WorldWideScience

Sample records for solfataricus alpha-glucosidase implications

  1. Structure of the Sulfolobus solfataricus alpha-glucosidase: Implications for domain conservation and substrate recognition in GH31

    DEFF Research Database (Denmark)

    Ernst, Heidi Asschenfeldt; Lo Leggio, Leila; Willemoes, M.

    2006-01-01

    The crystal structure of a-glucosidase MalA from Sulfolobus solfataricus has been determined at 2.5 Å resolution. It provides a structural model for enzymes representing the major specificity in glycoside hydrolase family 31 (GH31), including a-glucosidases from higher organisms, involved...

  2. Characterization of different crystal forms of the alpha-glucosidase MalA from Sulfolobus solfataricus

    DEFF Research Database (Denmark)

    Ernst, Heidi Asschenfeldt; Willemoës, Martin; Lo Leggio, Leila

    2005-01-01

    MalA is an alpha-glucosidase from the hyperthermophilic archaeon Sulfolobus solfataricus. It belongs to glycoside hydrolase family 31, which includes several medically interesting alpha-glucosidases. MalA and its selenomethionine derivative have been overproduced in Escherichia coli...

  3. Screening alpha-glucosidase and alpha-amylase inhibitors from natural compounds by molecular docking in silico.

    Science.gov (United States)

    Jhong, Chien-Hung; Riyaphan, Jirawat; Lin, Shih-Hung; Chia, Yi-Chen; Weng, Ching-Feng

    2015-01-01

    The alpha-glucosidase inhibitor is a common oral anti-diabetic drug used for controlling carbohydrates normally converted into simple sugars and absorbed by the intestines. However, some adverse clinical effects have been observed. The present study seeks an alternative drug that can regulate the hyperglycemia by down-regulating alpha-glucosidase and alpha-amylase activity by molecular docking approach to screen the hyperglycemia antagonist against alpha-glucosidase and alpha-amylase activities from the 47 natural compounds. The docking data showed that Curcumin, 16-hydroxy-cleroda-3,13-dine-16,15-olide (16-H), Docosanol, Tetracosanol, Antroquinonol, Berberine, Catechin, Quercetin, Actinodaphnine, and Rutin from 47 natural compounds had binding ability towards alpha-amylase and alpha-glucosidase as well. Curcumin had a better biding ability of alpha-amylase than the other natural compounds. Analyzed alpha-glucosidase activity reveals natural compound inhibitors (below 0.5 mM) are Curcumin, Actinodaphnine, 16-H, Quercetin, Berberine, and Catechin when compared to the commercial drug Acarbose (3 mM). A natural compound with alpha-amylase inhibitors (below 0.5 mM) includes Curcumin, Berberine, Docosanol, 16-H, Actinodaphnine/Tetracosanol, Catechin, and Quercetin when compared to Acarbose (1 mM). When taken together, the implication is that molecular docking is a fast and effective way to screen alpha-glucosidase and alpha-amylase inhibitors as lead compounds of natural sources isolated from medicinal plants. © 2015 International Union of Biochemistry and Molecular Biology.

  4. The Role of alpha-Glucosidase in Germinating Barley Grains

    DEFF Research Database (Denmark)

    Stanley, Duncan; Rejzek, Martin; Næsted, Henrik

    2011-01-01

    The importance of alpha-glucosidase in the endosperm starch metabolism of barley (Hordeum vulgare) seedlings is poorly understood. The enzyme converts maltose to glucose (Glc), but in vitro studies indicate that it can also attack starch granules. To discover its role in vivo, we took complementa...

  5. Cloning a cDNA for the lysosomal alpha-glucosidase

    NARCIS (Netherlands)

    KONINGS, A.; HUPKES, P.; Versteeg, R.; Grosveld, G.; Reuser, A.; Galjaard, H.

    1984-01-01

    Messenger RNA was isolated from monkey testes and size-fractionated on sucrose gradients. In vitro translation of these mRNA fractions resulted in nascent, labeled alpha-glucosidase that could be precipitated with anti human alpha-glucosidase antiserum. A cDNA library was constructed from the most

  6. Alpha-glucosidase inhibitory and antiplasmodial properties of terpenoids from the leaves of Buddleja saligna Willd

    Czech Academy of Sciences Publication Activity Database

    Chukwujekwu, J. C.; Rengasamy, K.R.R.; de Kock, C. A.; Smith, P. J.; Poštová Slavětínská, Lenka; van Staden, J.

    2016-01-01

    Roč. 31, č. 1 (2016), s. 63-66 ISSN 1475-6366 Institutional support: RVO:61388963 Keywords : alpha-glucosidase * antidiabetic * antiplasmodial * Buddleja saligna * terpenoids Subject RIV: CC - Organic Chemistry Impact factor: 4.293, year: 2016

  7. Potential antiradical and alpha-glucosidase inhibitors from Ecklonia maxima (Osbeck) Papenfuss.

    Science.gov (United States)

    Rengasamy, Kannan R R; Aderogba, Mutalib A; Amoo, Stephen O; Stirk, Wendy A; Van Staden, Johannes

    2013-11-15

    Alpha-glucosidase inhibitors play a potential role in the treatment of type 2 diabetes by delaying glucose absorption in the small intestine. Ecklonia maxima, a brown alga which grows abundantly on the west coast of South Africa, is used to produce alginate, animal feed, nutritional supplements and fertilizer. The crude aqueous methanol extract, four solvent fractions and three phlorotannins: 1,3,5-trihydroxybenezene (phloroglucinol) (1), dibenzo [1,4] dioxine-2,4,7,9-tetraol (2) and hexahydroxyphenoxydibenzo [1,4] dioxine (eckol) (3) isolated from E. maxima were evaluated for antiradical and alpha-glucosidase inhibitory activities. All the phlorotannins tested had strong antioxidant activities on DPPH free radicals with EC50 values ranging from 0.008 to 0.128μM. Compounds 2 and 3 demonstrated stronger antioxidant activity and an alpha-glucosidase inhibitory property than positive controls. These results suggest that E. maxima could be a natural source of potent antioxidants and alpha-glucosidase inhibitors. This study could facilitate effective utilization of E. maxima as an oral antidiabetic drug or functional food ingredient with a promising role in the formulation of medicines and nutrition supplements. Copyright © 2013 Elsevier Ltd. All rights reserved.

  8. Human acid alpha-glucosidase from rabbit milk has therapeutic effect in mice with glycogen storage disease type II

    NARCIS (Netherlands)

    A.G.A. Bijvoet (Agnes); A.J.J. Reuser (Arnold); H. van Hirtum (Hans); M.A. Kroos (Marian); E.H. van de Kamp; O. Schoneveld; P. Visser (Pim); J.P. Brakenhoff (Just); M. Weggeman (Miranda); E.J.J.M. van Corven (Emiel); A.T. van der Ploeg (Ans)

    1999-01-01

    textabstractPompe's disease or glycogen storage disease type II (GSDII) belongs to the family of inherited lysosomal storage diseases. The underlying deficiency of acid alpha-glucosidase leads in different degrees of severity to glycogen storage in heart, skeletal

  9. An isozyme of acid alpha-glucosidase with reduced catalytic activity for glycogen.

    OpenAIRE

    Beratis, N G; LaBadie, G U; Hirschhorn, K

    1980-01-01

    Both the common and a variant isozyme of acid alpha-glucosidase have been purified from a heterozygous placenta with CM-Sephadex, ammonium sulfate precipitation, dialysis, Amicon filtration, affinity chromatography by Sephadex G-100, and DEAE-cellulose chromatography. Three and two activity peaks, from the common and variant isozymes, respectively, were obtained by DEAE-cellulose chromatography using a linear NaCl gradient. The three peaks of activity of the common isozyme were eluted with 0....

  10. alpha-Glucosidase-albumin conjugates: effect of chronic administration in mice

    International Nuclear Information System (INIS)

    Allen, T.M.; Murray, L.; Bhardwaj, D.; Poznansky, M.J.

    1985-01-01

    Enzyme albumin conjugates have been proposed as a means of increasing the efficacy of enzyme use in vivo and decreasing immune response to the enzyme. Particulate drug carriers, however, have a pronounced tendency to localize in the mononuclear phagocyte (reticuloendothelial) system. The authors have examined in mice the effect on phagocytic index, tissue distribution and organ size of continued administration of conjugates of alpha-glucosidase with either homologous or heterologous albumin. Mice received 10 X 2-mg injections of bovine serum albumin (BSA) or mouse serum albumin (MSA), either free, polymerized or conjugated with alpha-glucosidase. Experiments involving BSA had to be terminated before the end of the experiment because of anaphylaxis, but these reactions were less severe to the polymerized albumin than to free albumin. Free BSA, BSA polymer and BSA-enzyme conjugates all caused a decrease in phagocytic index after six injections. Mice receiving MSA showed no evidence of anaphylaxis, but mice receiving six or more injections of free MSA, MSA polymer or MSA-enzyme conjugate had significantly decreased phagocytic indices as compared to controls. Phagocytic indices had returned to normal by 7 days after the final injection. Tissue distribution of 125 I-labeled albumin preparations was determined in either naive or chronically injected mice

  11. Long-term intravenous treatment of Pompe disease with recombinant human alpha-glucosidase from milk.

    Science.gov (United States)

    Van den Hout, Johanna M P; Kamphoven, Joep H J; Winkel, Léon P F; Arts, Willem F M; De Klerk, Johannes B C; Loonen, M Christa B; Vulto, Arnold G; Cromme-Dijkhuis, Adri; Weisglas-Kuperus, Nynke; Hop, Wim; Van Hirtum, Hans; Van Diggelen, Otto P; Boer, Marijke; Kroos, Marian A; Van Doorn, Pieter A; Van der Voort, Edwin; Sibbles, Barbara; Van Corven, Emiel J J M; Brakenhoff, Just P J; Van Hove, Johan; Smeitink, Jan A M; de Jong, Gerard; Reuser, Arnold J J; Van der Ploeg, Ans T

    2004-05-01

    Recent reports warn that the worldwide cell culture capacity is insufficient to fulfill the increasing demand for human protein drugs. Production in milk of transgenic animals is an attractive alternative. Kilogram quantities of product per year can be obtained at relatively low costs, even in small animals such as rabbits. We tested the long-term safety and efficacy of recombinant human -glucosidase (rhAGLU) from rabbit milk for the treatment of the lysosomal storage disorder Pompe disease. The disease occurs with an estimated frequency of 1 in 40,000 and is designated as orphan disease. The classic infantile form leads to death at a median age of 6 to 8 months and is diagnosed by absence of alpha-glucosidase activity and presence of fully deleterious mutations in the alpha-glucosidase gene. Cardiac hypertrophy is characteristically present. Loss of muscle strength prevents infants from achieving developmental milestones such as sitting, standing, and walking. Milder forms of the disease are associated with less severe mutations and partial deficiency of alpha-glucosidase. In the beginning of 1999, 4 critically ill patients with infantile Pompe disease (2.5-8 months of age) were enrolled in a single-center open-label study and treated intravenously with rhAGLU in a dose of 15 to 40 mg/kg/week. Genotypes of patients were consistent with the most severe form of Pompe disease. Additional molecular analysis failed to detect processed forms of alpha-glucosidase (95, 76, and 70 kDa) in 3 of the 4 patients and revealed only a trace amount of the 95-kDa biosynthetic intermediate form in the fourth (patient 1). With the more sensitive detection method, 35S-methionine incorporation, we could detect low-level synthesis of -glucosidase in 3 of the 4 patients (patients 1, 2, and 4) with some posttranslation modification from 110 kDa to 95 kDa in 1 of them (patient 1). One patient (patient 3) remained totally deficient with both detection methods (negative for cross

  12. Alpha-glucosidase inhibitors for patients with type 2 diabetes: results from a Cochrane systematic review and meta-analysis.

    NARCIS (Netherlands)

    Laar, F.A. van de; Lucassen, P.L.B.J.; Akkermans, R.P.; Lisdonk, E.H. van de; Rutten, G.E.H.M.; Weel, C. van

    2005-01-01

    OBJECTIVE: To review the effects of monotherapy with alpha-glucosidase inhibitors (AGIs) for patients with type 2 diabetes, with respect to mortality, morbidity, glycemic control, insulin levels, plasma lipids, body weight, and side effects. RESEARCH DESIGN AND METHODS: We systematically searched

  13. An isozyme of acid alpha-glucosidase with reduced catalytic activity for glycogen.

    Science.gov (United States)

    Beratis, N G; LaBadie, G U; Hirschhorn, K

    1980-03-01

    Both the common and a variant isozyme of acid alpha-glucosidase have been purified from a heterozygous placenta with CM-Sephadex, ammonium sulfate precipitation, dialysis, Amicon filtration, affinity chromatography by Sephadex G-100, and DEAE-cellulose chromatography. Three and two activity peaks, from the common and variant isozymes, respectively, were obtained by DEAE-cellulose chromatography using a linear NaCl gradient. The three peaks of activity of the common isozyme were eluted with 0.08, 0.12, and 0.17 M NaCl, whereas the two peaks of the variant, with 0.01 and 0.06 M NaCl. The pH optimum and thermal denaturation at 57 degrees C were the same in all enzyme peaks of both isozymes. Rabbit antiacid alpha-glucosidase antibodies produced against the common isozyme were found to cross-react with both peaks of the variant isozyme. The two isozymes shared antigenic identity and had similar Km's with maltose as substrate. Normal substrate saturation kinetics were observed with the common isozyme when glycogen was the substrate, but the variant produced an S-shaped saturation curve indicating a phase of negative and positive cooperativity at low and high glycogen concentrations, respectively. The activity of the variant was only 8.6% and 19.2% of the common isozyme when assayed with nonsaturating and saturating concentrations of glycogen, respectively. A similar rate of hydrolysis of isomaltose by both isozymes was found indicating that the reduced catalytic activity of the variant isozyme toward glycogen is not the result of a reduced ability of this enzyme to cleave the alpha-1,6 linkages of glycogen.

