Big Data around health services, treatments, and outcomes, and Big Data can be used to analyze the benefit of health system pharmacy services. The goal of this article is to provide a perspective on how Big Data can be applied to health system pharmacy. It will define Big Data, describe the impact of Big Data on population health, review specific implications of Big Data in health system pharmacy, and describe an approach for pharmacy leaders to effectively use Big Data. A few strategies involved in managing Big Data in health system pharmacy include identifying potential opportunities for Big Data, prioritizing those opportunities, protecting privacy concerns, promoting data transparency, and communicating outcomes. As health care information expands in its content and becomes more integrated, Big Data can enhance the development of patient-centered pharmacy services. PMID:27559194

  11. Effects of Odor on Emotion, with Implications

    Directory of Open Access Journals (Sweden)

    Mikiko eKadohisa

    2013-10-01

    Full Text Available The sense of smell is found widely in the animal kingdom. Human and animal studies show that odor perception is modulated by experience and/or physiological state (such as hunger, and that some odors can arouse emotion, and can lead to the recall of emotional memories. Further, odors can influence psychological and physiological states. Individual odorants are mapped via gene-specified receptors to corresponding glomeruli in the olfactory bulb, which directly projects to the piriform cortex and the amygdala without a thalamic relay. The odors to which a glomerulus responds reflect the chemical structure of the odorant. The piriform cortex and the amygdala both project to the orbitofrontal cortex which with the amygdala is involved in emotion and associative learning, and to the entorhinal/hippocampal system which is involved in long-term memory including episodic memory. Evidence that some odors can modulate emotion and cognition is described, and the possible implications for the treatment of psychological problems, for example in reducing the effects of stress, are considered.

  12. Microbiological implications of the food irradiation process

    International Nuclear Information System (INIS)

    Teufel, P.

    1981-01-01

    The Joint FAO/IAEA/WHO Expert Committee on the wholesomeness of irradiated food which met in 1976 concluded after a detailed and critical review of the available information, that the microbiological aspects of food irradiation were fully comparable to those of conventional processes used in modern food technology. Processing of food by irradiation may be considered from the microbiological point of view as separate procedures: high dose treatment (> 10 kGy), for sterilisation (radappertization) and low dose treatment (< 10 kGy) for pasteurisation (radicidation, radurization), (for definitions see p. 43), disinfestation, or inhibition of sprouting. No public health hazards related to micro-organisms arise from high dose irradiation because this process results in commercially sterile products. On the other hand, it is important to consider the possible microbiological hazards when food is irradiated with a low dose. The microbiological implications relate to the natural radiation resistance of bacteria, yeasts, fungi and viruses or to the mutagenic effects of ionising radiation in micro-organisms. Both areas of concern were reviewed in detail by Ingram and Ingram and Farkas. (orig.)

  13. Healthcare quality improvement -- policy implications and practicalities.

    Science.gov (United States)

    Esain, Ann Elizabeth; Williams, Sharon J; Gakhal, Sandeep; Caley, Lynne; Cooke, Matthew W

    2012-01-01

    This article aims to explore quality improvement (QI) at individual, group and organisational level. It also aims to identify restraining forces using formative evaluation and discuss implications for current UK policy, particularly quality, innovation, productivity and prevention. Learning events combined with work-based projects, focusing on individual and group responses are evaluated. A total of 11 multi-disciplinary groups drawn from NHS England healthcare Trusts (self-governing operational groups) were sampled. These Trusts have different geographic locations and participants were drawn from primary, secondary and commissioning arms. Mixed methods: questionnaires, observations and reflective accounts were used. The paper finds that solution versus problem identification causes confusion and influences success. Time for problem solving to achieve QI was absent. Feedback and learning structures are often not in place or inflexible. Limited focus on patient-centred services may be related to past assumptions regarding organisational design, hence assumptions and models need to be understood and challenged. The authors revise the Plan, Do, Study; Act (PDSA) model by adding an explicit problem identification step and hence avoiding solution-focused habits; demonstrating the need for more formative evaluations to inform managers and policy makers about healthcare QI processes. - Although UK-centric, the quality agenda is a USA and European theme, findings may help those embarking on this journey or those struggling with QI.

  14. Practical implications of neutron survey instrument performance

    International Nuclear Information System (INIS)

    Tanner, R. J.; Bartlett, D. T.; Hager, I. G.; Jones, I. N.; Molinos, C.; Roberts, N. J.; Taylor, G. C.; Thomas, D. J.

    2004-01-01

    Improvements have been made to the Monte Carlo modelling used to calculate the response of the neutron survey instruments most commonly used in the UK, for neutron energies up to 20 MeV. The improved modelling of the devices includes the electronics and battery pack, allowing better calculations of both the energy and angle dependence of response. These data are used to calculate the response of the instruments in rotationally and fully isotropic, as well as unidirectional fields. Experimental measurements with radionuclide sources and monoenergetic neutron fields have been, and continue to be made, to test the calculated response characteristics. The enhancements to the calculations have involved simulation of the sensitivity of the response to variations in instrument manufacture, and will include the influence of the user and floor during measurements. The practical implications of the energy and angle dependence of response, variations in manufacture, and the influence of the user are assessed by folding the response characteristics with workplace energy and direction distributions. (authors)

  15. Cosmological implications of primordial black holes

    Science.gov (United States)

    Bernal, José Luis; Bellomo, Nicola; Raccanelli, Alvise; Verde, Licia

    2017-10-01

    The possibility that a relevant fraction of the dark matter might be comprised of Primordial Black Holes (PBHs) has been seriously reconsidered after LIGO's detection of a ~ 30 Msolar binary black holes merger. Despite the strong interest in the model, there is a lack of studies on possible cosmological implications and effects on cosmological parameters inference. We investigate correlations with the other standard cosmological parameters using cosmic microwave background observations, finding significant degeneracies, especially with the tilt of the primordial power spectrum and the sound horizon at radiation drag. However, these degeneracies can be greatly reduced with the inclusion of small scale polarization data. We also explore if PBHs as dark matter in simple extensions of the standard ΛCDM cosmological model induces extra degeneracies, especially between the additional parameters and the PBH's ones. Finally, we present cosmic microwave background constraints on the fraction of dark matter in PBHs, not only for monochromatic PBH mass distributions but also for popular extended mass distributions. Our results show that extended mass distribution's constraints are tighter, but also that a considerable amount of constraining power comes from the high-l polarization data. Moreover, we constrain the shape of such mass distributions in terms of the correspondent constraints on the PBH mass fraction.

  16. Environmental health implications of global climate change

    Energy Technology Data Exchange (ETDEWEB)

    Watson, Robert T.; Patz, Jonathan; Gubler, Duane J.; Parson, Edward A.; Vincent, James H.

    2005-07-01

    This paper reviews the background that has led to the now almost-universally held opinion in the scientific community that global climate change is occurring and is inescapably linked with anthropogenic activity. The potential implications to human health are considerable and very diverse. These include, for example, the increased direct impacts of heat and of rises in sea level, exacerbated air and water-borne harmful agents, and - associated with all the preceding - the emergence of environmental refugees. Vector-borne diseases, in particular those associated with blood-sucking arthropods such as mosquitoes, may be significantly impacted, including redistribution of some of those diseases to areas not previously affected. Responses to possible impending environmental and public health crises must involve political and socio-economic considerations, adding even greater complexity to what is already a difficult challenge. In some areas, adjustments to national and international public health practices and policies may be effective, at least in the short and medium terms. But in others, more drastic measures will be required. Environmental monitoring, in its widest sense, will play a significant role in the future management of the problem. (Author)

  17. The Greek crisis: Causes and implications

    Directory of Open Access Journals (Sweden)

    Vlamis Prodromos

    2010-01-01

    Full Text Available This paper presents and critically discusses the origins and causes of the Greek fiscal crisis and its implications for the euro currency as well as the SEE economies. In the aftermath of the 2007-2009 financial crisis the enormous increase in sovereign debt has emerged as an important negative outcome, since public debt was dramatically increased in an effort by the US and the European governments to reduce the accumulated growth of private debt in the years preceding the recent financial turmoil. Although Greece is the country member of the eurozone that has been in the middle of this ongoing debt crisis, since November 2009 when it was made clear that its budget deficit and mainly its public debt were not sustainable, Greece’s fiscal crisis is not directly linked to the 2007 US subprime mortgage loan market crisis. As a result of this negative downturn the Greek government happily accepted a rescue plan of 110 billion euros designed and financed by the European Union and the IMF. A lengthy austerity programme and a fiscal consolidation plan have been put forward and are to be implemented in the next three years.

  18. [Hepatitis E virus: Blood transfusion implications].

    Science.gov (United States)

    Gallian, P; Piquet, Y; Assal, A; Djoudi, R; Chiaroni, J; Izopet, J; Tiberghien, P

    2014-11-01

    Hepatitis E virus (HEV) is a non-enveloped RNA virus transmitted by the fecal-oral route. Autochthonous hepatitis E occurring in developed countries is caused by genotypes 3 and 4 and is a zoonotic infection. Humans are infected mostly after ingestion of undercooked meat from infected animals. Most HEV 3 and 4 infections are clinically inapparent. However, genotype 3 (HEV 3) can lead to chronic hepatitis in immuno-compromised patients such as organ-transplant recipients and patients with haematological malignancies. In Europe, HEV 3 is implicated in transfusion-transmitted HEV infection. In France, as observed in several European countries, prevalence of HEV RNA and specific IgG antibodies are high indicating that viral circulation is important. The systematic HEV NAT screening of blood donations used for preparation of solvent detergent plasma indicate that 1 to 2218 donation is infected by HEV RNA. The need or implementation's impacts of safety measures to prevent HEV transmission by blood transfusion are under reflexion by French's health authorities. The HEV NAT screening is the only available tool of prevention. Alternative strategies are under investigation including individual or mini pool NAT testing all or part of blood donations. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  19. Extremophile Diatoms: Implications to the Drake Equation

    Science.gov (United States)

    Sterrenburg, Frithjof A. S.; Hoover, Richard B.

    2011-01-01

    Diatoms are unicellular Eukaryotes that (as a group and phylogenetically) are not strictly regarded as extremophiles , since the vast majority of diatoms are mesophilic photoautotrophs. However, among the terrestrial Eukaryotes, diatoms are by far the single group of organisms with the ability to inhabit the greatest range of hostile environments on Earth. They are the dominant eukaryotes in the polar regions; in fumaroles, hot springs and geysers; and in hypersaline and hyperalkaline lakes and pools. Cryophilic species such as Fragilaria sublinearis and Chaetoceras fragilis are able to carry out respiration at extremely low rates at low temperatures in darkness. The Drake Equation refers to the likelihood of there being intelligent life at the technological level of electromagnetic communication. However, consideration of the range of conditions suitable for the habitability of eukaryotic diatoms and prokaryotic extremophiles, the likelihood that life exists elsewhere in the cosmos becomes many orders of magnitude greater than that predicted by the classical Drake Equation. In this paper we review the characteristics of diatoms as eukaryotic extremophiles and consider the implications to adjustments needed to the Drake Equation to assess the possibility that life exists elsewhere in the Universe.

  20. Implications of conformal invariance in momentum space

    Science.gov (United States)

    Bzowski, Adam; McFadden, Paul; Skenderis, Kostas

    2014-03-01

    We present a comprehensive analysis of the implications of conformal invariance for 3-point functions of the stress-energy tensor, conserved currents and scalar operators in general dimension and in momentum space. Our starting point is a novel and very effective decomposition of tensor correlators which reduces their computation to that of a number of scalar form factors. For example, the most general 3-point function of a conserved and traceless stress-energy tensor is determined by only five form factors. Dilatations and special conformal Ward identities then impose additional conditions on these form factors. The special conformal Ward identities become a set of first and second order differential equations, whose general solution is given in terms of integrals involving a product of three Bessel functions (`triple- K integrals'). All in all, the correlators are completely determined up to a number of constants, in agreement with well-known position space results. In odd dimensions 3-point functions are finite without renormalisation while in even dimensions non-trivial renormalisation in required. In this paper we restrict ourselves to odd dimensions. A comprehensive analysis of renormalisation will be discussed elsewhere. This paper contains two parts that can be read independently of each other. In the first part, we explain the method that leads to the solution for the correlators in terms of triple- K integrals while the second part contains a self-contained presentation of all results. Readers interested only in results may directly consult the second part of the paper.