  14. Antioxidant, cytotoxic and alpha-glucosidase inhibition activities from the Mexican berry "Anacahuita" (Cordia boissieri).

    Science.gov (United States)

    Viveros-Valdez, Ezequiel; Jaramillo-Mora, Carlos; Oranday-Cardenas, Azucena; Mordn-Martinez, Javier; Carranza-Rosales, Pilar

    2016-09-01

    This study describes the total phenolic and flavonoid content as well as cytotoxic, alpha-glucosidase inhibition and antiradical/antioxidant potential of extracts obtained from the edible fruits of Cordia boissieri, which is widely distributed throughout northeastern Mexico. Phenolic and flavonoid content were evaluated by means of the Folin-Ciocalteu method and aluminum chloride colorimetric assay respectively. The antiradical/antioxidant activity was determined by the 2,2-diphenyl-1-picrylhydrazyl (DPPH) scavenging and Trolox Equivalent Antioxidant Capacity (TEAC) assays. Cytotoxic activity was assessed by means of human cancer cell lines (MCF-7 and HeLa), alpha-glucosidase inhibition was determined by colorimetric assay using p-Nitrophenyl a-D-glucopyranoside (PNPG) as a substrate. Results indicate that extract of C. boissieri fruit has a good antioxidant potential to show a EC₅₀: 137.76 ± 35 ptg/mL and 65 ±2 ltM/g in the DPPH and TEAC assays respectively, inhibitor of the enzyme alpha-glu- cosidase involved in sugar uptake (ICSO: 215.20 ± 35 μg/ mL), cytotoxic activities against MCF-7 (IC50: 310 ± 42 μg/mL) and HeLa (IC₅₀0: 450.4 ±21μgg/mL) cancer cell lines as well as an important phenolic content with 230 t 23 mg/1OOg and 54±11 mg100g g of phenols and flavonoids totals respectively. These results point towards an interesting potential for the fruits of C. boissieri as chemopreventive properties and expand the possibilities.

  15. Purification, enzymatic characterization, and nucleotide sequence of a high-isoelectric-point alpha-glucosidase from barley malt

    DEFF Research Database (Denmark)

    Frandsen, T P; Lok, F; Mirgorodskaya, E

    2000-01-01

    in the transition state complex. Mass spectrometry of tryptic fragments assigned the 92-kD protein to a barley cDNA (GenBank accession no. U22450) that appears to encode an alpha-glucosidase. A corresponding sequence (HvAgl97; GenBank accession no. AF118226) was isolated from a genomic phage library using a c......High-isoelectric-point (pI) alpha-glucosidase was purified 7, 300-fold from an extract of barley (Hordeum vulgare) malt by ammonium sulfate fractionation, ion-exchange, and butyl-Sepharose chromatography. The enzyme had high activity toward maltose (k(cat) = 25 s(-1)), with an optimum at pH 4...

  16. Nutrient Content, Phytonutrient Composition, Alpha Amylase, Alpha Glucosidase Inhibition Activity and Antioxidant Activity of the Stoechospermum Marginatum Collected in Pre Monsoon Season

    OpenAIRE

    Reka Palanivel; Thahira Banu Azeez; Seethalakshmi Muthaya

    2017-01-01

    The objective of this study was to investigate the nutrient content, phytonutrient composition, physicochemical properties, alpha amylase and alpha glucosidase inhibition activity and antioxidant activity of the brown algae Stoechospermum marginatum collected from Gulf of Mannar, Tamil Nadu, India in pre monsoon season (June- September, 2015). Six and eight hours of ethanol and aqueous extract of Stoechospermum marginatum were used for phytonutrient screening, alpha amylase, alpha glucosidase...

  17. Cloning and Molecular Characterization of an Alpha-Glucosidase (MalH) from the Halophilic Archaeon Haloquadratum walsbyi.

    Science.gov (United States)

    Cuebas-Irizarry, Mara F; Irizarry-Caro, Ricardo A; López-Morales, Carol; Badillo-Rivera, Keyla M; Rodríguez-Minguela, Carlos M; Montalvo-Rodríguez, Rafael

    2017-11-21

    We report the heterologous expression and molecular characterization of the first extremely halophilic alpha-glucosidase (EC 3.2.1.20) from the archaeon Haloquadratum walsbyi . A 2349 bp region ( Hqrw_2071 ) from the Hqr. walsbyi C23 annotated genome was PCR-amplified and the resulting amplicon ligated into plasmid pET28b(+), expressed in E. coli Rosetta cells, and the resulting protein purified by Ni-NTA affinity chromatography. The recombinant protein showed an estimated molecular mass of 87 kDa, consistent with the expected value of the annotated protein, and an optimal activity for the hydrolysis of α-PNPG was detected at 40 °C, and at pH 6.0. Enzyme activity values were the highest in the presence of 3 M NaCl or 3-4 M KCl. However, specific activity values were two-fold higher in the presence of 3-4 M KCl when compared to NaCl suggesting a cytoplasmic localization. Phylogenetic analyses, with respect to other alpha-glucosidases from members of the class Halobacteria, showed that the Hqr. walsbyi MalH was most similar (up to 41%) to alpha-glucosidases and alpha-xylosidases of Halorubrum . Moreover, computational analyses for the detection of functional domains, active and catalytic sites, as well as 3D structural predictions revealed a close relationship with an E. coli YicI-like alpha-xylosidase of the GH31 family. However, the purified enzyme did not show alpha-xylosidase activity. This narrower substrate range indicates a discrepancy with annotations from different databases and the possibility of specific substrate adaptations of halophilic glucosidases due to high salinity. To our knowledge, this is the first report on the characterization of an alpha-glucosidase from the halophilic Archaea, which could serve as a new model to gain insights into carbon metabolism in this understudied microbial group.

  18. Cloning and Molecular Characterization of an Alpha-Glucosidase (MalH from the Halophilic Archaeon Haloquadratum walsbyi

    Directory of Open Access Journals (Sweden)

    Mara F. Cuebas-Irizarry

    2017-11-01

    Full Text Available We report the heterologous expression and molecular characterization of the first extremely halophilic alpha-glucosidase (EC 3.2.1.20 from the archaeon Haloquadratum walsbyi. A 2349 bp region (Hqrw_2071 from the Hqr. walsbyi C23 annotated genome was PCR-amplified and the resulting amplicon ligated into plasmid pET28b(+, expressed in E. coli Rosetta cells, and the resulting protein purified by Ni-NTA affinity chromatography. The recombinant protein showed an estimated molecular mass of 87 kDa, consistent with the expected value of the annotated protein, and an optimal activity for the hydrolysis of α-PNPG was detected at 40 °C, and at pH 6.0. Enzyme activity values were the highest in the presence of 3 M NaCl or 3–4 M KCl. However, specific activity values were two-fold higher in the presence of 3–4 M KCl when compared to NaCl suggesting a cytoplasmic localization. Phylogenetic analyses, with respect to other alpha-glucosidases from members of the class Halobacteria, showed that the Hqr. walsbyi MalH was most similar (up to 41% to alpha-glucosidases and alpha-xylosidases of Halorubrum. Moreover, computational analyses for the detection of functional domains, active and catalytic sites, as well as 3D structural predictions revealed a close relationship with an E. coli YicI-like alpha-xylosidase of the GH31 family. However, the purified enzyme did not show alpha-xylosidase activity. This narrower substrate range indicates a discrepancy with annotations from different databases and the possibility of specific substrate adaptations of halophilic glucosidases due to high salinity. To our knowledge, this is the first report on the characterization of an alpha-glucosidase from the halophilic Archaea, which could serve as a new model to gain insights into carbon metabolism in this understudied microbial group.

  19. Treatment with acarbose, an alpha-glucosidase inhibitor, reduces increased albumin excretion in streptozotocin-diabetic rats.

    Science.gov (United States)

    Cohen, M P; Vasselli, J R; Neuman, R G; Witt, J

    1995-10-01

    1. We examined the effect of the alpha-glucosidase inhibitor acarbose on urinary albumin excretion (UAE) in streptozotocin diabetic rats. 2. Treatment with acarbose for 8 weeks after induction of diabetes prevented the significant increase in UAE observed in untreated diabetic rats relative to nondiabetic controls. 3. Acarbose significantly reduced integrated glycemia, which correlated with albumin excretion rates, and exerts a salutary effect on diabetic renal dysfunction.

  20. Alpha-glucosidase inhibitory and antiplasmodial properties of terpenoids from the leaves of Buddleja saligna Willd.

    Science.gov (United States)

    Chukwujekwu, Jude C; Rengasamy, Kannan R R; de Kock, Carmen A; Smith, Peter J; Slavětínská, Lenka Poštová; van Staden, Johannes

    2016-01-01

    In our continuing search for biologically active natural product(s) of plant origin, Buddleja saligna, a South African medicinal plant, was screened in line with its traditional use for antidiabetic (yeast alpha glucosidase inhibitory) and antiplasmodial (against a chloroquine sensitive strain of Plasmodium falciparum (NF54)) activities. The hexane fraction showed the most promising activity with regards to its antidiabetic (IC(50) = 260 ± 0.112 µg/ml) and antiplasmodial (IC(50) = 8.5 ± 1.6 µg/ml) activities. Using activity guided fractionation three known terpenoids (betulonic acid, betulone and spinasterol) were isolated from this species for the first time. The compounds displayed varying levels of biological activities (antidiabetic: 27.31 µg/ml ≥ IC(50) ≥ 5.6 µg/ml; antiplasmodial: 14 µg/ml ≥ IC(50) ≥ 2 µg/ml) with very minimal toxicity.

  1. In vitro alpha glucosidase inhibition and free-radical scavenging activity of propolis from Thai stingless bees in mangosteen orchard

    Directory of Open Access Journals (Sweden)

    Boonyadist Vongsak

    Full Text Available ABSTRACTThe chemical component and biological activity of propolis depend on flora area of bee collection and bee species. In the study, the propolis from three stingless bee species, Lepidotrigona ventralis Smith, Lepidotrigona terminata Smith, and Tetragonula pagdeni Schwarz, was collected in the same region of mangosteen garden from Thailand. Total phenolic content, alpha glucosidase inhibitory effect, and free-radical scavenging activity using FRAP, ABTS, DPPH assays were determined. The most potent activity of propolis extract was investigated for bioactive compounds and their quantity. The ethanol extract of T. pagdeni propolis had the highest total phenolic content 12.83 ± 0.72 g of gallic acid equivalents in 100 g of the extract, and the strongest alpha glucosidase inhibitory effect with the IC50 of 70.79 ± 6.44 µg/ml. The free-radical scavenging activity evaluated by FRAP, ABTS, DPPH assays showed the FRAP value of 279.70 ± 20.55 µmol FeSO4 equivalent/g extract and the IC50 of 59.52 ± 10.76 and 122.71 ± 11.76 µg/ml, respectively. Gamma- and alpha-mangostin from T. pagdeni propolis extract were isolated and determined for the biological activity. Gamma-mangostin exhibited the strongest activity for both alpha glucosidase inhibitory effect and free-radical scavenging activity. Using HPLC quantitative analysis method, the content of gamma- and alpha-mangostin in the extract was found to be 0.94 ± 0.01 and 2.77 ± 0.08% (w/w, respectively. These findings suggested that T. pagdeni propolis may be used as a more suitable raw material for nutraceutical and pharmaceutical products and these mangostin derivatives as markers.