  1. Human genetic information: the legal implications.

    Science.gov (United States)

    Brahams, D

    1990-01-01

    This paper provides a brief summary of some of the key legal issues raised by human genetic information and research as viewed from a British common law standpoint. The law is basically reactive rather than prospective and problems posed by futuristic medico-scientific discoveries are likely to be dealt with by reference to established legal principles and analogies made with decided cases. The acquisition and research into human genetic information in the form of DNA profiling may have wide-ranging legal implications. Human genetic information may provide an evidential tool in the legal process when the identity of a specific individual or his family connections and relationships are called into question. It may also pose problems of confidentiality which could conflict with a duty of disclosure. In the future it may be possible to identify a propensity to develop a disease which may be seriously disabling or terminal long before any symptoms are detectable. This sensitive information could be of considerable interest to any prospective employer, insurer, marriage partner or family member and is of serious concern to the individual himself. How far should or could such information lawfully be made available and to whom? Legal debates are also likely to focus on ownership of human genetic information, the patenting of techniques to unravel it, and therapies and medicines developed therefrom. The law will be invoked to safeguard any intellectual property which may exist and to patent any inventive steps in the field.(ABSTRACT TRUNCATED AT 250 WORDS)

  2. Relative age effect: implications for effective practice.

    Science.gov (United States)

    Andronikos, Georgios; Elumaro, Adeboye Israel; Westbury, Tony; Martindale, Russell J J

    2016-01-01

    Physical and psychological differences related to birthdate amongst athletes of the same selection year have been characterised as the "relative age effects" (RAEs). RAEs have been identified in a variety of sports, both at youth and adult level, and are linked with dropout of athletes and a reduction of the talent pool. This study examined the existence, mechanisms and possible solutions to RAEs using qualitative methodology. Seven experts in the field of talent identification and development were interviewed. Inductive analysis of the data showed that, while there was mixed evidence for the existence of RAEs across sports, the eradication of RAEs was attributed to controllable features of the development environment. The factors reported included the structure of "categories" used to group athletes within the sport (e.g. age, weight, size, skills), recognition and prioritisation of long-term development over "short term win focus." Education of relevant parties (e.g. coaches, scouts, clubs) about RAEs and the nature of "talent" within a long-term context was suggested, along with careful consideration of the structure of the development environment (e.g. delayed selection, provision for late developers, focus on skills not results, use of challenge). Implications for research and practice are discussed.

  3. Implications and Prospects of the GNEP

    International Nuclear Information System (INIS)

    Ryu, Jae-Soo; Lee, Byung-Wook; Lee, Han-Myung; Ko, Han-Suk; Lee, Kwang-Seok; Kim, Hak-Ro

    2008-01-01

    As increased recognition for a role of an economical carbon-free nuclear energy, it is expected that possibility for introduction and an expansion of nuclear power plants (NPPs) will be increased around the world,1) with pursuing self-reliant nuclear fuel cycle in certain states to secure assurances of nuclear fuel supply. However, the pursuit of sensitive nuclear technology such as enrichment and reprocessing has led to concerns about nuclear proliferation. The disclosure of nuclear black market has threatened the current global nonproliferation regime.2) To respond to these concerns, efforts have been made to overcome the loophole of the existing nuclear nonproliferation regime. In February 2004, US President Bush proposed that nuclear exporters refuse to transfer sensitive nuclear technology to prevent new states from producing fissile material to close a loophole in the NPT.3) Meanwhile as the amount of spent nuclear fuel (SNF) by once-through fuel cycle increases, the US needs multiple repositories by the end of the century.4) In February 2006, therefore, Bush administration announced the Global Nuclear Energy Partnership (GNEP), which can bring about expansion of nuclear energy including SNF management while decreasing the risk of nuclear proliferation. It is expected that the GNEP will have an effect on national nuclear programs of participating countries as well as nuclear international cooperation. In this regard, this paper discusses the implication of the GNEP and its prospects

  4. Environmental implications of increased biomass energy use

    Energy Technology Data Exchange (ETDEWEB)

    Miles, T.R. Sr.; Miles, T.R. Jr. (Miles (Thomas R.), Portland, OR (United States))

    1992-03-01

    This study reviews the environmental implications of continued and increased use of biomass for energy to determine what concerns have been and need to be addressed and to establish some guidelines for developing future resources and technologies. Although renewable biomass energy is perceived as environmentally desirable compared with fossil fuels, the environmental impact of increased biomass use needs to be identified and recognized. Industries and utilities evaluating the potential to convert biomass to heat, electricity, and transportation fuels must consider whether the resource is reliable and abundant, and whether biomass production and conversion is environmentally preferred. A broad range of studies and events in the United States were reviewed to assess the inventory of forest, agricultural, and urban biomass fuels; characterize biomass fuel types, their occurrence, and their suitability; describe regulatory and environmental effects on the availability and use of biomass for energy; and identify areas for further study. The following sections address resource, environmental, and policy needs. Several specific actions are recommended for utilities, nonutility power generators, and public agencies.

  5. The Implications of Deep Mitigation Pathways

    Science.gov (United States)

    Calvin, K. V.

    2016-12-01

    The 21st Conference of Parties to the UNFCCC agreement called for limiting climate change to "well below 2°C above pre-industrial levels and pursuing efforts to limit the temperature increase to 1.5°C." A climate target of 1.5°C places a stringent constraint on allowable emissions over the twenty-first century. Roegli et al. (2015) set that constraint at 200-415 GtCO2 between 2011 and 2100 for a likely chance of staying below 1.5°C in 2100. Limiting emissions to these levels requires that global emissions peak and decline over the coming decades, with net negative global emissions by mid-century. This level of decarbonization requires dramatic shifts in the energy and agricultural sectors, and comes at significant economic costs. This talk explores the effect of mitigating climate change to 1.5°C on the economy, energy system, and terrestrial system. We quantify the required deployment of various low carbon technologies, as well as the amount of existing capital that is abandoned in an effort to limit emissions. We show the shifts required in the terrestrial system, including its contribution to carbon sequestration through afforestation and bioenergy. Additionally, we show the implications of deep mitigation pathways on energy, food, and carbon prices. We contrast these results with a reference, no climate policy, world and a 2°C.

  6. Online customer experience: Implications for digital banking

    Directory of Open Access Journals (Sweden)

    Štavljanin Velimir

    2017-01-01

    Full Text Available Banks will be facing great challenges in the coming period. Some of these challenges are a lack of differentiation, disloyal customers, new non-traditional competitors, increased interaction and expectations from digital channels. Many consulting firms, but also the academic community, propose a solution in the form of implementing the concept of customer experience management. As research shows that a large number of challenges come from the online environment, it is necessary for banks to ensure excellence in the online environment by applying the concept of online customer experience. In order to create this experience, it is up to the banks to meet all the necessary antecedents, which can involve the elements in terms of control, processes and content. This can be a very difficult job if one is unfamiliar with the basics, but it could also be a rewarding job which will reflect on the business performance. Although the focus of the paper is online customer experience, even in the developed countries 'digital' customers are rare. Most of them are multichannel oriented and an important aspect is the multichannel integration and the strategy focused on customer experience. This paper presents an overview of the literature in the field of online customer experience, with the aim of introducing the public with the concept as well as presenting the implications which this concept has for digital banking.

  7. Conservation Documentation and the Implications of Digitisation

    Directory of Open Access Journals (Sweden)

    Michelle Moore

    2001-11-01

    Full Text Available Conservation documentation can be defined as the textual and visual records collected during the care and treatment of an object. It can include records of the object's condition, any treatment done to the object, any observations or conclusions made by the conservator as well as details on the object's past and present environment. The form of documentation is not universally agreed upon nor has it always been considered an important aspect of the conservation profession. Good documentation tells the complete story of an object thus far and should provide as much information as possible for the future researcher, curator, or conservator. The conservation profession will benefit from digitising its documentation using software such as databases and hardware like digital cameras and scanners. Digital technology will make conservation documentation more easily accessible, cost/time efficient, and will increase consistency and accuracy of the recorded data, and reduce physical storage space requirements. The major drawback to digitising conservation records is maintaining access to the information for the future; the notorious pace of technological change has serious implications for retrieving data from any machine- readable medium.

  8. Framework and implications of virtual neurorobotics

    Directory of Open Access Journals (Sweden)

    2008-07-01

    Full Text Available Despite decades of societal investment in artificial learning systems, truly “intelligent” systems have yet to be realized. These traditional models are based on input-output pattern optimization and/or cognitive production rule modeling. One response has been social robotics, using the interaction of human and robot to capture important cognitive dynamics such as cooperation and emotion; to date, these systems still incorporate traditional learning algorithms. More recently, investigators are focusing on the core assumptions of the brain “algorithm” itself—trying to replicate uniquely “neuromorphic” dynamics such as action potential spiking and synaptic learning. Only now are large-scale neuromorphic models becoming feasible, due to the availability of powerful supercomputers and an expanding supply of parameters derived from research into the brain’s interdependent electrophysiological, metabolomic and genomic networks. Personal computer technology has also led to the acceptance of computer-generated humanoid images, or “avatars”, to represent intelligent actors in virtual realities. In a recent paper, we proposed a method of virtual neurorobotics (VNR in which the approaches above (social-emotional robotics, neuromorphic brain architectures, and virtual reality projection are hybridized to rapidly forward-engineer and develop increasingly complex, intrinsically intelligent systems. In this paper, we synthesize our research and related work in the field and provide a framework for VNR, with wider implications for research and practical applications.

  9. Polycystic ovary syndrome: clinical implication in perimenopause

    Directory of Open Access Journals (Sweden)

    Monika Lenart-Lipińska

    2014-12-01

    Full Text Available Polycystic ovary syndrome (PCOS, a hyperandrogenic disorder, is the commonest endocrinopathy in premenopausal women. This syndrome is associated with fertility problems, clinical manifestations of hyperandrogenism and metabolic disturbances, particularly insulin resistance and obesity. There is a great body of evidence that patients with PCOS present multiple cardiovascular risk factors and cluster components of metabolic syndrome from early ages. The presence of comorbidities such as abdominal obesity, insulin resistance, type 2 diabetes, hypertension places these females at an increased risk of future cardiovascular events. However, the extent to which PCOS components are present in perimenopausal women and the degree to which PCOS increases various risk factors in addition to the known risk of the perimenopausal period have not been fully determined. The perimenopausal period per se is associated with weight gain and an increased cardiovascular risk, which may be additionally aggravated by the presence of metabolic disturbances connected with PCOS. The phenotype of PCOS may improve with aging and it is still uncertain whether the presence of PCOS significantly increases the cardiovascular risk later in women’s life. Most recent data suggest that the prevalence of cardiovascular diseases and the related long-term consequences in females with PCOS seem to be lower than expected. This manuscript reviews long-term consequences of PCOS and considers their clinical implications in perimenopause.

  10. Environmental implications and applications of engineered ...

    Science.gov (United States)

    This review focus on environmental implications and applications of engineered magnetite (Fe3O4) nanoparticles (MNPs) as a single phase or a component of a hybrid nanocomposite that take advantages of their superparamagnetism and high surface area. MNPs are synthesized via co-precipitation, thermal decomposition, hydrothermal process, emulsion, and microbial process. Aggregation/sedimentation and transport of MNPs depend on surface charge of MNPs and geochemical parameters such as pH, ionic strength, and organic matter. MNPs generally have low toxicity to humans and ecosystem. MNPs are used for making excellent anode electrode materials in lithium-ion battery, for constructing biosensors, and for catalyzing a variety of chemical reactions. MNPs are used for air cleanup and carbon sequestration. MNP nanocomposites are made as antimicrobial agent for water disinfection and flocculants for water treatment. Conjugated MNPs are widely used for adsorptive/separative removal of organics, dye, oil, arsenic, Cr(VI), heavy metals, radionuclides, and rare earth elements. MNPs can degrade organic/inorganic contaminants via chemical reduction or oxidation in water, sediment, and soil. Future studies should further explore mechanisms of MNP interactions with other nanomaterials and contaminants, economic and green approaches of MNP synthesis, and field scale demonstration of MNP utilization. Submit to Journal of Hazardous Materials.

  11. The public health implications of melioidosis

    Directory of Open Access Journals (Sweden)

    Timothy J.J. Inglis

    Full Text Available Melioidosis, which is caused by the bacterium Burkholderia pseudomallei, is a potentially fatal tropical infection, little known outside its main endemic zone of Southeast Asia and northern Australia. Though it has received more attention in recent years on account of its claimed suitability as a biological weapon agent, the principal threat from melioidosis is a result of naturally occurring events. Occasional case clusters, sporadic cases outside the known endemic zone and infections in unusual demographic groups highlight a changing epidemiology. As melioidosis is the result of an environmental encounter and not person-to-person transmission, subtle changes in its epidemiology indicate a role environmental factors, such as man-made disturbances of soil and surface water. These have implications for travel, occupational and tropical medicine and in particular for risk assessment and prevention. Practical problems with definitive laboratory diagnosis, antibiotic treatment and the current lack of a vaccine underline the need for prevention through exposure avoidance and other environmental health measures. It is likely that the increasing population burden of the tropical zone and extraction of resources from the humid tropics will increase the prevalence of melioidosis. Climate change-driven extreme weather events will both increase the prevalence of infection and gradually extend its main endemic zone.

  12. Clinical Ethics Consultation After God: Implications for Advocacy and Neutrality.

    Science.gov (United States)

    Parker, J Clint

    2017-10-24

    In After God: Morality and Bioethics in a Secular Age, H. Tristram Engelhardt, Jr. explores the broad implications for moral reasoning once a culture has lost a God's-eye perspective. In this paper, I focus on the implications of Engelhardt's views for clinical ethics consultation. I begin by examining the question of whether clinical ethics consultants (CECs) should advocate a particular viewpoint and/or process during consultations or adopt a neutral stance. I then examine the implications of Engelhardt's views for this question. Finally, I discuss some of Engelhardt's foundational ontological, metaphysical, meta-ethical, and epistemological commitments and how these commitments connect to his views on clinical ethics consultation.

  13. Learning Culture, Spirituality and Local Knowledge: Implications for African Schooling

    Science.gov (United States)

    Sefa Dei, George J.

    2002-09-01

    (Learning, Culture, Spirituality and Local Knowedge: Implications for African Schooling) - Using a Ghanaian case study, this paper looks at the relevance and implications of local knowledge, culture and spirituality for understanding and implementing educational change in Africa. It examines how teachers, educators, and students use local cultural knowledge about self, personhood and community. Among the critical issues raised are: How do subjects understand the nature, impact and implications of spirituality for schooling and education? What is the role of spirituality, culture, language and social politics in knowledge production? What contribution does the local cultural knowledge base make to the search for genuine educational options in Africa?

  14. Cash balance pension plans--accounting and business implications.

    Science.gov (United States)

    Arcady, A; Mellors, F

    2001-01-01

    This article illustrates the accounting and disclosure implications of converting from traditional pensions to cash balance plans. That information is followed by a description of issues that have encouraged employers to initiate those conversions.

  15. Automation of micro finance institutions in Nigeria: Implication for the ...

    African Journals Online (AJOL)

    IT) and performance. Taking a cue from Diffusion of Information theory, the perception of stakeholders in microfinance institutions on the ITimpact on service delivery in the MFBs and the implications for the Accountants is worthy of exploration.

  16. The use of dexamethasone in animals: implication for fertility ...

    African Journals Online (AJOL)

    Exposure to dexamethasone causes numerous changes in various biological systems including the reproductive system and this has huge implication on fertility and pregnancy. Maternal dexamethasone administration promotes foetal lung maturation and thermoregulation in premature foetuses. This indication makes ...

  17. Exploring Marital Satisfaction among Graduate Students: Implications for Service Delivery

    Science.gov (United States)

    Gold, Joshua M.

    2006-01-01

    This article provides a synopsis of the theoretical and empirical literature describing the effects of graduate study on marital satisfaction. These findings offer implications for psychoeducational and responsive interventions for family counselors working with this population.

  18. The Epidemiological Transition: Policy and Planning Implications for ...

    African Journals Online (AJOL)

    The key words employed were: Epidemiological Transition with particular emphasis on policy and planning implications in developing countries. Several studies have outlined definitions, stages and historical perspectives of epidemiological transition, as well as the scenarios in developed and developing countries.

  19. Expertise development in the professions; Implications for teaching and assessment

    NARCIS (Netherlands)

    Boshuizen, Els

    2011-01-01

    Boshuizen, H. P. A. (2011, 30 August - 3 September). Expertise development in the professions; Implications for teaching and assessment. Paper presented at the bi-annual EARLI conferences, Exeter, UK.

  20. The Internet and Trends in Vocabulary Development: Implications ...

    African Journals Online (AJOL)

    registers and coinages and their implications in teacher education programmes. With stratified randomized sampling technique, a quantitative and qualitative survey was conducted on thirty (30) lecturers and forty (40) English Language teachers ...

  1. Theory of Multiple Intelligences: Implications for Higher Education.

    Science.gov (United States)

    Kezar, Adrianna

    2001-01-01

    Reviews implications of Gardner's theory of multiple intelligences for higher education: responding to increased access, the necessity of meeting the needs of diverse users, and the accountability movement. (EV)

  2. Dependence on carbonated water: Clinical and policy implications

    Directory of Open Access Journals (Sweden)

    Sumit Kumar Gupta

    2015-01-01

    Full Text Available A case of caffeine dependence syndrome with preference for a specific brand of carbonated water (popularly known as soft drinks or colas is discussed to highlight the clinical and policy implications.

  3. Climate Change: Implications for South African Building Systems and Components

    CSIR Research Space (South Africa)

    Gibberd, Jeremy T

    2017-12-01

    Full Text Available to determine the implications of these changes for buildings. Proposals are made on how buildings may be adapted to climate change and recommendations on further research and development are outlined....

  4. Structuralism: Its Implications for the Performance of Prose Fiction

    Science.gov (United States)

    Hopkins, Mary Francis

    1977-01-01

    Discusses the implications of structuralism by examining "Introduction to The Structural Analysis of Narrative", a contemporary writing by Roland Barthes. Explains Barthes' terms and concepts by using Virginia Woolf's Mrs. Dalloway character for an example. (MH)

  5. On power idealization filter topologies of lattice implication algebras.

    Science.gov (United States)

    Bai, Shi-Zhong; Wu, Xiu-Yun

    2014-01-01

    The aim of this paper is to introduce power idealization filter topologies with respect to filter topologies and power ideals of lattice implication algebras, and to investigate some properties of power idealization filter topological spaces and their quotient spaces.

  6. Medicare Part D Roulette, Potential Implications of Random..

    Data.gov (United States)

    U.S. Department of Health & Human Services — Medicare Part D Roulette, Potential Implications of Random Assignment and Plan Restrictions Dual-eligible (Medicare and Medicaid) beneficiaries are randomly assigned...

  7. Democracy and Violent Conflicts in Nigeria: Implications for National ...

    African Journals Online (AJOL)

    First Lady

    /afrrev.v7i3.23. Democracy and Violent Conflicts in Nigeria: Implications for National Development. Joshua, Segun - Department of Political Science and International. Relations, College of Development Studies, Covenant University, Ota, Ogun.

  8. Willingness to pay for rural telephone services: Implications for rural ...

    African Journals Online (AJOL)

    WTP) for rural telephone services and the implications on poverty reduction in Southeast Nigeria. The key research problem was the inability of the telephone providers or regulatory agencies to estimate the amount the people were willing to pay ...

  9. The Transatlantic Defense Industrial Base: Restructuring Scenarios and Their Implications

    National Research Council Canada - National Science Library

    Guay, Terrence R

    2005-01-01

    This monograph compares the post-Cold War restructuring of the defense industries in the United States and Europe with the aim of understanding the implications for the transatlantic industrial base...

  10. Implications of climate change for tourism in Australia

    NARCIS (Netherlands)

    Amelung, B.; Nicholls, S.

    2014-01-01

    This study assesses the impacts of projected climate change on Australia's tourism industry. Based on application of the Tourism Climatic Index, it investigates potential changes in climatic attractiveness for Australia's major destinations, and discusses implications for tourist flows and tourism

  11. Advances in Seabed Liquefaction and its Implications for Marine Structures

    DEFF Research Database (Denmark)

    Sumer, B. Mutlu

    2013-01-01

    A review is presented of recent advances in seabed liquefaction and its implications for marine structures. The review is organized in seven sections: Residual liquefaction, including the sequence of liquefaction, mathematical modelling, centrifuge modelling and comparison with standard wave...

  12. The Chemical Weapons Convention: Strategic Implications for the United States

    National Research Council Canada - National Science Library

    Vogel, Frederick

    1997-01-01

    ... the U.S. national security interest. The author explores the historical, moral, and legal aspects of chemical warfare, and the strategic implications of the convention, including operational, policy, Constitutional, and industry impact...

  13. Propositions regarding Autodidactic Learning and Their Implications for Teaching.

    Science.gov (United States)

    Danis, Claudia; Tremblay, Nicole A.

    1987-01-01

    The authors highlight major new propositions that were inferred from a study of autodidactic learning experiences. They suggest corresponding implications for practice in a formal educational setting. Topics include motivation, goals, specialization, monitoring of the learning process, and reflection. (CH)

  14. Fractures in children with Pompe disease: a potentiallong-term complication

    Energy Technology Data Exchange (ETDEWEB)

    Case, Laura E. [Duke University Medical Center, Division of Physical Therapy, Department of Community and Family Medicine, Durham, NC (United States); Hanna, Rabi; DeArmey, Stephanie; Mackey, Joanne; Boney, Anne; Chen, Yuan-Tsong; Kishnani, Priya S. [Duke University Medical Center, Department of Pediatrics, Durham, NC (United States); Frush, Donald P. [Duke University Medical Center, Department of Radiology, Durham, NC (United States); Krishnamurthy, Vidya [Duke University Medical Center, Department of Pediatrics and Department of Medicine, Durham, NC (United States); Morgan, Claire; Bouchard, Susan [Genzyme Corporation, Pharmacovigilance, Cambridge, MA (United States); Corzo, Deyanira [Genzyme Corporation, Cambridge, MA (United States); Weber, Thomas J. [Duke University Medical Center, Department of Medicine, Durham, NC (United States)

    2007-05-15

    Pompe disease (glycogen storage disease type II or acid maltase deficiency) is an autosomal recessive disorder caused by deficiency of the lysosomal enzyme acid {alpha}-glucosidase (GAA). Classic infantile-onset disease, characterized by cardiomegaly and profound weakness, leads to death in the first year of life from cardiorespiratory failure. Reversal of cardiomyopathy and improved motor function have been shown in clinical trials of rhGAA enzyme replacement therapy (ERT) with alglucosidase alfa (Myozyme), recently approved for clinical use. Increased survival potentially unmasks long-term complications of this previously lethal disease, including risk of skeletal fracture, recently identified at our institution and not previously reported in children with Pompe disease. To report the risk of fracture in children with Pompe disease with increased survival with ERT. We present four cases of fracture in patients with classic infantile Pompe disease treated with ERT at our institution, and review a study database for additional reports of fracture in this population. We review 19 fractures in 14 children with Pompe disease on ERT. Radiologists should be familiar with and vigilant for the association of fractures and increased survival on ERT in children with Pompe disease. We discuss potential mechanisms, implications for radiographic surveillance, potential intervention, and needs for further research. (orig.)

  15. Diabetes Management and Hypoglycemia in Safety Sensitive Jobs

    Directory of Open Access Journals (Sweden)

    See-Muah Lee

    2011-03-01

    Full Text Available The majority of people diagnosed with diabetes mellitus are in the working age group in developing countries. The interrelationship of diabetes and work, that is, diabetes affecting work and work affecting diabetes, becomes an important issue for these people. Therapeutic options for the diabetic worker have been developed, and currently include various insulins, insulin sensitizers and secretagogues, incretin mimetics and enhancers, and alpha glucosidase inhibitors. Hypoglycemia and hypoglycaemic unawareness are important and unwanted treatment side effects. The risk they pose with respect to cognitive impairment can have safety implications. The understanding of the therapeutic options in the management of diabetic workers, blood glucose awareness training, and self-monitoring blood glucose will help to mitigate this risk. Employment decisions must also take into account the extent to which the jobs performed by the worker are safety sensitive. A risk assessment matrix, based on the extent to which a job is considered safety sensitive and based on the severity of the hypoglycaemia, may assist in determining one's fitness to work. Support at the workplace, such as a provision of healthy food options and arrangements for affected workers will be helpful for such workers. Arrangements include permission to carry and consume emergency sugar, flexible meal times, self-monitoring blood glucose when required, storage/disposal facilities for medicine such as insulin and needles, time off for medical appointments, and structured self-help rogams.