  2. Synergisms in Alpha-glucosidase Inhibition and Antioxidant Activity of Camellia sinensis L. Kuntze and Eugenia uniflora L. Ethanolic Extracts

    Science.gov (United States)

    Vinholes, Juliana; Vizzotto, Márcia

    2017-01-01

    Background: Camellia sinensis, the most consumed and popular beverages worldwide, and Eugenia uniflora, a Brazilian native species, have been already confirmed to have beneficial effects in the treatment of diabetes mellitus. However, their potential acting together against an enzyme linked to this pathology has never been exploited. Objective: The aim of this study was to evaluate the inhibitory properties of individual and combined ethanolic extracts of the leaves of C. sinensis and E. uniflora over alpha-glucosidase, a key digestive enzyme used on the Type 2 diabetes mellitus (T2DM) control. In addition, their inhibitory activity against 2,2-diphenyl-1-picrylhydrazyl radical (DPPH•) and peroxyl radicals was also assayed. Materials and Methods: Enzyme inhibition and antioxidant potential were assessed based on in vitro assays. Total phenolic compounds, carotenoids, and chlorophylls A and B were achieved using spectrophotometric methods. Results: E. uniflora was almost 40 times more active on alpha-glucosidase than C. sinensis and combined extracts showed a significant synergistic effect with an obtained IC50 value almost 5 times lower than the theoretical value. C. sinensis extract was twice more active than E. uniflora concerning DPPH•, in contrast, E. uniflora was almost 10 times more effective than C. sinensis on inhibition of peroxyl radicals with a significant synergistic effect for combined extracts. The extracts activities may be related with their phytochemicals, mainly phenolic compounds, and chlorophylls. Conclusion: Combined C. sinensis and E. uniflora ethanolic extracts showed synergistic effect against alpha-glucosidase and lipid peroxidation. These herbal combinations can be used to control postprandial hyperglycemia and can also provide antioxidant defenses to patients with T2DM. SUMMARY Alfa-glucosidase and antioxidant Interaction between Camellia sinensis L. Kuntze and Eugenia uniflora L. ethanolic extracts was investigated.Extracts showed

  3. Synergisms in Alpha-glucosidase Inhibition and Antioxidant Activity of Camellia sinensis L. Kuntze and Eugenia uniflora L. Ethanolic Extracts.

    Science.gov (United States)

    Vinholes, Juliana; Vizzotto, Márcia

    2017-01-01

    Camellia sinensis , the most consumed and popular beverages worldwide, and Eugenia uniflora , a Brazilian native species, have been already confirmed to have beneficial effects in the treatment of diabetes mellitus. However, their potential acting together against an enzyme linked to this pathology has never been exploited. The aim of this study was to evaluate the inhibitory properties of individual and combined ethanolic extracts of the leaves of C. sinensis and E. uniflora over alpha-glucosidase, a key digestive enzyme used on the Type 2 diabetes mellitus (T2DM) control. In addition, their inhibitory activity against 2,2-diphenyl-1-picrylhydrazyl radical (DPPH • ) and peroxyl radicals was also assayed. Enzyme inhibition and antioxidant potential were assessed based on in vitro assays. Total phenolic compounds, carotenoids, and chlorophylls A and B were achieved using spectrophotometric methods. E. uniflora was almost 40 times more active on alpha-glucosidase than C. sinensis and combined extracts showed a significant synergistic effect with an obtained IC 50 value almost 5 times lower than the theoretical value. C. sinensis extract was twice more active than E. uniflora concerning DPPH • , in contrast, E. uniflora was almost 10 times more effective than C. sinensis on inhibition of peroxyl radicals with a significant synergistic effect for combined extracts. The extracts activities may be related with their phytochemicals, mainly phenolic compounds, and chlorophylls. Combined C. sinensis and E. uniflora ethanolic extracts showed synergistic effect against alpha-glucosidase and lipid peroxidation. These herbal combinations can be used to control postprandial hyperglycemia and can also provide antioxidant defenses to patients with T2DM. Alfa-glucosidase and antioxidant Interaction between Camellia sinensis L. Kuntze and Eugenia uniflora L. ethanolic extracts was investigated.Extracts showed synergistic effect over alpha-glucosidase and peroxyl radicals

  4. Repetitive postprandial hyperglycemia increases cardiac ischemia/reperfusion injury: prevention by the alpha-glucosidase inhibitor acarbose.

    Science.gov (United States)

    Frantz, Stefan; Calvillo, Laura; Tillmanns, Jochen; Elbing, Inka; Dienesch, Charlotte; Bischoff, Hilmar; Ertl, Georg; Bauersachs, Johann

    2005-04-01

    Protective effects of the alpha-glucosidase inhibitor acarbose have been reported for various diabetic complications. In the STOP-NIDDM study, even patients without overt diabetes, but with impaired glucose tolerance, had a reduction in cardiovascular events when treated with acarbose. Therefore, we investigated the effect of repetitive postprandial hyperglycemia on the cardiac ischemia/reperfusion injury in vivo. Mice were treated daily by single applications of placebo, sucrose (4 g/kg body weight), or sucrose + acarbose (10 mg/kg body weight) by gavage for 7 days. Acarbose treatment significantly reduced the sucrose-induced increase in plasma glucose concentration. Subsequently, animals underwent 30 min of ischemia by coronary artery ligation and 24 h of reperfusion in vivo. In the sucrose group, ischemia/reperfusion damage was significantly increased (infarct/area at risk, placebo vs. sucrose, 38.8+/-7.5% vs. 62.2+/-4.8%, P<0.05). This was prevented by acarbose treatment (infarct/area at risk 30.7+/-7.2%). While myocardial inflammation was similar in all groups, oxidative stress as indicated by a significant increase in lipid peroxides was enhanced in the sucrose, but not in the sucrose + acarbose group. In summary, repetitive postprandial hyperglycemia increases ischemia/reperfusion damage. This effect can be prevented by treatment with the alpha-glucosidase inhibitor acarbose.

  5. Recombinant human acid alpha-glucosidase: high level production in mouse milk, biochemical characteristics, correction of enzyme deficiency in GSDII KO mice

    NARCIS (Netherlands)

    A.G.A. Bijvoet (Agnes); M.A. Kroos (Marian); F.R. Pieper (Frank); M. Van der Vliet (Martin); H.A. de Boer (Herman); A.T. van der Ploeg (Ans); M.Ph. Verbeet (Martin); A.J.J. Reuser (Arnold)

    1998-01-01

    textabstractGlycogen storage disease type II (GSDII) is caused by lysosomal acid alpha-glucosidase deficiency. Patients have a rapidly fatal or slowly progressive impairment of muscle function. Enzyme replacement therapy is under investigation. For large-scale, cost-effective

  6. Nutrient Content, Phytonutrient Composition, Alpha Amylase, Alpha Glucosidase Inhibition Activity and Antioxidant Activity of the Stoechospermum Marginatum Collected in Pre Monsoon Season

    Directory of Open Access Journals (Sweden)

    Reka Palanivel

    2017-03-01

    Full Text Available The objective of this study was to investigate the nutrient content, phytonutrient composition, physicochemical properties, alpha amylase and alpha glucosidase inhibition activity and antioxidant activity of the brown algae Stoechospermum marginatum collected from Gulf of Mannar, Tamil Nadu, India in pre monsoon season (June- September, 2015. Six and eight hours of ethanol and aqueous extract of Stoechospermum marginatum were used for phytonutrient screening, alpha amylase, alpha glucosidase inhibition activity and antioxidant activity. From the results of the study it is understood that Stoechospermum marginatum contain a high amount of carbohydrate, protein, crude fiber and phytonutrients like tannin, flavonoid, saponin, alkaloid, terpenoids, steroid and total phenolic content. The physicochemical properties namely Water absorption and Swelling power were very promising. Alpha amylase and alpha glucosidase inhibition activity was recorded to be high in both aqueous and ethanol extracts of eight hour extraction than in extracts taken from six hours extraction. Antioxidant activity was detected using DPPH, FRAP, beta carotene scavenging and H2O2 assay and found to have a high radical scavenging activity. Stoechospermum marginatum possess a valuable amount of total phenolic content and other phytonutrients and physicochemical properties, it may the reason for the potential inhibition of alpha amylase, alpha glucosidase and antioxidant activity. It is concluded from the study that the brown algae may be incorporated into foods to enhance their nutritional and therapeutic value.

  7. Alpha amylase and Alpha glucosidase inhibitory effects of aqueous stem extract of Salacia oblonga and its GC-MS analysis

    Directory of Open Access Journals (Sweden)

    Gladis Raja Malar Chelladurai

    2018-05-01

    Full Text Available ABSTRACT Our present investigation deals with the phytochemical screening, estimation of total flavonoids, terpenoids and tannin contents to evaluate the anti-diabetic activities of Salacia oblonga stem followed by GC-MS analysis. It explores the natural compounds and the potential α-amylase and α-glucosidase inhibitory actions of stem extracts. The aqueous stem extract was selected from other extracts (ethanol, acetone, petroleum ether and chloroform for the in vitro study of anti-diabetic activity by alpha amylase and alpha glucosidase inhibitory assays. The stem extract was also analyzed by gas chromatography mass spectrometry to identify the natural chemical components. Phytochemical analysis of aqueous stem extract showed major classes of secondary metabolites such as phenols, flavonoids, alkaloids, terpenoids, tannins, saponins. The total flavonoid, terpenoid, and tannin contents were quantified as 19.82±0.06 mg QE/g, 96.2±0.20 mg/g and 11.25±0.03 mg TAE/g respectively. The percentage inhibition of assays showed maximum inhibitory effects (59.46±0.04% and 68.51±0.01% at a concentration of 100 mg/mL. The IC50 values of stem extract was found to be 73.56 mg/mL and 80.90 mg/mL for alpha amylase and alpha glucosidase inhibition. Fifteen chemical constituents were found by GC-MS analysis. This study suggest the aqueous stem extract of Salacia oblonga might be considered as potential source of bio active constituents with excellent antidiabetic activity.

  8. Divergent clinical outcomes of alpha-glucosidase enzyme replacement therapy in two siblings with infantile-onset Pompe disease treated in the symptomatic or pre-symptomatic state

    OpenAIRE

    Matsuoka, Takashi; Miwa, Yoshiyuki; Tajika, Makiko; Sawada, Madoka; Fujimaki, Koichiro; Soga, Takashi; Tomita, Hideshi; Uemura, Shigeru; Nishino, Ichizo; Fukuda, Tokiko; Sugie, Hideo; Kosuga, Motomichi; Okuyama, Torayuki; Umeda, Yoh

    2016-01-01

    Pompe disease is an autosomal recessive, lysosomal glycogen storage disease caused by acid ?-glucosidase deficiency. Infantile-onset Pompe disease (IOPD) is the most severe form and is characterized by cardiomyopathy, respiratory distress, hepatomegaly, and skeletal muscle weakness. Untreated, IOPD generally results in death within the first year of life. Enzyme replacement therapy (ERT) with recombinant human acid alpha glucosidase (rhGAA) has been shown to markedly improve the life expectan...

  9. Oral delivery of Acid Alpha Glucosidase epitopes expressed in plant chloroplasts suppresses antibody formation in treatment of Pompe mice.

    Science.gov (United States)

    Su, Jin; Sherman, Alexandra; Doerfler, Phillip A; Byrne, Barry J; Herzog, Roland W; Daniell, Henry

    2015-10-01

    Deficiency of acid alpha glucosidase (GAA) causes Pompe disease in which the patients systemically accumulate lysosomal glycogen in muscles and nervous systems, often resulting in infant mortality. Although enzyme replacement therapy (ERT) is effective in treating patients with Pompe disease, formation of antibodies against rhGAA complicates treatment. In this report, we investigated induction of tolerance by oral administration of GAA expressed in chloroplasts. Because full-length GAA could not be expressed, N-terminal 410-amino acids of GAA (as determined by T-cell epitope mapping) were fused with the transmucosal carrier CTB. Tobacco transplastomic lines expressing CTB-GAA were generated through site-specific integration of transgenes into the chloroplast genome. Homoplasmic lines were confirmed by Southern blot analysis. Despite low-level expression of CTB-GAA in chloroplasts, yellow or albino phenotype of transplastomic lines was observed due to binding of GAA to a chloroplast protein that has homology to mannose-6 phosphate receptor. Oral administration of the plant-made CTB-GAA fusion protein even at 330-fold lower dose (1.5 μg) significantly suppressed immunoglobulin formation against GAA in Pompe mice injected with 500 μg rhGAA per dose, with several-fold lower titre of GAA-specific IgG1 and IgG2a. Lyophilization increased CTB-GAA concentration by 30-fold (up to 190 μg per g of freeze-dried leaf material), facilitating long-term storage at room temperature and higher dosage in future investigations. This study provides the first evidence that oral delivery of plant cells is effective in reducing antibody responses in ERT for lysosomal storage disorders facilitating further advances in clinical investigations using plant cell culture system or in vitro propagation. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  10. Study of the role of epididymal alpha-glucosidase in the fertility of male rats by the administration of the enzyme inhibitor castanospermine.