  16. CHO Quasispecies—Implications for Manufacturing Processes

    Directory of Open Access Journals (Sweden)

    Florian M. Wurm

    2013-10-01

    Full Text Available Chinese hamster ovary (CHO cells are a source of multi-ton quantities of protein pharmaceuticals. They are, however, immortalized cells, characterized by a high degree of genetic and phenotypic diversity. As is known for any biological system, this diversity is enhanced by selective forces when laboratories (no sharing of gene pools grow cells under (diverse conditions that are practical and useful. CHO cells have been used in culture for more than 50 years, and various lines of cells are available and have been used in manufacturing. This article tries to represent, in a cursory way, the history of CHO cells, particularly the origin and subsequent fate of key cell lines. It is proposed that the name CHO represents many different cell types, based on their inherent genetic diversity and their dynamic rate of genetic change. The continuing remodeling of genomic structure in clonal or non-clonal cell populations, particularly due to the non-standardized culture conditions in hundreds of different labs renders CHO cells a typical case for “quasispecies”. This term was coined for families of related (genomic sequences exposed to high mutation rate environments where a large fraction of offspring is expected to carry one or more mutations. The implications of the quasispecies concept for CHO cells used in protein manufacturing processes are significant. CHO genomics/transcriptomics may provide only limited insights when done on one or two “old” and poorly characterized CHO strains. In contrast, screening of clonal cell lines, derived from a well-defined starting material, possibly within a given academic or industrial environment, may reveal a more narrow diversity of phenotypes with respect to physiological/metabolic activities and, thus, allow more precise and reliable predictions of the potential of a clone for high-yielding manufacturing processes.

  17. Oceanic implications for climate change policy

    International Nuclear Information System (INIS)

    McNeil, Ben I.

    2006-01-01

    Under the United Nations convention on the law of the sea (1982), each participating country maintains exclusive economic and environmental rights within the oceanic region extending 200 nm from its territorial sea, known as the exclusive economic zone (EEZ). Although the ocean within each EEZ is undoubtedly an anthropogenic CO 2 sink, it has been over-looked within international climate policy. In this paper I use an area-weighted scaling argument to show that the inclusion of the EEZ CO 2 sink within national carbon accounts would have significant implications in tracking national greenhouse commitments to any future climate change policy initiative. The advantages and disadvantages for inclusion of the EEZ CO 2 sink into global climate change policy are also explored. The most compelling argument for including the EEZ CO 2 sink is that it would enhance the equity and resources among coastal nations to combat and adapt against future climate change that will inherently impact coastal nations more so than land locked nations. If included, the funds raised could be used for either monitoring or adaptive coastal infrastructure among the most vulnerable nations. On the other hand, the EEZ anthropogenic CO 2 sink cannot be directly controlled by human activities and could be used as a disincentive for some developed nations to reduce fossil-fuel related greenhouse gas emissions. This may therefore dampen efforts to ultimately reduce atmospheric greenhouse gas concentrations. In consideration of these arguments it is therefore suggested that an 'EEZ clause' be added to Kyoto and any future international climate policy that explicitly excludes its use within national carbon accounts under these international climate frameworks

  18. Dental implications in oral cancer patients.

    Science.gov (United States)

    Escoda-Francolí, Jaume; Rodríguez-Rodríguez, Araceli; Pérez-García, Silvia; Gargallo-Albiol, Jordi; Gay-Escoda, Cosme

    2011-07-01

    A study is made of the dental implications of oral cancer, with a view to avoiding the complications that appear once oncological treatment is started. The study comprised a total of 22 patients diagnosed with oral cancer according to clinical and histological criteria in the Service of Maxillofacial Surgery (Dental Clinic of the University of Barcelona, Spain) during the period 1996-2005, and posteriorly treated in different hospital centers in Barcelona. Of the 22 patients diagnosed with oral cancer in our Service, the present study finally analyzed the 12 subjects who reported for the dental controls. As regards the remaining 10 patients, 5 had died and 5 could not be located; these subjects were thus excluded from the analysis. All of the smokers had abandoned the habit. The most common tumor location was the lateral margin of the tongue. None of the patients visited the dentist regularly before the diagnosis of oral cancer. T1N0M0 was the most common tumor stage. Surgery was carried out in 50% of the cases, while 8.4% of the patients received radiotherapy and 41.6% underwent surgery with postoperative radiotherapy. In turn, 66.6% of the patients reported treatment sequelae such as dysgeusia, xerostomia or speech difficulties, and one patient suffered osteoradionecrosis. Forty-one percent of the patients did not undergo regular dental controls after cancer treatment. As regards oral and dental health, 16.6% presented caries, and 50% had active periodontal disease. Protocols are available for preventing the complications of oral cancer treatment, and thus for improving patient quality of life. However, important shortcomings in the application of such protocols on the part of the public health authorities make it difficult to reach these objectives.

  19. The endocannabinoid system and cancer: therapeutic implication.

    Science.gov (United States)

    Guindon, Josée; Hohmann, Andrea G

    2011-08-01

    The endocannabinoid system is implicated in a variety of physiological and pathological conditions (inflammation, immunomodulation, analgesia, cancer and others). The main active ingredient of cannabis, Δ(9) -tetrahydrocannabinol (Δ(9) -THC), produces its effects through activation of CB(1) and CB(2) receptors. CB(1) receptors are expressed at high levels in the central nervous system (CNS), whereas CB(2) receptors are concentrated predominantly, although not exclusively, in cells of the immune system. Endocannabinoids are endogenous lipid-signalling molecules that are generated in the cell membrane from phospholipid precursors. The two best characterized endocannabinoids identified to date are anandamide (AEA) and 2-arachidonoylglycerol (2-AG). Here we review the relationship between the endocannabinoid system and anti-tumour actions (inhibition of cell proliferation and migration, induction of apoptosis, reduction of tumour growth) of the cannabinoids in different types of cancer. This review will focus on examining how activation of the endocannabinoid system impacts breast, prostate and bone cancers in both in vitro and in vivo systems. The therapeutic potential of cannabinoids for cancer, as identified in clinical trials, is also discussed. Identification of safe and effective treatments to manage and improve cancer therapy is critical to improve quality of life and reduce unnecessary suffering in cancer patients. In this regard, cannabis-like compounds offer therapeutic potential for the treatment of breast, prostate and bone cancer in patients. Further basic research on anti-cancer properties of cannabinoids as well as clinical trials of cannabinoid therapeutic efficacy in breast, prostate and bone cancer is therefore warranted. © 2011 The Authors. British Journal of Pharmacology © 2011 The British Pharmacological Society.

  20. BUSINESS OFFSHORING IMPLICATIONS ON THE LABOUR MARKET

    Directory of Open Access Journals (Sweden)

    SERGHEI MARGULESCU

    2012-05-01

    Full Text Available In terms of economic policy, three new aspects are important in the current context of globalization which brings forward new strategies regarding the outsourcing and offshoring of activities and functions of the value chain. These aspects refer to the instant appearance of an offshore transferable function , to the unpredictability of winning and losing functions and to the lowering of competition from the levels of sector, company or professional qualification category to an individual level. Of the three features, the most problematic for policy makers is the unpredictability of the impact of globalization. For example, in Europe we can not reasonably believe that workers in the most competitive sectors will be in a position of winners, nor that these winners will be the most prepared or trained in analytical functions. Many European workers currently work at prices fixed by the local market and not covered by productivity. But when the competition on functions will expand through globalization outside the country or area, their choices will be either a job loss or a reduction in salary. The question that will be raised ever insistently will be the following: what jobs are more exposed to this new competition? On the one hand, offshoring is on balance positive for Western economies, because it makes domestic companies more competitive. At the same time the material outsourcing is, for most developed economies, much more important than the outsourcing of services and the implications for labor market must be objectively differentiated in the two sectors. On the other hand, if we take into account the amplification of the effects that offshoring already has on the structure and distribution of labor, the socio-economic European policy of labor orientation to the coordinates of a "knowledge based" economy and to the jobs of the "information society" could be wrong.

  1. The skinny on tuna fat: health implications.

    Science.gov (United States)

    Maqbool, Asim; Strandvik, Birgitta; Stallings, Virginia A

    2011-11-01

    Dietary n-3 (omega-3) and n-6 (omega-6) PUFA have significant implications in health and disease prevention. Marine life is rich in long-chain n-3 PUFA. Children and adults in North America are reluctant fish eaters; canned tuna is a common fish in children's diets. Although a multitude of tuna products are available, their respective PUFA contents have not been well described. The aim of the present study was to compare the fatty acid (FA) profiles of different commercially available US tuna products. Fat and FA composition of eight products randomly selected from two US suppliers were analysed with capillary GC after lipid extraction. Large north-eastern US grocery store chain. Canned tuna. Energy from fat varied from 3 to 33 % and the essential FA (EFA) linoleic acid (18 : 2n-6) and α-linolenic acid (18 : 3n-3) varied tenfold. DHA varied between 90 and 770 mg/serving. The n-6:n-3 ratio was 3:1-4:1 in oil-packaged products, 2:1-7:1 in packaged tuna salads and 1:3-1:7 in water-packaged products. A similar magnitude of differences was seen in the ratio between arachidonic acid (20 : 4n-6) and DHA. Light tuna canned in water may be a better choice of providing n-3 PUFA to individuals in a healthy population, whereas oil-packaged products may be preferable for those individuals with a need for increased EFA, such as for patients with cystic fibrosis. Awareness regarding PUFA content may aid in consumer product choices and health-care provider advice.

  2. Definitions of fuel poverty: Implications for policy

    International Nuclear Information System (INIS)

    Moore, Richard

    2012-01-01

    This paper outlines why the definition of fuel poverty is important in policy formulation and describes how the Government's current definitions evolved from the original concept. It discusses the determination of income and fuel costs and the possibilities for a relative and common European measure. It examines problems inherent in assessing fuel costs as a percentage of income and puts forward the arguments for a ‘budget standard’ approach. The paper illustrates how the size of the problem depends on the definition and chosen threshold and suggests advantages for a rating scale. It illustrates how the income composition and thresholds also govern the distribution of the target populations and the relative importance of the main causal factors, and examines the consequent policy implications. It explores the definition of vulnerable households and the importance of severity and questions whether the UK fuel poverty strategy is targeted at households least able to afford their fuel costs (as the name implies) or primarily those at risk from excess winter and summer mortality and morbidity. Finally, after examining the role of supplementary indicators, it looks at the opportunities for changing the definition and comments on the Government review of the definition and targets. - Highlights: ► There are major failings in the existing official definitions of fuel poverty. ► expressing fuel costs as a percentage of income is a poor indicator of fuel poverty. ► A budget standard approach provides a more consistent, meaningful and fairer measure. ► The scale and nature of the problem changes dramatically with different definitions. ► The definition is crucial to the mix of policies and allocation of resources required.

  3. Neurobiology and clinical implications of lucid dreaming.

    Science.gov (United States)

    Mota-Rolim, Sérgio A; Araujo, John F

    2013-11-01

    Several lines of evidence converge to the idea that rapid eye movement sleep (REMS) is a good model to foster our understanding of psychosis. Both REMS and psychosis course with internally generated perceptions and lack of rational judgment, which is attributed to a hyperlimbic activity along with hypofrontality. Interestingly, some individuals can become aware of dreaming during REMS, a particular experience known as lucid dreaming (LD), whose neurobiological basis is still controversial. Since the frontal lobe plays a role in self-consciousness, working memory and attention, here we hypothesize that LD is associated with increased frontal activity during REMS. A possible way to test this hypothesis is to check whether transcranial magnetic or electric stimulation of the frontal region during REMS triggers LD. We further suggest that psychosis and LD are opposite phenomena: LD as a physiological awakening while dreaming due to frontal activity, and psychosis as a pathological intrusion of dream features during wake state due to hypofrontality. We further suggest that LD research may have three main clinical implications. First, LD could be important to the study of consciousness, including its pathologies and other altered states. Second, LD could be used as a therapy for recurrent nightmares, a common symptom of depression and post-traumatic stress disorder. Finally, LD may allow for motor imagery during dreaming with possible improvement of physical rehabilitation. In all, we believe that LD research may clarify multiple aspects of brain functioning in its physiological, altered and pathological states. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

  4. Brain microbleeds: Epidemiology and clinical implications.

    Science.gov (United States)

    Boyano, I; Bravo, N; Miranda, J; Gil-Gregorio, P; Olazarán, J

    2016-06-22

    Brain microbleeds (BMB) are haemosiderin deposits contained within macrophages, which are displayed as hypointense images in some T2-weighted magnetic resonance imaging sequences. There are still many questions to be answered about the pathophysiology and clinical relevance of BMB. We conducted a literature review of the main epidemiological, clinical, and anatomical pathology studies of BMB performed in the general population, in patients at risk of or already suffering from a vascular disease, and in patients with cognitive impairment. We analysed the prevalence of BMB, risk factors, and potential pathophysiological mechanisms and clinical implications. The prevalence of BMB is highly variable (3%-27% in the general population, 6%-80% in patients with vascular risk factors or vascular disease, and 16%-45% in patients with cognitive impairment). BMB are associated with ageing, Alzheimer disease (AD), and in particular haemorrhagic or ischaemic cerebrovascular disease. The pathological substrate of BMB is either lipohyalinosis (subcortical BMB) or cerebral amyloid angiopathy (lobar BMB). BMB exacerbate cognitive impairment, possibly through cortical-subcortical and intracortical disconnection, and increase the risk of death, mostly due to vascular causes. BMB also increase the risk of cerebral haemorrhage, particularly in patients with multiple lobar BMB (probable erebral amyloid angiopathy). Therefore, anticoagulant treatment may be contraindicated in these patients. In patients with lower risk of bleeding, the new oral anticoagulants and the combination of clinical and magnetic resonance imaging follow-up could be helpful in the decision-making process. Copyright © 2016 Sociedad Española de Neurología. Published by Elsevier España, S.L.U. All rights reserved.