    Science.gov (United States)

    Yeung, C H; Cooper, T G

    1994-11-01

    The activity of epididymal alpha-glucosidase in adult rats was rapidly suppressed to histochemically undetectable levels within 2 days by the continuous release of the enzyme inhibitor castanospermine via a peritoneal osmotic pump at a rate of 100-200 nmol h-1. It was established that mating activities overnight depleted 72% of the spermatozoa in the distal cauda, which was replenished in 2 days, and that fertility began to decline 3 weeks after efferent duct ligation. Male rats of proven mating proficiency and fertility were treated with castanospermine, or buffered saline as control, for up to 30 days and enzyme inhibition was confirmed at the end of treatment by histochemistry. Fertility was normal at the first mating test on day 7, significantly decreased at the second mating on day 9, but recovered in a stepwise manner at subsequent matings on days 12 and 14. Delaying the third mating until day 25 did not sustain the transient subfertility. However, prolonging sperm storage in the distal cauda epididymides and preventing replenishment with freshly matured spermatozoa, by efferent duct ligation for 14 days performed on day 15 during castanospermine administration, caused a decrease in fertility and a change in the kinematics of epididymal spermatozoa of the castanospermine-treated group. In control rats, binding of epididymal spermatozoa to Vicia faba, a lectin specific for glucose and glucosamine, and mannose and mannosamine residues, decreased from the proximal caput to the distal corpus coincident with the increase in alpha-glucosidase activity on the epithelial brush border. Lectin binding then increased in the cauda where enzyme activity was absent. However, castanospermine treatment did not significantly alter this binding profile. The findings suggest that epididymal alpha-glucosidase does not play a crucial role in the development of sperm fertilizing capacity, but may be involved in the preparation of spermatozoa for storage.

  11. Production of enzymatically active recombinant full-length barley high pI alpha-glucosidase of glycoside family 31 by high cell-density fermentation of Pichia pastoris and affinity purification

    DEFF Research Database (Denmark)

    Næsted, Henrik; Kramhøft, Birte; Lok, F.

    2006-01-01

    Recombinant barley high pI alpha-glucosidase was produced by high cell-density fermentation of Pichia pastoris expressing the cloned full-length gene. The gene was amplified from a genomic clone and exons (coding regions) were assembled by overlap PCR. The resulting cDNA was expressed under contr...... nM x s(-1), and 85 s(-1) using maltose as substrate. This work presents the first production of fully active recombinant alpha-glucosidase of glycoside hydrolase family 31 from higher plants. (c) 2005 Elsevier Inc. All rights reserved....

  12. alpha-Glucosidase inhibition (acarbose) fails to enhance secretion of glucagon-like peptide 1 (7-36 amide) and to delay gastric emptying in Type 2 diabetic patients

    DEFF Research Database (Denmark)

    Hücking, K; Kostic, Z; Pox, C

    2005-01-01

    AIM: Acarbose is able to enhance GLP-1 release and delay gastric emptying in normal subjects. The effect of alpha-glucosidase inhibition on GLP-1 has been less evident in Type 2 diabetic patients. The aim of this study was to investigate the possible influence of acarbose on GLP-1 release and gas...

  13. Sugar transport in the thermoacidophilic archaeon Sulfolobus solfataricus

    NARCIS (Netherlands)

    Albers, Sonja-Verena

    2001-01-01

    Summary and concluding remarks Introduction The archaeon Sulfolobus solfataricus is a thermoacidophile preferring growth at around 80oC and a pH of 2.5 to 3.5. As a thermoacidophile S. solfataricus faces two major problems: firstly, the proton permeability of membranes increases with temperature

  14. J-GLOBAL MeSH Dictionary: Sulfolobus solfataricus [MeCab user dictionary for science technology term[Archive

    Lifescience Database Archive (English)

    Full Text Available MeCab user dictionary for science technology term Sulfolobus solfataricus 名詞 一般 * * * * Sulfolobus solfataricus ... MeSH D048229 200906045592943760 C LS07 UNKNOWN_2 Sulfolobus solfataricus

  15. "Hot standards" for the thermoacidophilic archaeon Sulfolobus solfataricus

    NARCIS (Netherlands)

    Zaparty, M.; Esser, D.; Gertig, S.; Haferkamp, P.; Kouril, T.; Sierocinski, P.; Pham, T.K.; Manica, A.; Reimann, J.; Schreiber, K.; Teichmann, D.; Wolferen, van M.E.; Jan, von M.; Wieloch, P.; Albers, S.V.; Driessen, A.J.M.; Klenk, H.P.; Schleper, C.; Schomburg, D.; Oost, van der J.; Wright, P.C.; Siebers, B.

    2010-01-01

    Within the archaea, the thermoacidophilic crenarchaeote Sulfolobus solfataricus has become an important model organism for physiology and biochemistry, comparative and functional genomics, as well as, more recently also for systems biology approaches. Within the Sulfolobus Systems Biology

  16. "Hot standards" for the thermoacidophilic archaeon Sulfolobus solfataricus

    NARCIS (Netherlands)

    Zaparty, Melanie; Esser, Dominik; Gertig, Susanne; Haferkamp, Patrick; Kouril, Theresa; Manica, Andrea; Pham, Trong K.; Reimann, Julia; Schreiber, Kerstin; Sierocinski, Pawel; Teichmann, Daniela; van Wolferen, Marleen; von Jan, Mathias; Wieloch, Patricia; Albers, Sonja V.; Driessen, Arnold J. M.; Klenk, Hans-Peter; Schleper, Christa; Schomburg, Dietmar; van der Oost, John; Wright, Phillip C.; Siebers, Bettina

    Within the archaea, the thermoacidophilic crenarchaeote Sulfolobus solfataricus has become an important model organism for physiology and biochemistry, comparative and functional genomics, as well as, more recently also for systems biology approaches. Within the Sulfolobus Systems Biology

  17. KAPASITAS ANTIOKSIDAN DAN INHIBITOR ALFA GLUKOSIDASE EKSTRAK UMBI BAWANG DAYAK [Antioxidant and Alpha-Glucosidase Inhibitory Properties of Bawang Dayak Bulb Extracts

    Directory of Open Access Journals (Sweden)

    Andi Early Febrinda*

    2013-12-01

    Full Text Available Bawang dayak (Eleutherine palmifolia is an indigenous plant in Borneo traditionally used by Dayak tribes to treat any kind of degenerative deseases including diabetes mellitus. The purpose of this research was to measure antioxidant and antidiabetic capacities of water and ethanolic extracts of bawang dayak bulb. Parameters evaluated in this research were phytochemical screening, total phenolics, flavonoid content, DPPH free-radical scavenging activity, and alpha glucosidase inhibiting (AGI activity. The result showed that the total phenolics and flavonoid content in bawang dayak ethanolic extract (217.71 mg GAE/g and 65.35 mg QE/g were higher than that of the water extract (139.93 mg GAE/g and 16.95 mg QE/g. The ethanolic extract also had higher antioxidant and AGI activities (IC50 112 and 241 ppm than that of the water extract (IC50 526 and 505 ppm. In addition, the IC50 values for AGI in bawang dayak ethanolic extract was lower than acarbose which is known as a commercial antidiabetic agent.

  18. Alpha-glucosidase inhibitor, acarbose, improves glycamic control and reduces body weight in type 2 diabetes: Findings on indian patients from the pooled data analysis

    Directory of Open Access Journals (Sweden)

    Sanjay Kalra

    2013-01-01

    Full Text Available Alpha-glucosidase inhibitors are widely used especially in Asian countries as a treatment option for type 2 diabetes patients with high postprandial glycemia (PPG. The higher carbohydrate in the Indian diets lead to greater prandial glycemic excursion, increased glucosidase, and incretin activity in the gut and may need special therapeutic strategies to tackle these glucose peaks. This is the subgroup analysis of Indian subjects who participated in the GlucoVIP study that investigated the effectiveness and tolerability of acarbose as add-on or monotherapy in a range of patients with type 2 diabetes mellitus. A total of 1996 Indian patients were included in the effectiveness analysis. After 12.5 weeks (mean, the mean change in 2-hour PPG from baseline was −74.4 mg/dl, mean HbA1c decreased by -1.0%, and mean fasting blood glucose decreased by -37.9 mg/dl. The efficacy of acarbose was rated "very good" or "good" in 91.1% of patients, and tolerability as "very good" or "good" in 88.0% of patients. The results of this observational study suggest that acarbose was effective and well tolerated in the Indian patients with T2DM.

  19. Characteristics of alpha-glucosidase production from recombinant Aspergillus oryzae by membrane-surface liquid culture in comparison with various cultivation methods.

    Science.gov (United States)

    Morita, Masakazu; Shimamura, Hiroko; Ishida, Natsuko; Imamura, Koreyoshi; Sakiyama, Takaharu; Nakanishi, Kazuhiro

    2004-01-01

    alpha-Glucosidase was produced using recombinant Aspergillus oryzae by membrane-surface liquid culture (MSLC), a method previously developed by the authors and the results compared with other methods, including shaking flask culture (SFC), agar-plate culture (APC), culture on urethane sponge supports (USC), and liquid surface culture (LSC) to determine possible reasons for the advantageous features of MSLC. When yeast extract was used as a nitrogen source, the amount of enzyme produced by MSLC was 5 or more times higher than those for SFC and LSC, but similar to that using APC. Enzyme production in USC was slightly lower than in MSLC and APC. Cell growth was similar irrespective of the cultivation method used. When NaNO3, a typical inorganic nitrogen source was used, enzyme production in all the cultures was lower than that using yeast extract. However, even using NaNO3, the amount of the enzyme produced by MSLC was 8 to 20 times higher than those by SFC, APC, USC, and LSC. Although cell growth using NaNO3 was similar to that for yeast extract in MSLC, it was markedly decreased in SFC, APC, and LSC. The reason for the difference in enzyme productivity for various cultivation methods using yeast extract and NaNO3 as a nitrogen source is discussed, on the basis of the experimental findings. The role of the oxygen transfer effect and gene expression levels in enzyme production were also examined.

  20. Divergent clinical outcomes of alpha-glucosidase enzyme replacement therapy in two siblings with infantile-onset Pompe disease treated in the symptomatic or pre-symptomatic state.

    Science.gov (United States)

    Matsuoka, Takashi; Miwa, Yoshiyuki; Tajika, Makiko; Sawada, Madoka; Fujimaki, Koichiro; Soga, Takashi; Tomita, Hideshi; Uemura, Shigeru; Nishino, Ichizo; Fukuda, Tokiko; Sugie, Hideo; Kosuga, Motomichi; Okuyama, Torayuki; Umeda, Yoh

    2016-12-01

    Pompe disease is an autosomal recessive, lysosomal glycogen storage disease caused by acid α-glucosidase deficiency. Infantile-onset Pompe disease (IOPD) is the most severe form and is characterized by cardiomyopathy, respiratory distress, hepatomegaly, and skeletal muscle weakness. Untreated, IOPD generally results in death within the first year of life. Enzyme replacement therapy (ERT) with recombinant human acid alpha glucosidase (rhGAA) has been shown to markedly improve the life expectancy of patients with IOPD. However, the efficacy of ERT in patients with IOPD is affected by the presence of symptoms and cross-reactive immunologic material (CRIM) status. We have treated two siblings with IOPD with ERT at different ages: the first was symptomatic and the second was asymptomatic. The female proband (Patient 1) was diagnosed with IOPD and initiated ERT at 4 months of age. Her younger sister (Patient 2) was diagnosed with IOPD at 10 days of age and initiated ERT at Day 12. Patient 1, now 6 years old, is alive but bedridden, and requires 24-hour invasive ventilation due to gradually progressive muscle weakness. In Patient 2, typical symptoms of IOPD, including cardiac failure, respiratory distress, progressive muscle weakness, hepatomegaly and myopathic facial features were largely absent during the first 12 months of ERT. Her cardiac function and mobility were well-maintained for the first 3 years, and she had normal motor development. However, she developed progressive hearing impairment and muscle weakness after 3 years of ERT. Both siblings have had low anti-rhGAA immunoglobulin G (IgG) antibody titers during ERT and have tolerated the treatment well. These results suggest that initiation of ERT during the pre-symptomatic period can prevent and/or attenuate the progression of IOPD, including cardiomyopathy, respiratory distress, and muscle weakness for first several years of ERT. However, to improve the long-term efficacy of ERT for IOPD, new strategies

  1. Quantitative Proteomic Analysis of Sulfolobus solfataricus Membrane Proteins

    NARCIS (Netherlands)

    Pham, T.K.; Sierocinski, P.; Oost, van der J.; Wright, P.C.

    2010-01-01

    A quantitative proteomic analysis of the membrane of the archaeon Sulfolobus solfataricus P2 using iTRAQ was successfully demonstrated in this technical note. The estimated number of membrane proteins of this organism is 883 (predicted based on Gravy score), corresponding to 30 % of the total

  2. Conditions for gene disruption by homologous recombination of exogenous DNA into the Sulfolobus solfataricus genome

    Directory of Open Access Journals (Sweden)

    Sonja-Verena Albers

    2008-01-01

    Full Text Available The construction of directed gene deletion mutants is an essential tool in molecular biology that allows functional studies on the role of genes in their natural environment. For hyperthermophilic archaea, it has been difficult to obtain a reliable system to construct such mutants. However, during the past years, systems have been developed for Thermococcus kodakarensis and two Sulfolobus species, S. acidocaldarius and derivatives of S. solfataricus 98/2. Here we describe an optimization of the method for integration of exogenous DNA into S. solfataricus PBL 2025, an S. solfataricus 98/2 derivative, based on lactose auxotrophy that now allows for routine gene inactivation.