  5. The medical implications of space tourism.

    Science.gov (United States)

    Tarzwell, R

    2000-06-01

    Commercial space travel may soon be a reality. If so, microgravity, high acceleration, and radiation exposure, all known hazards, will be accessible to the general public. Therefore, space tourism has medical implications. Even though the first flights will feature space exposure times of only a few minutes, the potential may someday exist for exposure times long enough to warrant careful consideration of the potential hazards to the space-faring public. The effects of acceleration and microgravity exposure are well known on the corps of astronauts and cosmonauts. The effects of space radiation are partially known on astronauts, but much remains to be discovered. However, there are problems using astronaut data to make inferences about the general public. Astronauts are not necessarily representative of the general public, since they are highly fit, highly screened individuals. Astronaut data can tell us very little about the potential hazards of microgravity in pediatric, obstetric and geriatric populations, all of whom are potential space tourists. Key issues in standard setting will be determining acceptable limits of pre-existing disease and inferring medical standards from mission profiles. It will not be a trivial task drafting minimal medical standards for commercial space travel. It will require the collaboration of space medicine physicians, making the best guesses possible, based on limited amounts of data, with limited applicability. A helpful departure point may be the USAF Class 3 medical standard, applicable to NASA payload specialists. It is time to begin preliminary discussions toward defining those standards. acceleration, aerospace medicine, medical standards, microgravity, radiation, space, space tourism, environmental hazards, environmental medicine.

  6. From defibrillation theory to clinical implications.

    Science.gov (United States)

    Irnich, Werner

    2010-07-01

    Our defibrillation theory claims that the mean voltage threshold is a hyperbolic function of pulse duration and that voltages below rheobase should be avoided as being counterproductive. Truncation of the pulse just at rheobase level yields minimal stored energy thresholds. To verify or falsify this theory, animal experiments were carried out. In two animal experiments, 212 defibrillation thresholds in 22 swine were determined with different biphasic pulses of which 92 were optimally truncated in phase 1. Step-up test procedure was used with the first successful shock defined as "threshold." Experimental proof is gained that truncation according to "rheobase condition" shows lowest stored energy. A ranking order of stored energy thresholds demonstrates that (1) lower output capacitances reduce needed energy, and (2) pulse durations shorter or longer than optimal increase needed energy. The voltage-pulse-content threshold is linearly correlated with pulse duration. Truncation above or below rheobase increases the stored energy threshold. Voltage averaged during pulse duration is a hyperbolic function of pulse duration. The stored energy is reduced with decreasing output capacitance. The experimental results do not only fully verify our theory, they also suggest clinical implications: (1) the current usage of the "constant tilt concept" in implantable cardioverter defibrillator (ICD) should be abandoned in favor of "optimal truncation concept," (2) an algorithm developed for calculating optimal truncation proved to be useful so that incorporation into ICD for automatic adjustment is recommended, and (3) the output capacitance should be reduced from about 100 microF to 60 to 70 microF.

  7. Health implications of hospital waste management practices in Gujrat, Pakistan

    OpenAIRE

    Nadeem, Yasir

    2015-01-01

    The present research was conducted to investigate the health implications of hospital waste management practices in Gujrat, Pakistan. For this purpose two government and two private hospitals were randomly selected in the city of Gujrat. To find out the health implications, Sheikh Sukha waste dumping site was selected. Personal visits were made to hospitals and waste disposal site to record the actual conditions. Qualitative method was used in this research for data collection....

  8. AN ECONOMIC PERSPECTIVE AND POLICY IMPLICATION FOR SOCIAL ENTERPRISE

    OpenAIRE

    Yoon-Doo Kim; Seok Yoon; Heon-Goo Kim

    2014-01-01

    This study looked at the current status of Korean social enterprises and their problems and suggested governmental policy implications for enhancing the competitiveness of social enterprises. As the study methods, the current status of social enterprises was analyzed and performance of social enterprise support was examined and then policy implications for promoting the social enterprises were analyzed. First, the direction of governmental policy regarding the promotion of social enterprise s...

  9. The Military Coup and its Implications for the Thai Economy

    DEFF Research Database (Denmark)

    Schmidt, Johannes Dragsbæk

    The paper analyses the regional and international implications of the Thai military coup in September 2006. Focus is furthermore  attached to the economic consequences and the geo-political and geo-economic aspects related to the coup.......The paper analyses the regional and international implications of the Thai military coup in September 2006. Focus is furthermore  attached to the economic consequences and the geo-political and geo-economic aspects related to the coup....

  10. Revising the human mutation rate: implications for understanding human evolution.

    Science.gov (United States)

    Scally, Aylwyn; Durbin, Richard

    2012-10-01

    It is now possible to make direct measurements of the mutation rate in modern humans using next-generation sequencing. These measurements reveal a value that is approximately half of that previously derived from fossil calibration, and this has implications for our understanding of demographic events in human evolution and other aspects of population genetics. Here, we discuss the implications of a lower-than-expected mutation rate in relation to the timescale of human evolution.

  11. Structural and kinetic studies of the allosteric transition in Sulfolobus solfataricus uracil phosphoribosyltransferase: Permanent activation by engineering of the C-terminus

    DEFF Research Database (Denmark)

    Christoffersen, Stig; Kadziola, Anders; Johansson, Eva

    2009-01-01

    . The regulatory triphosphates bind at a site in the center of the tetramer in a different manner and change the quaternary arrangement. Both effectors contact Pro94 at the beginning of a long ß-strand in the dimer interface, which extends into a flexible loop over the active site. In the GTP-bound state, two...... flexible loop residues, Tyr123 and Lys125, bind the PPi moiety of PRPP in the neighboring subunit and contribute to catalysis, while in the inhibited state, they contribute to the configuration of the active site for UMP rather than PRPP binding. The C-terminal Gly216 participates in a hydrogen......-bond network in the dimer interface that stabilizes the inhibited, but not the activated, state. Tagging the C-terminus with additional amino acids generates an endogenously activated enzyme that binds GTP without effects on activity....

  12. Molecular characterization of a conserved archaeal copper resistance (cop) gene cluster and its copper-responsive regulator in Sulfolobus solfataricus P2

    NARCIS (Netherlands)

    Ettema, T.J.G.; Brinkman, A.B.; Lamers, P.P.; Kornet, N.; Vos, de W.M.; Oost, van der J.

    2006-01-01

    Using a comparative genomics approach, a copper resistance gene cluster has been identified in multiple archaeal genomes. The cop cluster is predicted to encode a metallochaperone (CopM), a P-type copper-exporting ATPase (CopA) and a novel, archaea-specific transcriptional regulator (CopT) which

  13. Transcriptome analysis of Sulfolobus solfataricus infected with two related fuselloviruses reveals novel insights into the regulation of CRISPR-Cas system

    DEFF Research Database (Denmark)

    Fusco, Salvatore; Liguori, Rossana; Limauro, Danila

    2015-01-01

    in a double-infected strain to explore both virus-host and virus-virus interactions. Whereas SSV1 did not induce major changes of the host gene expression, SSV2 elicited a strong host response, which includes the transcriptional activation of CRISPR loci and cas genes. As a consequence, a significant decrease...... of the SSV2 copy number has been observed, which in turn led to provirus-capture into the host chromosome. Results of this study have revealed novel aspects of the host-viral interaction in the frame of the CRISPR-response....

  14. Development of in vitro transposon assisted signal sequence trapping and its use in screening Bacillus halodurans C125 and Sulfolobus solfataricus P2 gene libraries

    DEFF Research Database (Denmark)

    Becker, F.; Schnorr, K.; Wilting, R.

    2004-01-01

    minitransposon enabling translational fusions between 'bla and target genes. Fusion of TnSig in the correct reading frame to a protein carrying transmembrane domains or signal peptides resulted in ampicillin resistance of the corresponding clone. Prokaryotic gene libraries from the alkaliphilic bacterium...... in the cell. Genes for secreted proteins, transmembrane proteins and lipoproteins were successfully identified by this method. In contrast to previous transposon based identification strategies, the method described here is fast and versatile and essentially enables any selectable marker compatible library...... to be tagged. It is suited for identifying genes encoding extracytosolic proteins in gene libraries of a wide range of prokaryotic organisms....

  15. Thermodynamics of the ATPase cycle of GlcV, the nucleotide-binding domain of the glucose ABC transporter of Sulfolobus solfataricus

    NARCIS (Netherlands)

    Pretz, Monika G.; Albers, Sonja-Verena; Schuurman-Wolters, Gea; Tampe, Robert; Driessen, Arnold J. M.; van der Does, Chris

    2006-01-01

    ATP-binding cassette transporters drive the transport of substrates across the membrane by the hydrolysis of ATP. They typically have a conserved domain structure with two membrane-spanning domains that form the transport channel and two cytosolic nucleotide-binding domains ( NBDs) that energize the

  16. GEMAS - Soil geochemistry and health implications

    Science.gov (United States)

    Ernstsen, Vibeke; Ladenberger, Anna; Wragg, Joanna; Gulan, Aleksandra

    2014-05-01

    The GEMAS Project resulted in a large coherent data set displaying baseline levels of elements in agricultural and grazing land soil, which has a wide variety of applications. Medical geology is an emerging new discipline providing a link between geoscience and medicine by interpreting natural geological factors in relation to human and animal health and their geographical distribution. Medical geology shows not only problems related to harmful health effects of natural geological materials and processes, but also deals with their beneficial aspects. Since the GEMAS project demonstrates the importance of geological factors in geochemical patterns in European soil, this data set can be used in improving our understanding of how the geological processes may affect human health in Europe. The main potential health problems are related to deficiency of nutrients in soil and toxic effects of potentially harmful elements. Deficiency in macro- (e.g., K, Fe, Mg, P) and micro-nutrients (e.g., Se, Zn, Cl) can be responsible for a reduction in crop productivity and certain health issues for livestock and humans. On the other hand, bioavailability of crucial elements depends on soil parameters, e.g., pH; namely, low pH in soil (in northern Europe) makes more micronutrients bioavailable, with the exception of Mo, P and Ca. Rocks underlying the soil layer have a major impact on soil composition, and soil parent material can be a main source of toxic metals, for instance, soil developed on black shale (e.g., Oslo region) shows potentially toxic levels of metals, such as As, Cd, U, Zn and Pb. High content of organic matter is another factor amplifying the toxic levels of metals in soil. Several important topics with health implications can be then addressed using the GEMAS data set, namely, soil properties and element bioavailability, arsenic toxicity, selenium deficiency, potential health effects of liming, uranium in European soil, influence of recent and historical volcanic

  17. Magmatic gas scrubbing: Implications for volcano monitoring

    Science.gov (United States)

    Symonds, R.B.; Gerlach, T.M.; Reed, M.H.

    2001-01-01

    Despite the abundance of SO2(g) in magmatic gases, precursory increases in magmatic SO2(g) are not always observed prior to volcanic eruption, probably because many terrestrial volcanoes contain abundant groundwater or surface water that scrubs magmatic gases until a dry pathway to the atmosphere is established. To better understand scrubbing and its implications for volcano monitoring, we model thermochemically the reaction of magmatic gases with water. First, we inject a 915??C magmatic gas from Merapi volcano into 25??C air-saturated water (ASW) over a wide range of gas/water mass ratios from 0.0002 to 100 and at a total pressure of 0.1 MPa. Then we model closed-system cooling of the magmatic gas, magmatic gas-ASW mixing at 5.0 MPa, runs with varied temperature and composition of the ASW, a case with a wide range of magmatic-gas compositions, and a reaction of a magmatic gas-ASW mixture with rock. The modeling predicts gas and water compositions, and, in one case, alteration assemblages for a wide range of scrubbing conditions; these results can be compared directly with samples from degassing volcanoes. The modeling suggests that CO2(g) is the main species to monitor when scrubbing exists; another candidate is H2S(g), but it can be affected by reactions with aqueous ferrous iron. In contrast, scrubbing by water will prevent significant SO2(g) and most HCl(g) emissions until dry pathways are established, except for moderate HCl(g) degassing from pH 100 t/d (tons per day) of SO2(g) in addition to CO2(g) and H2S(g) should be taken as a criterion of magma intrusion. Finally, the modeling suggests that the interpretation of gas-ratio data requires a case-by-case evaluation since ratio changes can often be produced by several mechanisms; nevertheless, several gas ratios may provide useful indices for monitoring the drying out of gas pathways. Published by Elsevier Science B.V.

  18. Cosmological and astrophysical implications of sterile neutrinos

    Science.gov (United States)

    Petraki, Kalliopi

    The discovery of neutrino masses suggests that the Standard Model should be supplemented with new gauge-singlet fermions, often called sterile neutrinos. The interplay among the new couplings introduced in the Standard Model can accommodate the neutrino oscillation data for a variety of choices: the new particles can be extremely heavy and practically unobservable, or they can be light, in which case they can solve several long-standing puzzles. It has been shown, for example, that sterile neutrinos in some range of masses can account for dark matter, their emission from a supernova can explain pulsar kicks, arid their decays can play an important role in the formation of the first stars. Though indirect, these clues indicate that sterile neutrinos can be the minimal solution to a variety of unsolved problems. This emphasizes the importance of investigating further the consequences of these new degrees of freedom for cosmology and astrophysics. In this dissertation, I explore the possible role of sterile neutrinos of different mass scales in some cosmological and astrophysical phenomena. A minimal extension of the Higgs sector of the Standard Model, with a gauge- singlet boson coupled to sterile neutrinos, can provide a consistent framework for the theory of neutrino masses, and can produce a relic population of keV sterile neutrinos via decays of the singlet Higgs. The latter can account for the dark matter of the universe. The mechanism operates around the electroweak scale, and has interesting consequences for the electroweak phase transition. Relic sterile neutrinos produced via decays at the electroweak scale constitute colder dark matter than those produced via other previously suggested mechanisms. The primordial thermal content of dark matter has important implications for the formation of cosmic structures, such as clusters and galaxies. The assessment of the relevant properties suggests that sterile neutrinos produced at the electroweak scale are a

  19. Chrysotile dissolution rates: Implications for carbon sequestration

    International Nuclear Information System (INIS)

    Thom, James G.M.; Dipple, Gregory M.; Power, Ian M.; Harrison, Anna L.

    2013-01-01

    important implications for constraining potential rates of sequestration in serpentinite-hosted aquifers and under accelerated sequestration scenarios in mine tailings

  20. Implications for global energy markets: implications for non-fossil energy sources

    International Nuclear Information System (INIS)

    Grubb, Michael

    1998-01-01

    This paper highlights the recent developments concerning non-fossil energy and examines the impact of the Kyoto Protocol on non-fossil energy sources, and the implications for non-fossil sources in the implementation of the Kyoto Protocol. The current contributions of fossil and non-fossil fuels to electricity production, prospects for expansion of the established non-fossil sources, new renewables in Europe to date, renewables in Europe to 2010, and policy integration in the EU are discussed. Charts illustrating the generating capacity of renewable energy plant in Britain (1992-1966), wind energy capacity in Europe (1990-2000), and projected renewable energy contributions in the EU (wind, small hydro, photovoltaic, biomass and geothermal) are provided. (UK)

  1. Generic implications of ATWS events at the Salem Nuclear Power Plant: generic implications. Vol. 1

    International Nuclear Information System (INIS)

    1983-04-01

    This report is the first of two volumes. It documents the work of an interoffice, interdisciplinary NRC Task Force established to determine the generic implications of two anticipated transients without scram (ATWS) at the Salem Nuclear Power Plant, Unit 1 on February 22 and 25, 1983. A second report will document the NRC actions to be taken based on the work of the Task Force. The Task Force was established to address three questions: (1) Is there a need for prompt action for similar equipment in other facilities. (2) Are NRC and its licensees learning the sefety-management lessons, and, (3) How should the priority and content of the ATWS rule be adjusted. A number of short-term actions were taken through Bulletins and an Information Notice. Intermediate-term actions to address the generic issues will be addressed in the separate report and implemented through appropriate regulatory mechanisms

  2. Drug treatment of type 2 diabetes mellitus in patients for whom metformin is contraindicated [Corrigendum

    Directory of Open Access Journals (Sweden)

    Irons BK

    2017-10-01

    Full Text Available Irons BK, Minze MG. Drug treatment of type 2 diabetes mellitus in patients for whom metformin is contraindicated. Diabetes Metab Syndr Obes. 2014;7:15–24.There is an error in the text on page 19:“Alpha-glucosidase inhibitors are infrequently used in the treatment of T2DM.3 These agents competitively inhibit the absorption of alpha-glucosidase along the brush border of the small intestine, which slows gut absorption of carbohydrates and ultimately reduces post-prandial blood glucose.34–36” should read as “Alpha-glucosidase inhibitors are infrequently used in the treatment of T2DM.3 These agents competitively inhibit the degradation of complex carbohydrates along the brush border of the small intestine, which slows gut absorption of metabolized carbohydrates and ultimately reduces post-prandial blood glucose.34–36”Read the original article

  3. Evaporites in Martian Paleolakes: Observations and Implications

    Science.gov (United States)

    Wray, J. J.; Milliken, R.; Swayze, G. A.; Ehlmann, B. L.; Dundas, C. M.; Baldridge, A. M.; Andrews-Hanna, J. C.; Murchie, S. L.

    2009-12-01

    wall adjacent to this fan contains Fe/Mg-phyllosilicate, and near the bottom of the depression, over 300 meters below the shoreline elevation, polyhydrated sulfate is detected in finely bedded deposits. These sulfate deposits contrast with carbonate-bearing sediments seen in Jezero crater, another inferred paleolake site [6,7]. This difference in dominant anion could reflect local differences in water chemistry, groundwater vs. meteoric inputs, or possibly a change in atmospheric composition over time. Finding more examples of lake evaporites on Mars should improve our understanding of their paleo-environmental and astrobiological implications. [1] Cabrol N A and Grin E A (1999) Icarus 142, 160. [2] Wray J J et al. (2009) LPSC 40, #1896. [3] Swayze G A et al. (2008) AGU Fall Meeting, #P44A-04. [4] Andrews-Hanna J C et al. (2007) Nature 446, 163. [5] Di Achille G et al. (2009) GRL 36, L14201. [6] Ehlmann B L et al. (2008) Nature Geosci. 1, 355. [7] Ehlmann B L et al. (2008) Science 322, 1828.

  4. Gastrointestinal Motility Disorders and Their Clinical Implications in Cirrhosis

    Directory of Open Access Journals (Sweden)

    Eleni Theocharidou

    2017-01-01

    Full Text Available Gastrointestinal motility is impaired in a substantial proportion of patients with cirrhosis. Cirrhosis-related autonomic neuropathy, increased nitric oxide production, and gut hormonal changes have been implicated. Oesophageal dysmotility has been associated with increased frequency of abnormal gastro-oesophageal reflux. Impaired gastric emptying and accommodation may result in early satiety and may have an impact on the nutritional status of these patients. Small intestinal dysmotility might be implicated in small intestinal bacterial overgrowth and increased bacterial translocation. The latter has been implicated in the pathophysiology of hepatic encephalopathy and spontaneous bacterial peritonitis. Enhanced colonic motility is usually associated with the use of lactulose. Pharmacological interventions aiming to alter gastrointestinal motility in cirrhosis could potentially have a beneficial effect reducing the risk of hepatic decompensation and improving prognosis.

  5. ERP in large Danish enterprises: Implications for SCM

    DEFF Research Database (Denmark)

    Møller, Charles

    2004-01-01

    This paper argues that with the present state of Enterprise Resource Planning (ERP) adoption by the companies, the potential benefits of Supply Chain Management (SCM) and integration is about to be unleashed. This paper presents the results and the implications of a survey on ERP adoption...... technology; (iii) ERP adoption has matured; and (iv) ERP adoption is converging towards a dominant design. Finally, the paper discusses the general implications of the surveyed state of practice on the SCM research challenges. Consequently we argue that research needs to adjust its conceptions of the ERP...

  6. SYMPOSIUM - MACRONUTRIENT UTILIZATION DURING EXERCISE: IMPLICATIONS FOR PERFORMANCE AND SUPPLEMENTATION

    Directory of Open Access Journals (Sweden)

    Darryn S. Willoughby

    2004-09-01

    Full Text Available The review articles constitute a mini-symposium entitled "Macronutrient Utilization During Exercise: Implications for Performance and Supplementation" that were recently presented at the 2004 annual conference of the International Society of Sports Nutrition in Las Vegas, NV. Much controversy often surrounds macronutrient intake, utilization, and subsequent metabolism regarding exercise and athletic performance. Furthermore, the role of macronutrient supplementation with the specificintent of improving body composition and exercise performance by way of nutrient timing is also an important issue. As such, the articles provide a comprehensive overview of metabolic and performance-enhancing implications regarding carbohydrate, fat, and protein.

  7. Structuring the self: Moral implications of getting an ADHD diagnosis

    DEFF Research Database (Denmark)

    Nielsen, Mikka

    2018-01-01

    by an analytical framework offered by anthropologist Cheryl Mattingly and based on interviews with adults diagnosed with ADHD, I analyse the implications of being diagnosed with ADHD. I argue that the implications entail different moral tasks that can be analysed from what Mattingly calls three moral scenes: 1......) the trial where moral judgements are made; 2) the workshop where practices are cultivated; and 3) the moral laboratory where everyday experiments are carried out. In closing, I will briefly discuss the societal conditions for how diagnoses have become carriers of self-understandings....

  8. Neoliberalism and its implications for mental health in the UK.

    Science.gov (United States)

    Ramon, Shulamit

    2008-01-01

    This article sets out to outline the tenets of neoliberalism and globalization, prior to the identification of the implications of neoliberalism for the British health system since 1979. The article then focuses on the applications and implications of neoliberalism for the British mental health system in terms of service organization and management, and the impact these changes in direction had on the three existing service sectors: users, carers and professionals. The discussion and the conclusion highlight the significance of these developments in the mental health system in the rather hybrid context of health, mental health, and social care policy and practice in the United Kingdom.

  9. Implications of fuel wood scarcity on livelihoods of rural communities ...

    African Journals Online (AJOL)

    Fuelwood scarcity is evident in south western Uganda, where households are using sorghum and maize stalks for cooking as alternatives to the traditional fuelwood. The aim of the study was to assess the implications of fuelwood scarcity on livelihoods of rural communities in Nyarubuye sub-county in Kisoro district in south ...

  10. The Skills Implications of Electronic Retailing. IES Final Report.

    Science.gov (United States)

    Tackey, Nii Djan; Hillage, Jim; Jagger, Nick; Bates, Peter

    The skills and education/training implications of the development of electronic commerce in the United Kingdom's retail industry and its associated supply chain were examined. The major data collection activities were as follows: a literature review; consultation with leading academics and advisers; an e-mail-based call for information from…

  11. Zvierwa as African IKS: Epistemological and Ethical Implications of ...

    African Journals Online (AJOL)

    Finally, the article explores the implications and impact of marginalizing taboos by the new generation on crime rate, moral decadence, ecosystem and environmental degradation. In light of this observation, the article contends that taboos need to be re-instituted as an 'ethno-science' that promotes human values while at ...

  12. Liberalization of Trade in Goods and Services : Implications for the ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    This project aims to contribute to a better understanding of the issues and implications of the liberalization of trade in goods and services for the ICT sector. Researchers will analyze key elements of the national, regional and international regulatory framework and characterize the private ICT goods and services sector with ...

  13. Financial implications of anemia management in anaemic chronic ...

    African Journals Online (AJOL)

    Objectives- To assess the cost implications of anaemia management using ESA's and parenteral iron and vitamins at the University ofBenin Teaching Hospital, a tertiary health care centre in South-South Nigeria. Methods-Costs of investigating a patient for anaemia were obtained from the revenue unit of the laboratory.

  14. Land Tenure and Gender Relations: Implications for Sustainable ...

    African Journals Online (AJOL)

    Land Tenure and Gender Relations: Implications for Sustainable Rural Development. ... If tenure is secure, the holder can reasonably expect to use the land to its best advantage in accordance with the right, reap a timely and fair return and be able to enforce the right against non-holders. Tenure enables the holder to make ...

  15. Portfolio implications of cointegration between labor income and dividends

    NARCIS (Netherlands)

    de Jong, F.C.J.M.