  3. Conditions for gene disruption by homologous recombination of exogenous DNA into the Sulfolobus solfataricus genome.

    Science.gov (United States)

    Albers, Sonja-Verena; Driessen, Arnold J M

    2008-12-01

    The construction of directed gene deletion mutants is an essential tool in molecular biology that allows functional studies on the role of genes in their natural environment. For hyperthermophilic archaea, it has been difficult to obtain a reliable system to construct such mutants. However, during the past years, systems have been developed for Thermococcus kodakarensis and two Sulfolobus species, S. acidocaldarius and derivatives of S. solfataricus 98/2. Here we describe an optimization of the method for integration of exogenous DNA into S. solfataricus PBL 2025, an S. solfataricus 98/2 derivative, based on lactose auxotrophy that now allows for routine gene inactivation.

  4. Structure of the heterotrimeric PCNA from Sulfolobus solfataricus

    International Nuclear Information System (INIS)

    Williams, Gareth J.; Johnson, Kenneth; Rudolf, Jana; McMahon, Stephen A.; Carter, Lester; Oke, Muse; Liu, Huanting; Taylor, Garry L.; White, Malcolm F.; Naismith, James H.

    2006-01-01

    The structure of the heterotrimeric PCNA complex from S. sulfataricus is reported to 2.3 Å. PCNA is a ring-shaped protein that encircles DNA, providing a platform for the association of a wide variety of DNA-processing enzymes that utilize the PCNA sliding clamp to maintain proximity to their DNA substrates. PCNA is a homotrimer in eukaryotes, but a heterotrimer in crenarchaea such as Sulfolobus solfataricus. The three proteins are SsoPCNA1 (249 residues), SsoPCNA2 (245 residues) and SsoPCNA3 (259 residues). The heterotrimeric protein crystallizes in space group P2 1 , with unit-cell parameters a = 44.8, b = 78.8, c = 125.6 Å, β = 100.5°. The crystal structure of this heterotrimeric PCNA molecule has been solved using molecular replacement. The resulting structure to 2.3 Å sheds light on the differential stabilities of the interactions observed between the three subunits and the specificity of individual subunits for partner proteins.

  5. Crystallization and preliminary X-ray diffraction analysis of PAT, an acetyltransferase from Sulfolobus solfataricus

    International Nuclear Information System (INIS)

    Cho, Ching-Chang; Luo, Ching-Wei; Hsu, Chun-Hua

    2008-01-01

    PAT, an acetyltransferase from the archaeon S. solfataricus that specifically acetylates the chromatin protein Alba, was expressed, purified and crystallized. PAT is an acetyltransferase from the archaeon Sulfolobus solfataricus that specifically acetylates the chromatin protein Alba. The enzyme was expressed, purified and subsequently crystallized using the sitting-drop vapour-diffusion technique. Native diffraction data were collected to 1.70 Å resolution on the BL13C1 beamline of NSRRC from a flash-frozen crystal at 100 K. The crystals belonged to space group P2 1 2 1 2 1 , with unit-cell parameters a = 44.30, b = 46.59, c = 68.39 Å

  6. Structure of dimeric, recombinant Sulfolobus solfataricus phosphoribosyl diphosphate synthase

    DEFF Research Database (Denmark)

    Andersen, Rune W.; Lo Leggio, Leila; Hove-Jensen, Bjarne

    2015-01-01

    The enzyme 5-phosphoribosyl-1-α-diphosphate (PRPP) synthase (EC 2.7.6.1) catalyses the Mg2+-dependent transfer of a diphosphoryl group from ATP to the C1 hydroxyl group of ribose 5-phosphate resulting in the production of PRPP and AMP. A nucleotide sequence specifying Sulfolobus solfataricus PRPP...

  7. Identification and characterisation of a novel acylpeptide hydrolase from Sulfolobus solfataricus: structural and functional insights.

    Directory of Open Access Journals (Sweden)

    Marta Gogliettino

    Full Text Available A novel acylpeptide hydrolase, named APEH-3(Ss, was isolated from the hypertermophilic archaeon Sulfolobus solfataricus. APEH is a member of the prolyl oligopeptidase family which catalyzes the removal of acetylated amino acid residues from the N terminus of oligopeptides. The purified enzyme shows a homotrimeric structure, unique among the associate partners of the APEH cluster and, in contrast to the archaeal APEHs which show both exo/endo peptidase activities, it appears to be a "true" aminopeptidase as exemplified by its mammalian counterparts, with which it shares a similar substrate specificity. Furthermore, a comparative study on the regulation of apeh gene expression, revealed a significant but divergent alteration in the expression pattern of apeh-3(Ss and apeh(Ss (the gene encoding the previously identified APEH(Ss from S. solfataricus, which is induced in response to various stressful growth conditions. Hence, both APEH enzymes can be defined as stress-regulated proteins which play a complementary role in enabling the survival of S. solfataricus cells under different conditions. These results provide new structural and functional insights into S. solfataricus APEH, offering a possible explanation for the multiplicity of this enzyme in Archaea.

  8. Saccharolobus caldissimus gen. nov., sp. nov., a facultatively anaerobic iron-reducing hyperthermophilic archaeon isolated from an acidic terrestrial hot spring, and reclassification of Sulfolobus solfataricus as Saccharolobus solfataricus comb. nov. and Sulfolobus shibatae as Saccharolobus shibatae comb. nov.

    Science.gov (United States)

    Sakai, Hiroyuki D; Kurosawa, Norio

    2018-04-01

    A novel hyperthermophilic archaeon of strain HS-3 T , belonging to the family Sulfolobaceae, was isolated from an acidic terrestrial hot spring in Hakone Ohwaku-dani, Japan. Based on 16S rRNA gene sequence analysis, the closest phylogenetic relatives of strain HS-3 T were, first, Sulfolobus solfataricus (96.4 %) and, second, Sulfolobus shibatae (96.2 %), indicating that the strain belongs to the genus Sulfolobus. However, the sequence similarity to the type species of the genus Sulfolobus (Sulfolobus acidocaldarius) was remarkably low (91.8 %). In order to determine whether strain HS-3 T belongs to the genus Sulfolobus, its morphological, biochemical and physiological characteristics were examined in parallel with those of S. solfataricus and S. shibatae. Although there were some differences in chemolithotrophic growth between strain HS-3 T , S. solfataricus and S. shibatae, their temperature, pH and facultatively anaerobic characteristics of growth, and their utilization of various sugars were almost identical. In contrast, the utilization of various sugars by S. acidocaldarius was quite different from that of HS-3 T , S. solfataricus and S. shibatae. Phylogenetic evidence based on the 16S and the 23S rRNA gene sequences also clearly distinguished the monophyletic clade composed of strain HS-3 T , S. solfataricus, and S. shibatae from S. acidocaldarius. Based on these results, we propose a new genus and species, Saccharolobus caldissimus gen. nov., sp. nov., for strain HS-3 T , as well as two reclassifications, Saccharolobus solfataricus comb. nov. and Saccharolobus shibatae comb. nov. The type strain of Saccharolobus caldissimus is HS-3 T (=JCM 32116 T and InaCC Ar80 T ). The type species of the genus is Saccharolobus solfataricus.

  9. Two DNA polymerase sliding clamps from the thermophilic archaeon Sulfolobus solfataricus.

    Science.gov (United States)

    De Felice, M; Sensen, C W; Charlebois, R L; Rossi, M; Pisani, F M

    1999-08-06

    Herein, we report the identification and characterization of two DNA polymerase processivity factors from the thermoacidophilic archaeon Sulfolobus solfataricus. They, referred to as 039p (244 amino acid residues, 27 kDa) and 048p (249 amino acid residues, 27 kDa), present significant primary structure similarity to eukaryotic proliferating cell nuclear antigen (PCNA). We demonstrate that both 039p and 048p form oligomers in solution and are able to substantially activate the synthetic activity of the single-subunit family B DNA polymerase from S. solfataricus (Sso DNA pol B1) on poly(dA)-oligo(dT) as a primer-template. This stimulatory effect is the result of enhanced DNA polymerase processivity, as indicated by the analysis of the elongation products on polyacrylamide gels. Activation of Sso DNA pol B1 synthetic activity was also observed on linear primed single-stranded M13 mp18 DNA as a template. By immunoblot analysis using specific rabbit antisera, 039p and 048p were both detected in the logarithmic and stationary phases of S. solfataricus growth curve. This is the first report of the identification and biochemical characterization of two distinct DNA polymerase processivity factors from the same organism. The significance of these findings for the understanding of the DNA replication process in Archaea is discussed. Copyright 1999 Academic Press.

  10. Structure of the dimeric form of CTP synthase from Sulfolobus solfataricus

    DEFF Research Database (Denmark)

    Lauritsen, Iben; Willemoës, Martin; Jensen, Kaj Frank

    2011-01-01

    CTP synthase catalyzes the last committed step in de novo pyrimidine-nucleotide biosynthesis. Active CTP synthase is a tetrameric enzyme composed of a dimer of dimers. The tetramer is favoured in the presence of the substrate nucleotides ATP and UTP; when saturated with nucleotide, the tetramer...... completely dominates the oligomeric state of the enzyme. Furthermore, phosphorylation has been shown to regulate the oligomeric states of the enzymes from yeast and human. The crystal structure of a dimeric form of CTP synthase from Sulfolobus solfataricus has been determined at 2.5 Å resolution...

  11. Allosteric regulation and communication between subunits in uracil phosphoribosyltransferase from Sulfolobus solfataricus

    DEFF Research Database (Denmark)

    Arent, Susan; Harris, Pernille; Jensen, Kaj Frank

    2005-01-01

    organisms. To understand the allosteric regulation, crystal structures were determined for S. solfataricus UPRTase in complex with UMP and with UMP and the allosteric inhibitor CTP. Also, a structure with UMP bound in half of the active sites was determined. All three complexes form tetramers but reveal...... to rearrangements in the quaternary structure imply that this residue plays a major role in regulation of the enzyme and in communication between subunits. The ribose ring of UMP adopts alternative conformations in the cis and trans subunits of the UPRTase-UMP tetramer with associated differences...

  12. The Dichotomy of the Poly(ADP-Ribose Polymerase-Like Thermozyme from Sulfolobus solfataricus

    Directory of Open Access Journals (Sweden)

    Maria Rosaria Faraone Mennella

    2018-01-01

    Full Text Available The first evidence of an ADP-ribosylating activity in Archaea was obtained in Sulfolobus solfataricus(strain MT-4 where a poly(ADP-ribose polymerase (PARP-like thermoprotein, defined with the acronymous PARPSso, was found. Similarly to the eukaryotic counterparts PARPSso cleaves beta-nicotinamide adenine dinucleotide to synthesize oligomers of ADP-ribose; cross-reacts with polyclonal anti-PARP-1 catalytic site antibodies; binds DNA. The main differences rely on the molecular mass (46.5 kDa and the thermophily of PARPSso which works at 80 °C. Despite the biochemical properties that allow correlating it to PARP enzymes, the N-terminal and partial amino acid sequences available suggest that PARPSso belongs to a different group of enzymes, the DING proteins, an item discussed in detail in this review.This finding makes PARPSso the first example of a DING protein in Archaea and extends the existence of DING proteins into all the biological kingdoms. PARPSsohas a cell peripheral localization, along with the edge of the cell membrane. The ADP-ribosylation reaction is reverted by a poly(ADP-ribose glycohydrolase-like activity, able to use the eukaryotic poly(ADP-ribose as a substrate too. Here we overview the research of (ADP-ribosylation in Sulfolobus solfataricus in the past thirty years and discuss the features of PARPSso common with the canonical poly(ADP-ribose polymerases, and the structure fitting with that of DING proteins.

  13. Purification, crystallization and preliminary crystallographic analysis of GTP-binding protein from the hyperthermophilic archaeon Sulfolobus solfataricus

    NARCIS (Netherlands)

    Wu Hao,; Sun, L.; Brouns, S.J.J.; Fu, S.; Akerboom, A.P.; Li, X.; Oost, van der J.

    2007-01-01

    A predicted GTP-binding protein from the hyperthermophilic archaeon Sulfolobus solfataricus, termed SsGBP, has been cloned and overexpressed in Escherichia coli. The purified protein was crystallized using the hanging-drop vapour-diffusion technique in the presence of 0.05 M cadmium sulfate and 0.8

  14. Determination of hydride transfer stereospecificity of NADH-dependent alcohol-aldehyde/ketone oxidoreductase from Sulfolobus solfataricus.

    Science.gov (United States)

    Trincone, A; Lama, L; Rella, R; D'Auria, S; Raia, C A; Nicolaus, B

    1990-10-18

    This paper describes the determination of stereospecificity of hydride transfer reaction of an alcohol dehydrogenase isolated from the archaebacterium Sulfolobus solfataricus. The 1H-NMR and EI-MS data indicate that the enzyme transfers the pro-R hydrogen from coenzyme to substrate and is therefore an A-specific dehydrogenase.

  15. Mutations and Rearrangements in the Genome of Sulfolobus solfataricus P2

    DEFF Research Database (Denmark)

    Redder, P.; Garrett, R. A.