    2012-01-01

    This paper analyzes the implications of cointegration between labor income and dividends for the optimal portfolio weight for stocks. In a recent paper, Benzoni et al. (J Finance 62:2123–2167, 2007) claim that, as a result of cointegration, the optimal weight in stocks may be smaller for young

  16. Impact of accounting on human behaviour: implications for ...

    African Journals Online (AJOL)

    Impact of accounting on human behaviour: implications for organizations and society. Chinwuba Okafor, JT Akinmayowa. Abstract. No Abstract. Nigeria Journal of Business Administration Vol. 6(1) 2004: 106-117. Full Text: EMAIL FULL TEXT EMAIL FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT.

  17. Survivor Revictimization: Object Relations Dynamics and Treatment Implications.

    Science.gov (United States)

    Carey, Andrew L.

    1997-01-01

    Uses an integrated, unified framework based on object relations theory and research to provide specific and practical understanding of survivor revictimization. Focuses on revictimization dynamics, revictimization research, the survivor's world of revictimization, and treatment implications based on that framework. Offers a case study to elaborate…

  18. The Male Role in Contraception: Implications for Health Education.

    Science.gov (United States)

    Chng, Chwee Lye

    1983-01-01

    Many males still perceive contraception as a woman's responsibility. This paper describes male contraceptives and their effectiveness and draws implications for school and community health education professionals. More equitable sharing of the responsibility for contraception might result in more effective contraception. (PP)

  19. Pluricentric Views towards English and Implications for ELT in China

    Science.gov (United States)

    Jianli, Liang

    2015-01-01

    Descriptions of the classifications or models of English language have been proposed by a number of scholars who attempt to explain the differences in the ways English is used in different localities. This paper reviews three models of classification of English language, with an aim of drawing implications on how English Language Teaching (ELT) in…

  20. Stigma, discrimination and its implications for people living with HIV ...

    African Journals Online (AJOL)

    However, the difficulty of the task should not be underestimated, as has been shown by the persistence of discrimination based on factors such as race, gender and sexual orientation. Key words: HIV,AIDS, stigma, Africa, discrimination. La stigmatisation, la discrimination et ses implications pour les gens vivant avec le ...

  1. [Cellular mechanisms implicated in anti-erythrocyte alloimmunization].

    Science.gov (United States)

    Ansart-Pirenne, H; Rouger, P; Noizat-Pirenne, F

    2005-06-01

    In many clinical situations patients are dependent on blood transfusions. Occurrence of alloimmunization to blood group antigens (BGA) complicates the transfusion strategy and may be involved in clinical transfusion stalemate situations. B cell differentiation into antibody-secreting plasma cells is triggered by antigen and requires helper T cells which produce cytokines. Although antibodies implicated in BGA alloimmunization have been studied for many years, little is known about helper T cell responses that drive their production. Few studies on BGA specific T cell responses have been published today. This review summarizes the new developments in the field of cellular mechanisms implicated into antibody production. The definition of immunodominant peptides derived from RhD and Jk(a) BGAs, the cytokine patterns induced and the HLA class II molecules implicated in their presentation are analyzed. A tolerogenic route for RhD immunodominant peptides is experimented. Identification of such immunodominant peptides, the cytokine patterns induced and the HLA class II molecules implicated in their presentation, would facilitate the design of new therapeutic strategies including the specific control of alloimmunization with peptide antigen tolerogens or the ex-vivo induction of regulatory T cells.

  2. LHCb results on flavour physics and implications to BSM

    CERN Document Server

    Langenbruch, C

    2014-01-01

    LHCb is a dedicated flavour physics experiment at the LHC. Precision measurements of CP violation and the study of rare decays of hadrons containing beauty and charm quarks constitute powerful searches for New Physics. A selection of recent LHCb results and their implications to physics beyond the Standard Model are discussed.

  3. Financial Frictions and Real Implications of Macroprudential Policies

    Czech Academy of Sciences Publication Activity Database

    Derviz, Alexis

    2012-01-01

    Roč. 3, č. 26 (2012), s. 333-368 ISSN 1555-4961 Institutional support: RVO:67985556 Keywords : Debt * Equity * Bank * Default * Macroprudential policy Subject RIV: AH - Economics http://library.utia.cas.cz/separaty/2012/E/Derviz- financial frictions and real implications of macroprudential policies.pdf

  4. Mother/Daughter Relationship: Psychological Implication of Love in ...

    African Journals Online (AJOL)

    This paper re-examines Toni Morrison's Beloved to identify an example of the types of mother/daughter relationship that existed between black mothers and their daughters and the implications of such relationship on the Black American society. The paper is a psychoanalytic reading, utilizing Melanie Klein's Object ...

  5. The brain-gut interaction: the conversation and the implications

    African Journals Online (AJOL)

    Review Article: The brain-gut interaction: the conversation and the implications. 2011;24(3) Supplement. S Afr J Clin Nutr. Prins A, RD (SA), MNutr. Little Company of Mary Medical Centre, Groenkloof, Pretoria. Correspondence to: Arina Prins, e-mail: arina.p@internists.co.za. The brain-gut interaction: the conversation and ...

  6. Radiological protection, environmental implications, health and risk management: forum

    International Nuclear Information System (INIS)

    2008-01-01

    Topics related to the radioactivity or radiation are presented. The importance of protection and security measures that are required both for public health, occupational health and the medical radiation is analyzed. In addition, it emphasizes the risks faced by professionals who work with radioactivity. Issues that confront the serious environmental implications of such activities are also showed [es

  7. The Institutional Implications of the Unfair Terms Directive in Poland

    NARCIS (Netherlands)

    Mańko, R.

    2012-01-01

    In this paper I focus on the institutional implications of the EU Unfair Terms Directive (93/13) in Poland in the broader context of the welfare state model prevalent in that post-socialist EU Member State. I depart from the assumption that there is, in principle, a link between the intensity of the

  8. Knowledge and Awareness Implication on E-Waste Management ...

    African Journals Online (AJOL)

    Lack of awareness and cautionary information on effective and appropriate management operations associated with e-waste may pose potential threat to human health and the environment. This study assessed the knowledge and awareness implication of e-waste management among undergraduate students of Federal ...

  9. Implications of Black Coffee Twig Borer on cocoa in Uganda

    African Journals Online (AJOL)

    ACSS

    Implications of Black Coffee Twig Borer on cocoa in Uganda. G.H. Kagezi1, P. Kucel1, J.P. Egonyu1, ... Here, we report for the first time an outbreak of the Black Coffee Twig Borer (BCTB), Xylosandrus compactus (Eichhoff), a new pest on ... the damaged plant parts do not bear fruits resulting into loss of yields and hence,.

  10. Some Instructional Implications from a Mathematical Model of Cognitive Development.

    Science.gov (United States)

    Mierkiewicz, Diane B.

    Cognitive development and various educational implications are discussed in terms of Donald Saari's model of the interaction of a learner and the enviroment and the constraints imposed by the inefficiency of the learner's cognitive system. Saari proposed a hierarchical system of cognitive structures such that the relationships between structures…

  11. Suicidality in Schizophrenia: Implications for the Counseling Profession.

    Science.gov (United States)

    Schwartz, Robert C.

    2000-01-01

    The most common reason for early mortality in schizophrenia is suicide. To date, the most recent comprehensive study on correlates among clients with schizophrenia is "Suicidal Behavior in Schizophrenia: Characteristics of Individuals Who Had and Had Not Attempted Suicide." This article reviews this study and discusses its implications for…

  12. assessment of selected world bank policies and their implications on ...

    African Journals Online (AJOL)

    LUCY

    Nigeria. World Bank policies on education, structural adjustment programme, water privatization, deregulation/liberalization and their implications on the fight against poverty in Nigeria were ... necessities, assets, and income. It is a condition of general deprivation whose manifestation in the form of social inferiority, isolation, ...

  13. The estrogen hypothesis of schizophrenia implicates glucose metabolism

    DEFF Research Database (Denmark)

    Olsen, Line; Hansen, Thomas; Jakobsen, Klaus D

    2008-01-01

    implicated by the candidate genes resulting from the estrogen selection. We identified ten candidate genes using this approach that are all active in glucose metabolism and particularly in the glycolysis. Thus, we tested the hypothesis that variants of the glycolytic genes are associated with schizophrenia...

  14. Implications of teacher educators' practices in assessment for ...

    African Journals Online (AJOL)

    This study presents findings on teacher educators' practices in assessment and their implications for student learning in Tanzania. Research on classroom assessment has been dichotomizing assessment and teaching-learning processes instead of viewing assessment as an integral part of the teachinglearning process.

  15. Effective Study Habits in Educational Sector: Counselling Implications.

    African Journals Online (AJOL)

    Effective Study Habits in Educational Sector: Counselling Implications. RO Ogbodo. Abstract. The problem most students have that contributes to their poor performance in tests and examination is lack of proper study habit. For an excellent performance, there is need for the student to form good study habit. A student, who ...

  16. Lunar Cycles, Catchability of Penaeid Shrimps and Implications for ...

    African Journals Online (AJOL)

    Lunar Cycles, Catchability of Penaeid Shrimps and Implications for the Management of the Shrimp Fishery on Sofala Bank in Mozambique. ... However, profitability of the fishing companies would improve by 3% and 7%, respectively, as a result of more efficient trawling. Keywords: Penaeidae, fishing effort, lunar phases, ...

  17. Saving Sinking Ships: Implications from a Theory of Marital Dissolution

    Science.gov (United States)

    Laner, Mary Riege

    1978-01-01

    A recently developed theory of marital dissolution that utilizes a systems perspective is briefly presented. The theory was derived from almost 1,300 propositions in extant literature, and is readily understandable to layman, practitioner, and academician. Implications contained within the theory for those concerned with saving floundering marital…

  18. Copyright in the Digital Era and Some Implications for Indigenous ...

    African Journals Online (AJOL)

    Copyright in the Digital Era and Some Implications for Indigenous Knowledge. ... An understanding of copyright is particularly important in an academic, scholarly and artistic environment where creators are continuously using the works of others to build and ... A discussion of the fair use doctrine is provided in this regard.

  19. Implications of the ethical-legal framework for adolescent HIV ...

    African Journals Online (AJOL)

    Nicky

    Fourthly, the institutional framework for establishing research priorities and regulation of ethical review is being strengthened with the establishment of new institutions such as the National. Health Research Ethics Committee. The South African ethical-legal framework and its implications for adolescent HIV vaccine trials ...

  20. Eye mechanics and their implications for eye movement control

    NARCIS (Netherlands)

    Koene, Ansgar Roald

    2002-01-01

    The topic of this thesis is the investigation of the mechanical properties of the oculomotor system and the implications of these properties for eye movement control. The investigation was conducted by means of computer models and simulations. This allowed us to combine data from anatomy, physiology

  1. Implications of bride price on domestic violence and reproductive ...

    African Journals Online (AJOL)

    Objective: Bride price payment is a gender issue with implications on gender relations in different socio-cultural contexts. It also impacts Sexual and Reproductive Health and Rights. In a qualitative study on the perceptions of domestic violence in Wakiso district, payment of bride price emerged as one of the key factors ...

  2. Age-Related Hearing Loss: Implications for Counseling.

    Science.gov (United States)

    Souza, Pamela E.; Hoyer, William J.

    1996-01-01

    Examines adaptation strategies used by hearing-impaired listeners and considers the implications of age-related hearing loss for counseling, intervention, and self-management. Outlines information on hearing aids and on practical communication strategies and the growing importance of these strategies as the population grows increasingly older.…

  3. A gene expression signature for RSV: clinical implications and limitations.

    Directory of Open Access Journals (Sweden)

    Peter J M Openshaw

    2013-11-01

    Full Text Available Peter Openshaw discusses the challenges in advancing respiratory syncytial virus (RSV treatments and the implications of a study by Mejias and colleagues using a newly identified gene signature for diagnosis and prediction of RSV severity. Please see later in the article for the Editors' Summary.

  4. Noncoding RNAs in protein clearance pathways: implications in ...

    Indian Academy of Sciences (India)

    Home; Journals; Journal of Genetics; Volume 96; Issue 1. Noncoding RNAs in protein clearance pathways: implications in ... A class of small ncRNAs and miRNAs has gained much importance because of its involvement in human diseases such as cancer. Involvement of long ncRNAs have also been acknowledged in ...

  5. Whiteness as Technology of Affect: Implications for Educational Praxis

    Science.gov (United States)

    Leonardo, Zeus; Zembylas, Michalinos

    2013-01-01

    This article explores the embodiment and affectivity of whiteness, particularly as it implicates educational praxis and social justice in education, focusing on the following questions: In what ways are affect and whiteness constitutive of each other in race dialogue? How does emotion intersect with racial practices and white privilege, and what…

  6. Latitudinal shifts of introduced species: possible causes and implications

    Science.gov (United States)

    Qinfeng Guo; Dov F. Sax; Hong Qian; Regan Early

    2012-01-01

    This study aims to document shifts in the latitudinal distributions of non-native species relative to their own native distributions and to discuss possible causes and implications of these shifts. We used published and newly compiled data on intercontinentally introduced birds, mammals and plants. We found strong correlations between the latitudinal distributions...

  7. Organizational Resilience: The Theoretical Model and Research Implication

    Directory of Open Access Journals (Sweden)

    Xiao Lei

    2017-01-01

    Full Text Available Organizations are all subject to a diverse and ever changing and uncertain environment. Under this situation organizations should develop a capability which can resist the emergency and recover from the disruption. Base on lot of literature, the paper provides the main concept of organizational resilience; construct the primary theoretical model and some implications for management.

  8. Philosophical implications and multidisciplinary challenges of moral physiology

    NARCIS (Netherlands)

    Schleim, Stephan; Schirmann, Felix

    2011-01-01

    Neuroethics deals with the normative implications of advances and new technology of neuroscience. Some scholars argue that experiments on moral judgment might allow solutions to moral problems in the future or already nowadays. We discuss this research under the label of moral physiology to

  9. Vitamin D Status of College Students: Implications for Health Leaders

    Science.gov (United States)

    Cress, Eileen McKenna

    2014-01-01

    Vitamin D deficiency is considered to be a pandemic with implications for compromised bone health and other chronic diseases. Few studies have examined vitamin D status in college-aged individuals where prevention of future health consequences is still possible. Serum vitamin D 25(OH)D status and vitamin D intake were examined in 98 college…

  10. New advances in cystic fibrosis - implications for developing countries

    African Journals Online (AJOL)

    New advances in cystic fibrosis - implications for developing countries. Heather J Zar, Eric Bateman, Michelle Ramsay. Abstract. No Abstract. Full Text: EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Article Metrics. Metrics Loading ... Metrics powered by PLOS ALM.

  11. Radiation induced changes in the airway - anaesthetic implications ...

    African Journals Online (AJOL)

    Radiation induced changes in the airway - anaesthetic implications: case report. Mallika Balakrishnan, Renju Kuriakose, Rachel Cherian Koshy. Abstract. Radiation induces a variety of changes in the airway that can potentially lead to difficult intubation. Osteoradionecrosis (ORN) of the mandible, a severe consequence of ...

  12. Language practice as games: Implications for sociology of ...

    African Journals Online (AJOL)

    Drawing from Game Theory, the article conceptualises language practice as games, that is convergences of strategic interaction, and explores the implications of such a conceptualisation for sociology of translation (la sociologie de la traduction – Michel Callon) in development contexts in Africa. The discussion posits that a ...

  13. The Computer as Rorschach: Implications for Management and User Acceptance

    OpenAIRE

    Kaplan, Bonnie

    1983-01-01

    Different views of the computer held by different participants in a medical computing project make it difficult to gain wide acceptance of an application. Researchers', programmers', and clinicians' views illustrate how users project their views onto the computer. Effects of these different views on user acceptance and implications for the management of computer projects are presented.

  14. Innovation and inter-firm linkages : new implications for policy

    NARCIS (Netherlands)

    Nooteboom, B

    1999-01-01

    This article discusses the implications for competition, innovation and learning of different forms of inter-firm linkage, ways to govern them, different 'generic systems' of innovation, and government policy. It employs a transformed theory of transactions that can deal with innovation and

  15. Gendered Migration and Agriculture in the Dry Areas : Implications ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Gendered Migration and Agriculture in the Dry Areas : Implications for Resource Management and Livelihoods in Syria ... L'honorable Chrystia Freeland, ministre du Commerce international, a annoncé le lancement d'un nouveau projet financé par le Centre de recherches pour le développement international (CRDI).

  16. Hydrodynamic processes in sharp meander bends and their morphological implications

    NARCIS (Netherlands)

    Blanckaert, K.

    2011-01-01

    The migration rate of sharp meander bends exhibits large variance and indicates that some sharply curved bends tend to stabilize. These observations remain unexplained. This paper examines three hydrodynamic processes in sharp bends with fixed banks and discusses their morphological implications:

  17. Regime Change in North Africa: Possible Implications for 21st ...

    African Journals Online (AJOL)

    At the centre of these debates is the question of “Implications of the Arab Spring on Governance in Africa in the 21st Century”. This Article raises pertinent questions. It revisits the social and economic causes of these regime changes in North Africa; the role of ICT and its social media networks and; the future of repressive ...

  18. Influence of Spousal Communication on Marital Stability: Implication ...

    African Journals Online (AJOL)

    It is often said that the home is the basic unit of the larger society. Thus when the home is settled, the society is at peace. The main focus of this study was to find out the influence of spousal communication on marital stability: Implications for Conducive Home Environment. A researcher-designed questionnaire titled ...

  19. Communication and conflict management in the family: Implications ...

    African Journals Online (AJOL)

    This paper assesses communication and conflict management in the family within the framework of implications for national development using a simple random sample of 400 respondents. Findings show that conflict is an inevitable characteristic of the family. However, it has been noted that effective communication would ...

  20. Youth unemployment in Nigeria: some implications for the third ...

    African Journals Online (AJOL)

    Youth unemployment in Nigeria: some implications for the third Millenium. ... Government in league with the private sector it is further suggested, can create job corps for school dropouts as one major remedy to unemployment. The paper further sees hope for Nigeria only if Youths are mobilized by way of genuinely ...

  1. Education of Women in Today's World: Implications for Counsellors ...

    African Journals Online (AJOL)

    The result for research questions two revealed that all the items listed were accepted as problems of women in education sector. The third research question also revealed that all the items listed were accepted as things which education has done in the lives of women in Today's World, implications for Counsellors were also ...

  2. Evaluation of toxicological implications of ingestion exposure to ...

    African Journals Online (AJOL)

    Because increased LDL cholesterol, decreased HDL cholesterol and alteration in the level of total serum cholesterol have all been implicated as risk factors for atherosclerosis, this present study was designed to determine whether very low percentages of gasoline per kilogramme body weight could cause toxicity in rats.

  3. Gani Odutoku ' Dialogu with Mona Lisa: Interrogating Implications of ...

    African Journals Online (AJOL)

    ... exists in the interface that Africa and Europe shares, African nationalist efforts must combine concepts of Negritude and Tigritude to reinvent a new African consciousness that rises beyond the ashes of past debilitating conditions. Key words- Euro-African Interface, Negritude, Tigritude, Implication, Pan-Africanism ...

  4. Resource implications of adopting a restrictive neonatal blood ...

    African Journals Online (AJOL)

    Resource implications of adopting a restrictive neonatal blood transfusion policy. ... Objective. To determine whether adopting a restrictive BTF policy results in fewer transfusions. Methods. Data were retrospectively collected on all infants who received BTFs in the GSH nursery over a 6-month period following adoption of a ...

  5. Florence Nightingale, Statistician: Implications for Teachers of Educational Research.

    Science.gov (United States)

    Rice, Marti H.; Stallings, William M.

    This paper presents an overview of Florence Nightingale's statistical background and accomplishments; discusses Victorian statistics, Nightingale's education and statistical contributions; and concludes with implications for professors and students of educational research. Florence Nightingale (1820-1910), the first woman elected as a fellow of…

  6. implications for environmental management in Benue State, Nigeria

    African Journals Online (AJOL)

    This paper assesses the relationship between annual cropped area expansion and crop output and discusses the implication of such a relationship for environmental management in Benue State, Nigeria. The study was carried out using agricultural production survey (APS) data of five selected crops, namely: rice, sorghum, ...

  7. Families in Demographic Perspective: Implications for Family Counseling.

    Science.gov (United States)

    Bray, James H.

    1993-01-01

    Focuses on demographic changes in families and implications for counseling couples and families. Contends that several important demographic changes in families have major impacts on kinds of clients that present for counseling and therapy. Looks at children born to unmarried women, separation and divorce, single-parent families, and remarriage…

  8. An assessment of the health and social economc implications of ...

    African Journals Online (AJOL)

    An assessment of the health and social economc implications of satchet water in Ibadan, Nigeria: A public health challenge. ... The objective of the study was to find out the quality of such pure water. Stratified, simple random sampling procedures were used to select 78 samples from 20 brands of sachet water from important ...

  9. Bride Price And Implications For Women's Rights In Nigeria ...

    African Journals Online (AJOL)

    The study investigated the issue of bride price and its implications for women rights in Nigeria. The paper examined the issues of gender-role inequality and discovered that it runs across cultures. There are some gender roles that are exclusively male preserve as well as there are some gender roles that are exclusively ...

  10. Graduate Students on Campus: Needs and Implications for College Counselors

    Science.gov (United States)

    Benshoff, James M.; Cashwell, Craig S.; Rowell, P. Clay

    2015-01-01

    Graduate students compose an important segment of university and college populations. However, institutions of higher education often have not addressed adequately their status as adult students with different developmental and life issues and concerns. This article defines and describes the needs of graduate students, discusses implications, and…

  11. Nigeria's National Population Policy and its Implications for ...

    African Journals Online (AJOL)

    This paper compared Nigeria's national population policy and programme with those of other Third World countries and examined the implications for sustainable development in the 21st century, considering the trend of events in the country since 1999. it argued that when compared to those of China and India in terms of ...

  12. Human Nature and its Implications for the Legal System | Obioha ...

    African Journals Online (AJOL)

    This paper examines the implications the various conceptions of human nature hold for the legal system. No doubt, there are various and conflicting theories of human nature such that the concept of human nature seems to have remained elusive and pervasive. Some conceive man as nothing but matter pure and simple; ...

  13. Implications of Continuous Quality Improvement for Program Evaluation and Evaluators.

    Science.gov (United States)

    Mark, Melvin M.; Pines, Edward

    1995-01-01

    Explores the implications that continuous quality improvement (CQI) programs are likely to have for evaluation. CQI, often known as total quality management, offers a structured approach to the analysis of an organization's processes and improvement that should provide advantages to evaluators once they have gained experience with the approach.…

  14. Assets for Children: Experiences in Asia and Implications for China

    Science.gov (United States)

    Zou, Li; Sherraden, Michael

    2010-01-01

    A growing number of national and local governments view child development accounts (CDAs) as an innovative policy tool for social and economic development. This article reviews the global landscape of CDAs, presents three CDA policy cases from Asia, analyzes main themes and discusses potential implications for China. (Contains 1 table.)

  15. Implications of Enhancing Access to Higher Education for Quality ...

    African Journals Online (AJOL)

    This study sought to accomplish three objectives: to examine the expansion of access to university education in Kenya; to examine the implications of expansion of access for the quality of university education; and to develop a model showing interrelationships between the expansion of access and quality assurance, based ...

  16. Implications of structural policies on the wheat market – comparative ...

    African Journals Online (AJOL)

    Structural policy instruments can directly influence agricultural production, productivity, and other market variables. Using a Cobb-Douglas market model, we quantitatively assess national and global implications of structural policies on the wheat market, determined by technical progress and other structural policy measures ...

  17. Formalisation of Unplanned Settlements and Its Implications on ...

    African Journals Online (AJOL)

    Formalisation of Unplanned Settlements and Its Implications on Poverty Reduction: The Case of Dar es Salaam City. ... Properties found in these areas are sound or improvable. ... Key words: regularisation, formalisation, land tenure, property rights, unplanned/informal settlements, poverty reduction, Dar es Salaam ...

  18. Performance and cost implication of finisher turkeys fed varying ...

    African Journals Online (AJOL)

    A 28-day experiment was conducted to determine the effect of feeding varying levels of rice milling waste as a substitute on maize on the performance, nutrient utilization and the economics implication on finisher turkeys. Five turkey finisher diets were formulated by substituting maize with rice milling waste at 0%, 25%, 50%, ...

  19. Clinical Implications of Dynamic Systems Theory for Phonological Development

    Science.gov (United States)

    Rvachew, Susan; Bernhardt, Barbara May

    2010-01-01

    Purpose: To examine treatment outcomes in relation to the complexity of treatment goals for children with speech sound disorders. Method: The clinical implications of dynamic systems theory in contrast with learnability theory are discussed, especially in the context of target selection decisions for children with speech sound disorders. Detailed…

  20. Farm holdings in northern Nigeria and implication for food security ...

    African Journals Online (AJOL)

    African Journal of Food, Agriculture, Nutrition and Development ... major limitation to sustainable land use resources planning, development and management is the unreliable assessment of t available stock and the level of utilization. ... The paper discusses the implication for food security and sustainability in the region.