    2006-01-01

    The genome of Sulfolobus solfataricus P2 carries a larger number of transposable elements than any other sequenced genome from an archaeon or bacterium and, as a consequence, may be particularly susceptible to rearrangement and change. In order to gain more insight into the natures and frequencies...... of different types of mutation and possible rearrangements that can occur in the genome, the pyrEF locus was examined for mutations that were isolated after selection with 5-fluoroorotic acid. About two-thirds of the 130 mutations resulted from insertions of mobile elements, including insertion sequence (IS...... deletions, insertions, and a duplication, were observed, and about one-fifth of the mutations occurred elsewhere in the genome, possibly in an orotate transporter gene. One mutant exhibited a 5-kb genomic rearrangement at the pyrEF locus involving a two-step IS element-dependent reaction, and its boundaries...

  16. Crystallization and preliminary X-ray characterization of a PaaX-like protein from Sulfolobus solfataricus P2

    International Nuclear Information System (INIS)

    Cao, Yi; Lou, Zhiyong; Sun, Yuna; Xue, Fei; Feng, Changzeng; Gong, Xiaocui; Yang, Dongmei; Bartlam, Mark; Meng, Zhaohui; Zhang, Keqin

    2009-01-01

    In this study, the PaaX-like protein from the hyperthermophilic archaeon Sulfolobus solfataricus P2 was successfully crystallized by the hanging-drop vapour-diffusion method using ammonium sulfate as a precipitant. PaaX is a global regulator of the phenylacetyl-coenzyme A catabolon that adjusts the expression of different operons to that of the paa-encoded central pathway. In this study, the PaaX-like protein from the hyperthermophilic archaeon Sulfolobus solfataricus P2 was successfully crystallized by the hanging-drop vapour-diffusion method using ammonium sulfate as a precipitant. Diffraction data were obtained to a resolution of 3.0 Å using synchrotron radiation at the Photon Factory. The crystal belonged to space group P321, with unit-cell parameters a = 86.4, b = 86.4, c = 105.5 Å

  17. Biochemical, transcriptional and translational evidences of the phenol-meta-degradation pathway by the hyperthermophilic Sulfolobus solfataricus 98/2.

    Directory of Open Access Journals (Sweden)

    Alexia Comte

    Full Text Available Phenol is a widespread pollutant and a model molecule to study the biodegradation of monoaromatic compounds. After a first oxidation step leading to catechol in mesophilic and thermophilic microorganisms, two main routes have been identified depending on the cleavage of the aromatic ring: ortho involving a catechol 1,2 dioxygenase (C12D and meta involving a catechol 2,3 dioxygenase (C23D. Our work aimed at elucidating the phenol-degradation pathway in the hyperthermophilic archaea Sulfolobus solfataricus 98/2. For this purpose, the strain was cultivated in a fermentor under different substrate and oxygenation conditions. Indeed, reducing dissolved-oxygen concentration allowed slowing down phenol catabolism (specific growth and phenol-consumption rates dropped 55% and 39%, respectively and thus, evidencing intermediate accumulations in the broth. HPLC/Diode Array Detector and LC-MS analyses on culture samples at low dissolved-oxygen concentration (DOC  =  0.06 mg x L(-1 suggested, apart for catechol, the presence of 2-hydroxymuconic acid, 4-oxalocrotonate and 4-hydroxy-2-oxovalerate, three intermediates of the meta route. RT-PCR analysis on oxygenase-coding genes of S. solfataricus 98/2 showed that the gene coding for the C23D was expressed only on phenol. In 2D-DIGE/MALDI-TOF analysis, the C23D was found and identified only on phenol. This set of results allowed us concluding that S. solfataricus 98/2 degrade phenol through the meta route.

  18. Role of tryptophan 95 in substrate specificity and structural stability of Sulfolobus solfataricus alcohol dehydrogenase.

    Science.gov (United States)

    Pennacchio, Angela; Esposito, Luciana; Zagari, Adriana; Rossi, Mosè; Raia, Carlo A

    2009-09-01

    A mutant of the thermostable NAD(+)-dependent (S)-stereospecific alcohol dehydrogenase from Sulfolobus solfataricus (SsADH) which has a single substitution, Trp95Leu, located at the substrate binding pocket, was fully characterized to ascertain the role of Trp95 in discriminating between chiral secondary alcohols suggested by the wild-type SsADH crystallographic structure. The Trp95Leu mutant displays no apparent activity with short-chain primary and secondary alcohols and poor activity with aromatic substrates and coenzyme. Moreover, the Trp --> Leu substitution affects the structural stability of the archaeal ADH, decreasing its thermal stability without relevant changes in secondary structure. The double mutant Trp95Leu/Asn249Tyr was also purified to assist in crystallographic analysis. This mutant exhibits higher activity but decreased affinity toward aliphatic alcohols, aldehydes as well as NAD(+) and NADH compared to the wild-type enzyme. The crystal structure of the Trp95Leu/Asn249Tyr mutant apo form, determined at 2.0 A resolution, reveals a large local rearrangement of the substrate site with dramatic consequences. The Leu95 side-chain conformation points away from the catalytic metal center and the widening of the substrate site is partially counteracted by a concomitant change of Trp117 side chain conformation. Structural changes at the active site are consistent with the reduced activity on substrates and decreased coenzyme binding.

  19. The Sso7d protein of Sulfolobus solfataricus: in vitro relationship among different activities

    Directory of Open Access Journals (Sweden)

    Annamaria Guagliardi

    2002-01-01

    Full Text Available The physiological role of the nonspecific DNA-binding protein Sso7d from the crenarchaeon Sulfolobus solfataricus is unknown. In vitro studies have shown that Sso7d promotes annealing of complementary DNA strands (Guagliardi et al. 1997, induces negative supercoiling (Lopez-Garcia et al. 1998, and chaperones the disassembly and renaturation of protein aggregates in an ATP hydrolysis-dependent manner (Guagliardi et al. 2000. In this study, we examined the relationships among the binding of Sso7d to double-stranded DNA, its interaction with protein aggregates, and its ATPase activity. Experiments with 1-anilinonaphthalene-8-sulfonic acid as probe demonstrated that exposed hydrophobic surfaces in Sso7d are responsible for interactions with protein aggregates and double-stranded DNA, whereas the site of ATPase activity has a non-hydrophobic character. The interactions of Sso7d with double-stranded DNA and with protein aggregates are mutually exclusive events, suggesting that the disassembly activity and the DNA-related activities of Sso7d may be competitive in vivo. In contrast, the hydrolysis of ATP by Sso7d is independent of the binding of Sso7d to double-stranded DNA or protein aggregates.

  20. Identification of novel non-coding RNAs as potential antisense regulators in the archaeon Sulfolobus solfataricus

    DEFF Research Database (Denmark)

    tang, T. H.; Polacek, N.; Zywicki, M.

    2005-01-01

    By generating a specialized cDNA library from the archaeon Sulfolobus solfataricus, we have identified 57 novel small non-coding RNA (ncRNA) candidates and confirmed their expression by Northern blot analysis. The majority was found to belong to one of two classes, either antisense or antisense...... elements by inhibiting expression of the transposase mRNA. Surprisingly, the class of antisense RNAs also contained RNAs complementary to tRNAs or sRNAs (small-nucleolar-like RNAs). For the antisense-box ncRNAs, the majority could be assigned to the class of C/D sRNAs, which specify 2'-O-methylation sites...... on rRNAs or tRNAs. Five C/D sRNAs of this group are predicted to target methylation at six sites in 13 different tRNAs, thus pointing to the widespread role of these sRNA species in tRNA modification in Archaea. Another group of antisense-box RNAs, lacking typical C/D sRNA motifs, was predicted...

  1. Alpha-Glucosidase Inhibitory and Antioxidant Activity of Solvent ...

    African Journals Online (AJOL)

    regression analysis. Phytochemical contents and correlation with bioactivities. Total phenolic (TP), total proanthocyanidin. (TPro), and total hydroxycinnamic acid ..... An advantage of competitive inhibitors is that their inhibitory action is reversible, thus allowing undesirable effects to be readily mitigated by decreasing the ...

  2. Mutational analysis of divalent metal ion binding in the active site of class II α-mannosidase from sulfolobus solfataricus

    DEFF Research Database (Denmark)

    Hansen, Dennis K.; Webb, Helen; Nielsen, Jonas Willum

    2015-01-01

    Mutational analysis of Sulfolobus solfataricus class II α-mannosidase was focused on side chains that interact with the hydroxyls of the-1 mannosyl of the substrate (Asp-534) or form ligands to the active site divalent metal ion (His-228 and His-533) judged from crystal structures of homologous e......, although less dramatically with some activating metal ions. No major differences in the pH dependence between wild-type and mutant enzymes were found in the presence of different metal ions. The pH optimum was 5, but enzyme instability was observed at pH...

  3. Redox stress proteins are involved in adaptation response of the hyperthermoacidophilic archaeon Sulfolobus solfataricus to nickel challenge

    Directory of Open Access Journals (Sweden)

    Scaloni Andrea

    2007-08-01

    Full Text Available Abstract Background Exposure to nickel (Ni and its chemical derivatives has been associated with severe health effects in human. On the contrary, poor knowledge has been acquired on target physiological processes or molecular mechanisms of this metal in model organisms, including Bacteria and Archaea. In this study, we describe an analysis focused at identifying proteins involved in the recovery of the archaeon Sulfolobus solfataricus strain MT4 from Ni-induced stress. Results To this purpose, Sulfolobus solfataricus was grown in the presence of the highest nickel sulphate concentration still allowing cells to survive; crude extracts from treated and untreated cells were compared at the proteome level by using a bi-dimensional chromatography approach. We identified several proteins specifically repressed or induced as result of Ni treatment. Observed up-regulated proteins were largely endowed with the ability to trigger recovery from oxidative and osmotic stress in other biological systems. It is noteworthy that most of the proteins induced following Ni treatment perform similar functions and a few have eukaryal homologue counterparts. Conclusion These findings suggest a series of preferential gene expression pathways activated in adaptation response to metal challenge.

  4. SulfoSYS (Sulfolobus Systems Biology): towards a silicon cell model for the central carbohydrate metabolism of the archaeon Sulfolobus solfataricus under temperature variation

    NARCIS (Netherlands)

    Albers, S.V.; Birkeland, N.K.; Driessen, A.J.M.; Gertig, S.; Haferkamp, P.; Klenk, H.P.; Kouril, T.; Manica, A.; Pham, T.K.; Ruoff, P.; Schleper, C.; Schomburg, D.; Sharkey, K.; Siebers, B.; Sierocinski, P.; Steur, R.; Oost, van der J.; Westerhoff, H.V.; Wieloch, P.; Wright, P.C.; Zaparty, M.

    2009-01-01

    SulfoSYS (Sulfolobus Systems Biology) focuses on the study of the CCM (central carbohydrate metabolism) of Sulfolobus solfataricus and its regulation under temperature variation at the systems level. In Archaea, carbohydrates are metabolized by modifications of the classical pathways known from

  5. Sulfosys (Sulfolobus Systems Biology): towards a silicon cell model for the central carbohydrate metabolism of the archaeon Sulfolobus solfataricus under temperature variation.

    NARCIS (Netherlands)

    Albers, S.V.; Birkeland, N.K.; Driessen, A.J.; Gertig, S.; Haferkamp, P.; Klenk, H.P.; Kouril, T.; Manica, A.; Pham, T.K.; Ruoff, P.; Schleper, C.; Schomburg, D.; Sharkey, K.J.; Siebers, B.; Sierocinski, P.; Steuer, R.; van der Oost, J.; Westerhoff, H.V.; Wieloch, P.; Wright, P.C.; Zaparty, M.

    2009-01-01

    SulfoSYS (Sulfolobus Systems Biology) focuses on the study of the CCM (central carbohydrate metabolism) of Sulfolobus solfataricus and its regulation under temperature variation at the systems level. In Archaea, carbohydrates are metabolized by modifications of the classical pathways known from

  6. Gene content and organization of a 281-kbp contig from the genome of the extremely thermophilic archaeon, Sulfolobus solfataricus P2

    NARCIS (Netherlands)

    Charlebois, R.; Confalonieri, F.; Curtis, B.; Doolittle, W.F.; Duguet, M.; Erauso, G.; Faguy, D.; Gaasterland, T.; Garrett, R.A.; Gordon, P.; Kozera, C.; Medina, N.; Oost, van der J.; Peng, X.; Ragan, M.; She, Q.; Singh, R.K.

    2000-01-01

    The sequence of a 281-kbp contig from the crenarchaeote Sulfolobus solfataricus P2 was determined and analysed. Notable features in this region include 29 ribosomal protein genes, 12 tRNA genes (four of which contain archaeal-type introns), operons encoding enzymes of histidine biosynthesis,

  7. SulfoSYS (Sulfolobus Systems Biology) : towards a silicon cell model for the central carbohydrate metabolism of the archaeon Sulfolobus solfataricus under temperature variation

    NARCIS (Netherlands)

    Albers, Sonja-Verena; Birkeland, Nils-Kare; Driessen, Arnold J. M.; Gertig, Susanne; Haferkamp, Patrick; Klenk, Hans-Peter; Kouril, Theresa; Manica, Andrea; Pham, Trong K.; Ruoff, Peter; Schleper, Christa; Schomburg, Dietmar; Sharkey, Kieran J.; Siebers, Bettina; Sierocinski, Pawel; Steuer, Ralf; van der Oost, John; Westerhoff, Hans V.; Wieloch, Patricia; Wright, Phillip C.; Zaparty, Melanie; Birkeland, Nils-Kåre

    SulfoSYS (Sulfolobus Systems Biology) focuses on the study of the CCM (central carbohydrate metabolism) of Sulfolobus solfataricus and its regulation under temperature variation at the systems level. in Archaea, carbohydrates are metabolized by modifications of the classical pathways known from

  8. Identification and sequence analysis of Sulfolobus solfataricus purE and purK genes

    DEFF Research Database (Denmark)

    Sørensen, Iben Schildt; Dandanell, Gert

    1997-01-01

    From a genomic library of Sulfolobus solfataricus DSM1617 we have isolated and identified the purEK locus. Two open reading frames are identified as homologs of the purE and purK purine biosynthetic genes in Escherichia coli. The C-terminus of purE overlaps with the N-terminus of purK. When either...... of the genes is expressed from an E. coli promoter they can complement the corresponding purE and purK mutations in E. coli. PurE seems to be more closely related to eubacteria than to other archaea and to eukaryotes. Also the purK gene, which has not yet been found in other archaea, is more closely related...

  9. Allosteric regulation of the GTP activated and CTP inhibited uracil phosphoribosyltransferase from the thermophilic archaeon Sulfolobus solfataricus

    DEFF Research Database (Denmark)

    Jensen, Kaj Frank; Arent, Susan; Larsen, Sine

    2005-01-01

    The upp gene, encoding uracil phosphoribosyltransferase (UPRTase) from the thermoacidophilic archaeon Sulfolobus solfataricus, was cloned and expressed in Escherichia coli. The enzyme was purified to homogeneity. It behaved as a tetramer in solution and showed optimal activity at pH 5.5 when...... assayed at 60 °C. Enzyme activity was strongly stimulated by GTP and inhibited by CTP. GTP caused an approximately 20-fold increase in the turnover number kcat and raised the Km values for 5-phosphoribosyl-1-diphosphate (PRPP) and uracil by two- and >10-fold, respectively. The inhibition by CTP...... was complex as it depended on the presence of the reaction product UMP. Neither CTP nor UMP were strong inhibitors of the enzyme, but when present in combination their inhibition was extremely powerful. Ligand binding analyses showed that GTP and PRPP bind cooperatively to the enzyme and that the inhibitors...

  10. A New Pepstatin-Insensitive Thermopsin-Like Protease Overproduced in Peptide-Rich Cultures of Sulfolobus solfataricus

    Directory of Open Access Journals (Sweden)

    Marta Gogliettino

    2014-02-01

    Full Text Available In this study, we gain insight into the extracellular proteolytic system of Sulfolobus solfataricus grown on proteinaceous substrates, providing further evidence that acidic proteases were specifically produced in response to peptide-rich media. The main proteolytic component was the previously isolated SsMTP (Sulfolobus solfataricus multi-domain thermopsin-like protease, while the less abundant (named SsMTP-1 one was purified, characterized and identified as the sso1175 gene-product. The protein revealed a multi-domain organization shared with the cognate SsMTP with a catalytic domain followed by several tandemly-repeated motifs. Moreover, both enzymes were found spread across the Crenarchaeota phylum and belonging to the thermopsin family, although segregated into diverse phylogenetic clusters. SsMTP-1 showed a 75-kDa molecular mass and was stable in the temperature range 50–90 °C, with optimal activity at 70 °C and pH 2.0. Serine, metallo and aspartic protease inhibitors did not affect the enzyme activity, designating SsMTP-1 as a new member of the pepstatin-insensitive aspartic protease family. The peptide-bond-specificity of SsMTP-1 in the cleavage of the oxidized insulin B chain was uncommon amongst thermopsins, suggesting that it could play a distinct, but cooperative role in the protein degradation machinery. Interestingly, predictions of the transmembrane protein topology of SsMTP and SsMTP-1 strongly suggest a possible contribution in signal-transduction pathways.

  11. Specificities and pH profiles of adenine and hypoxanthine-guanine-xanthine phosphoribosyltransferases (nucleotide synthases) of the thermoacidophile archaeon Sulfolobus solfataricus

    DEFF Research Database (Denmark)

    Hansen, Michael Riis; Jensen, Kristine Steen; Rasmussen, Mads Skytte

    2014-01-01

    Two open reading frames in the genome of Sulfolobus solfataricus (SSO2341 and SSO2424) were cloned and expressed in E. coli. The protein products were purified and their enzymatic activity characterized. Although SSO2341 was annotated as a gene (gpT-1) encoding a 6-oxopurine...... phosphoribosyltransferase (PRTase), the protein product turned out to be a PRTase highly specific for adenine and we suggest that the reading frame should be renamed apT. The other reading frame SSO2424 (gpT-2) proved to be a true 6-oxopurine PRTase active with hypoxanthine, xanthine and guanine as substrates, and we.......5, while maximal activity with xanthine was observed at pH 7.5. We discuss likely reasons why SSO2341 in S. solfataricus and similar open reading frames in other Crenarchaeota could not be identified as genes encoding APRTase....

  12. Dynamic fluorescence studies of beta-glycosidase mutants from Sulfolobus solfataricus: effects of single mutations on protein thermostability.

    Science.gov (United States)

    Bismuto, Ettore; Febbraio, Ferdinando; Limongelli, Simona; Briante, Raffaella; Nucci, Roberto

    2003-04-01

    Multiple sequence alignment on 73 proteins belonging to glycosyl hydrolase family 1 reveals the occurrence of a segment (83-124) in the enzyme sequences from hyperthermophilic archaea bacteria, which is absent in all the mesophilic members of the family. The alignment of the known three-dimensional structures of hyperthermophilic glycosidases with the known ones from mesophilic organisms shows a similar spatial organizations of beta-glycosidases except for this sequence segment whose structure is located on the external surface of each of four identical subunits, where it overlaps two alpha-helices. Site-directed mutagenesis substituting N97 or S101 with a cysteine residue in the sequence of beta-glycosidase from hyperthermophilic archaeon Sulfolobus solfataricus caused some changes in the structural and dynamic properties as observed by circular dichroism in far- and near-UV light, as well as by frequency domain fluorometry, with a simultaneous loss of thermostability. The results led us to hypothesize an important role of the sequence segment present only in hyperthermophilic beta-glycosidases, in the thermal adaptation of archaea beta-glycosidases. The thermostabilization mechanism could occur as a consequence of numerous favorable ionic interactions of the 83-124 sequence with the other part of protein matrix that becomes more rigid and less accessible to the insult of thermal-activated solvent molecules. Copyright 2003 Wiley-Liss, Inc.

  13. Adenine phosphoribosyltransferase from Sulfolobus solfataricus is an enzyme with unusual kinetic properties and a crystal structure that suggests it evolved from a 6-oxopurine phosphoribosyltransferase

    DEFF Research Database (Denmark)

    Jensen, Kaj Frank; Hansen, Michael Riis; Jensen, Kristine Steen

    2015-01-01

    The adenine phosphoribosyltransferase (APRTase) encoded by the open reading frame SSO2342 of Sulfolobus solfataricus P2, was subjected to crystallographic, kinetic and ligand binding analyses. The enzyme forms dimers in solution and in the crystals, and binds one molecule of the reactants 5...

  14. Development of in vitro transposon assisted signal sequence trapping and its use in screening Bacillus halodurans C125 and Sulfolobus solfataricus P2 gene libraries

    DEFF Research Database (Denmark)

    Becker, F.; Schnorr, K.; Wilting, R.

    2004-01-01

    To identify genes encoding extracytosolic proteins, a minitransposon, TnSig, containing a signal-less beta-lactamase ('bla) as reporter gene, was constructed and used for in vitro transposition of genomic libraries made in Escherichia coli. The 'bla gene was cloned into a bacteriophage MU...... minitransposon enabling translational fusions between 'bla and target genes. Fusion of TnSig in the correct reading frame to a protein carrying transmembrane domains or signal peptides resulted in ampicillin resistance of the corresponding clone. Prokaryotic gene libraries from the alkaliphilic bacterium...... Bacillus halodurans C125 and the hyperthermophilic archaeon Sulfolobus solfataricus P2 were tagged with TnSig. The genomic sequences, which are publicly available (EMBL BA000004 and EMBL AE006641), were used for rapid open reading frame (ORF) identification and prediction of protein localisation...

  15. SMV1 virus-induced CRISPR spacer acquisition from the conjugative plasmid pMGB1 in Sulfolobus solfataricus P2

    DEFF Research Database (Denmark)

    Erdmann, Susanne; Shah, Shiraz Ali; Garrett, Roger Antony

    2013-01-01

    Organisms of the crenarchaeal order Sulfolobales carry complex CRISPR (clustered regularly interspaced short palindromic repeats) adaptive immune systems. These systems are modular and show extensive structural and functional diversity, especially in their interference complexes. The primary...... targets are an exceptional range of diverse viruses, many of which propagate stably within cells and follow lytic life cycles without producing cell lysis. These properties are consistent with the difficulty of activating CRISPR spacer uptake in the laboratory, but appear to conflict with the high...... complexity and diversity of the CRISPR immune systems that are found among the Sulfolobales. In the present article, we re-examine the first successful induction of archaeal spacer acquisition in our laboratory that occurred exclusively for the conjugative plasmid pMGB1 in Sulfolobus solfataricus P2...

  16. Role of alpha-glucosidase in the fermentable sugar composition of sorghum malt mashes

    CSIR Research Space (South Africa)

    Taylor, JRN

    1994-11-01

    Full Text Available The cause of the high glucose to maltose ratio in sorghum malt worts was studied. Mashing temperature and pH strongly affected both the amount of glucose and the proportion of glucose relative to total fermentable sugars. The relative proportion...

  17. Long-term intravenous treatment of Pompe disease with recombinant human alpha-glucosidase from milk.

    NARCIS (Netherlands)

    Hout, J.M. van den; Kamphoven, J.H.; Winkel, L.P.; Arts, W.F.M.; Klerk, J.B.C. de; Loonen, M.C.B.; Vulto, A.G.; Cromme-Dijkhuis, A.H.; Weisglas-Kuperus, N.; Hop, W.C.J.; Hirtum, H. van; Diggelen, O.P. van; Boer, M. de; Kroos, M.A.; Doorn, P.A. van; Voort, E.I. van der; Sibbles, B.; Corven, E.J. van; Brakenhoff, J.P.; Hove, J.L. van; Smeitink, J.A.M.; Jong, G. de; Reuser, A.J.J.; Ploeg, A.T. van der

    2004-01-01

    OBJECTIVE: Recent reports warn that the worldwide cell culture capacity is insufficient to fulfill the increasing demand for human protein drugs. Production in milk of transgenic animals is an attractive alternative. Kilogram quantities of product per year can be obtained at relatively low costs,

  18. Phytochemical Screening, Alpha-Glucosidase Inhibition, Antibacterial and Antioxidant Potential of Ajuga bracteosa Extracts.

    Science.gov (United States)

    Hafeez, Kokab; Andleeb, Saiqa; Ghousa, Tahseen; Mustafa, Rozina G; Naseer, Anum; Shafique, Irsa; Akhter, Kalsoom

    2017-01-01

    Ajuga bracteosa, a medicinal herb, is used by local community to cure a number of diseases such as inflammation, jaundice bronchial asthma, cancer and diabetes. The aim of present work was to evaluate the antioxidant potential, in vitro antidiabetic and antimicrobial effects of A. bracteosa. n-hexane, ethyl acetate, chloroform, acetone, methanol and aqueous extracts of Ajuga bracteosa roots, were prepared via maceration. Antibacterial activity was carried out by agar well diffusion method. Quantitative and qualitative phytochemical screening was done. The antioxidant activity was determined by iron (II) chelating activity, iron reducing power, DPPH, and ABTS free radical scavenging methods, Antidiabetic activity was evaluated through inhibition of α-glucosidase assay. Phytochemical analysis showed the presence of phenols, flavonoids, tannins, saponins, quinines, terpenoids, xanthoproteins, glycosides, carbohydrates, steroids, phytosterols and amino acids. DPPH and ABTS potential values were recorded as 61.92% to 88.84% and 0.11% to 38.82%, respectively. Total phenolic and total flavonoid contents were expressed as gallic acid and rutin equivalents. Total iron content was expressed as FeSO4 equivalents. Chloroform and n-hexane extracts showed significant enzyme inhibition potential with IC50 values of 29.92 μg/ml and 131.7 μg/ml respectively. Aqueous extract showed maximum inhibition of E. coli, S. typhimurium, E. amnigenus, S. pyogenes, and S. aureus, (18.0±1.0 mm, 12.5±0.7 mm, 17.0±0.0 mm, 11.0±0.0 mm and 15.3±2.0 mm mm), respectively. Similarly, n-hexane extract showed maximum inhibition of E. coli, E. amnigenus, S. aureus (11.6±1.5 mm; 11.3±1.5 mm; 13.3±0.5 mm). This study also shows that n-hexane, chloroform, ethyl acetate and aqueous extracts of A. bracteosa root possess α-glucosidase inhibitory activities and therefore it may be used as hypoglycemic agents in the management of postprandial hyperglycemia. Ajuga bracteosa root extracts may provide a basis for development of antioxidant, antimicrobial and antidiabetic drugs. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  19. Long-term intravenous treatment of Pompe disease with recombinant human alpha-glucosidase from milk

    NARCIS (Netherlands)

    J.M.P. van den Hout (Johanna); B. Sibbles (Barbara); J.P. Brakenhoff (Just); A.H. Cromme-Dijkhuis (Adri); N. Weisglas-Kuperus (Nynke); A.J.J. Reuser (Arnold); M.A. Boer (Marijke); J.A.M. Smeitink (Jan); O.P. van Diggelen (Otto); E. van der Voort (Edwin); E.J.J.M. van Corven (Emiel); H. van Hirtum (Hans); J.H.J. Kamphoven (Joep); A.T. van der Ploeg (Ans); J. van Hove (Johan); W.F.M. Arts (Willem Frans); P.A. van Doorn (Pieter); J.B.C. de Klerk (Johannes); M.C.B. Loonen (Christa); A.G. Vulto (Arnold); M.A. Kroos (Marian); W.C.J. Hop (Wim); L.P.F. Winkel (Léon); G. de Jong (Gerard)

    2004-01-01

    textabstractOBJECTIVE: Recent reports warn that the worldwide cell culture capacity is insufficient to fulfill the increasing demand for human protein drugs. Production in milk of transgenic animals is an attractive alternative. Kilogram quantities of product per year can be

  20. Alpha-glucosidase inhibitory effect and inorganic constituents of Phyllanthus amarus Schum. & Thonn. ash

    Directory of Open Access Journals (Sweden)

    Malinee Wongnawa

    2014-10-01

    Full Text Available This study investigated the -glucosidase inhibitory effect and determined the concentration of some inorganic constituents in P. amarus ash. Oral glucose and sucrose tolerance test were performed on normal mice. In vitro -glucosidase inhibitory activity was evaluated by using yeast a-glucosidase. The element concentrations were measured by inductively coupled plasma (ICP spectroscopy. Single oral administration of P. amarus ash did not show antihyperglycemic effect after glucose administration, but decreased blood glucose level after sucrose administration. The ash showed -glucosidase inhibitory activity in vitro with IC50 of 982 mg/mL. The concentrations of K, Ca, Mg, Mn, Fe, Zn, Cu, Pb, Cr, Ni and Co in P. amarus ash were 35049.80±340.64, 3337.24±52.10, 1368.52±13.29, 90.81±1.34, 87.68±1.15, 18.28±0.22, 4.69±0.07, 1.07±0.15, 0.29±0.03, 0.20±0.04 and 0.10±0.02 mg/g, respectively. These results indicate that the antihyperglycemic effect of P. amarus ash might be partly due to the -glucosidase inhibitory activity of the inorganic constituents.

  1. Competitive inhibitor of cellular alpha-glucosidases protects mice from lethal dengue virus infection

    OpenAIRE

    Chang, Jinhong; Schul, Wouter; Yip, Andy; Xu, Xiaodong; Guo, Ju-Tao; Block, Timothy M.

    2011-01-01

    Dengue virus infection causes diseases in people, ranging from the acute febrile illness Dengue fever, to life-threatening Dengue Hemorrhagic Fever/Dengue Shock Syndrome. We previously reported that a host cellular α-glucosidases I and II inhibitor, imino sugar CM-10-18, potently inhibited dengue virus replication in cultured cells, and significantly reduced viremia in dengue virus infected AG129 mice. In this report we show that CM-10-18 also significantly protects mice from death and/or dis...

  2. Impaired performance of skeletal muscle in alpha-glucosidase knockout mice

    NARCIS (Netherlands)

    Hesselink, R.P; Gorselink, M.; Schaart, G.; Wagenmakers, A.J.M.; Kamphoven, G.; Reuser, A.J.J.; Vusse, van der G.J.; Drost, M.R.

    2002-01-01

    Glycogen storage disease type II (GSD II) is an inherited progressive muscle disease in which lack of functional acid -glucosidase (AGLU) results in lysosomal accumulation of glycogen. We report on the impact of a null mutation of the acid -glucosidase gene (AGLU-/-) in mice on the force production

  3. Alpha-Glucosidase Enzyme Biosensor for the Electrochemical Measurement of Antidiabetic Potential of Medicinal Plants.

    Science.gov (United States)

    Mohiuddin, M; Arbain, D; Islam, A K M Shafiqul; Ahmad, M S; Ahmad, M N

    2016-12-01

    A biosensor for measuring the antidiabetic potential of medicinal plants was developed by covalent immobilization of α-glucosidase (AG) enzyme onto amine-functionalized multi-walled carbon nanotubes (MWCNTs-NH2). The immobilized enzyme was entrapped in freeze-thawed polyvinyl alcohol (PVA) together with p-nitrophenyl-α-D-glucopyranoside (PNPG) on the screen-printed carbon electrode at low pH to prevent the premature reaction between PNPG and AG enzyme. The enzymatic reaction within the biosensor is inhibited by bioactive compounds in the medicinal plant extracts. The capability of medicinal plants to inhibit the AG enzyme on the electrode correlates to the potential of the medicinal plants to inhibit the production of glucose from the carbohydrate in the human body. Thus, the inhibition indicates the antidiabetic potential of the medicinal plants. The performance of the biosensor was evaluated to measure the antidiabetic potential of three medicinal plants such as Tebengau (Ehretis laevis), Cemumar (Micromelum pubescens), and Kedondong (Spondias dulcis) and acarbose (commercial antidiabetic drug) via cyclic voltammetry, amperometry, and spectrophotometry. The cyclic voltammetry (CV) response for the inhibition of the AG enzyme activity by Tebengau plant extracts showed a linear relation in the range from 0.423-8.29 μA, and the inhibition detection limit was 0.253 μA. The biosensor exhibited good sensitivity (0.422 μA/mg Tebengau plant extracts) and rapid response (22 s). The biosensor retains approximately 82.16 % of its initial activity even after 30 days of storage at 4 °C.

  4. Adenine phosphoribosyltransferase from Sulfolobus solfataricus is an enzyme with unusual kinetic properties and a crystal structure that suggests it evolved from a 6-oxopurine phosphoribosyltransferase.

    Science.gov (United States)

    Jensen, Kaj Frank; Hansen, Michael Riis; Jensen, Kristine Steen; Christoffersen, Stig; Poulsen, Jens-Christian Navarro; Mølgaard, Anne; Kadziola, Anders

    2015-04-14

    The adenine phosphoribosyltransferase (APRTase) encoded by the open reading frame SSO2342 of Sulfolobus solfataricus P2 was subjected to crystallographic, kinetic, and ligand binding analyses. The enzyme forms dimers in solution and in the crystals, and binds one molecule of the reactants 5-phosphoribosyl-α-1-pyrophosphate (PRPP) and adenine or the product adenosine monophosphate (AMP) or the inhibitor adenosine diphosphate (ADP) in each active site. The individual subunit adopts an overall structure that resembles a 6-oxopurine phosphoribosyltransferase (PRTase) more than known APRTases implying that APRT functionality in Crenarchaeotae has its evolutionary origin in this family of PRTases. Only the N-terminal two-thirds of the polypeptide chain folds as a traditional type I PRTase with a five-stranded β-sheet surrounded by helices. The C-terminal third adopts an unusual three-helix bundle structure that together with the nucleobase-binding loop undergoes a conformational change upon binding of adenine and phosphate resulting in a slight contraction of the active site. The inhibitor ADP binds like the product AMP with both the α- and β-phosphates occupying the 5'-phosphoribosyl binding site. The enzyme shows activity over a wide pH range, and the kinetic and ligand binding properties depend on both pH and the presence/absence of phosphate in the buffers. A slow hydrolysis of PRPP to ribose 5-phosphate and pyrophosphate, catalyzed by the enzyme, may be facilitated by elements in the C-terminal three-helix bundle part of the protein.

  5. Compound K Production from Red Ginseng Extract by β-Glycosidase from Sulfolobus solfataricus Supplemented with α-L-Arabinofuranosidase from Caldicellulosiruptor saccharolyticus.

    Directory of Open Access Journals (Sweden)

    Kyung-Chul Shin

    Full Text Available Ginsenoside compound K (C-K is attracting a lot of interest because of its biological and pharmaceutical activities, including hepatoprotective, antitumor, anti-wrinkling, and anti-skin aging activities. C-K has been used as the principal ingredient in skin care products. For the effective application of ginseng extracts to the manufacture of cosmetics, the PPD-type ginsenosides in ginseng extracts should be converted to C-K by enzymatic conversion. For increased yield of C-K from the protopanaxadiol (PPD-type ginsenosides in red-ginseng extract (RGE, the α-L-arabinofuranoside-hydrolyzing α-L-arabinofuranosidase from Caldicellulosiruptor saccharolyticus (CS-abf was used along with the β-D-glucopyranoside/α-L-arabinopyranoside-hydrolyzing β-glycosidase from Sulfolobus solfataricus (SS-bgly because SS-bgly showed very low hydrolytic activity on the α-L-arabinofuranoside linkage in ginsenosides. The optimal reaction conditions for C-K production were as follows: pH 6.0, 80°C, 2 U/mL SS-bgly, 3 U/mL CS-abf, and 7.5 g/L PPD-type ginsenosides in RGE. Under these optimized conditions, SS-bgly supplemented with CS-abf produced 4.2 g/L C-K from 7.5 g/L PPD-type ginsenosides in 12 h without other ginsenosides, with a molar yield of 100% and a productivity of 348 mg/L/h. To the best of our knowledge, this is the highest concentration and productivity of C-K from ginseng extract ever published in literature.

  6. Extensive Lysine Methylation in Hyperthermophilic Crenarchaea: Potential Implications for Protein Stability and Recombinant Enzymes

    Directory of Open Access Journals (Sweden)

    Catherine H. Botting

    2010-01-01

    Full Text Available In eukarya and bacteria, lysine methylation is relatively rare and is catalysed by sequence-specific lysine methyltransferases that typically have only a single-protein target. Using RNA polymerase purified from the thermophilic crenarchaeum Sulfolobus solfataricus, we identified 21 methyllysines distributed across 9 subunits of the enzyme. The modified lysines were predominantly in α-helices and showed no conserved sequence context. A limited survey of the Thermoproteus tenax proteome revealed widespread modification with 52 methyllysines in 30 different proteins. These observations suggest the presence of an unusual lysine methyltransferase with relaxed specificity in the crenarchaea. Since lysine methylation is known to enhance protein thermostability, this may be an adaptation to a thermophilic lifestyle. The implications of this modification for studies and applications of recombinant crenarchaeal enzymes are discussed.

  7. Antioxidant rich grape pomace extract suppresses postprandial hyperglycemia in diabetic mice by specifically inhibiting alpha-glucosidase

    Directory of Open Access Journals (Sweden)

    Hogan Shelly

    2010-08-01

    Full Text Available Abstract Background Postprandial hyperglycemia is an early defect of type 2 diabetes and one of primary anti-diabetic targets. Treatment of postprandial hyperglycemia can be achieved by inhibiting intestinal α-glucosidase, the key enzyme for oligosaccharide digestion and further glucose absorption. Grape pomace is winemaking byproduct rich in bioactive food compounds such as phenolic antioxidants. This study evaluated the anti-diabetic potential of two specific grape pomace extracts by determining their antioxidant and anti-postprandial hyperglycemic activities in vitro and in vivo. Methods The extracts of red wine grape pomace (Cabernet Franc and white wine grape pomace (Chardonnay were prepared in 80% ethanol. An extract of red apple pomace was included as a comparison. The radical scavenging activities and phenolic profiles of the pomace extracts were determined through the measurement of oxygen radical absorbance capacity, DPPH radical scavenging activity, total phenolic content and flavonoids. The inhibitory effects of the pomace extracts on yeast and rat intestinal α-glucosidases were determined. Male 6-week old C57BLKS/6NCr mice were treated with streptozocin to induce diabetes. The diabetic mice were then treated with vehicle or the grape pomace extract to determine whether the oral intake of the extract can suppress postprandial hyperglycemia through the inhibition of intestinal α-glucosidases. Results The red grape pomace extract contained significantly higher amounts of flavonoids and phenolic compounds and exerted stronger oxygen radical absorbance capacity than the red apple pomace extract. Both the grape pomace extracts but not the apple pomace extract exerted significant inhibition on intestinal α-glucosidases and the inhibition appears to be specific. In the animal study, the oral intake of the grape pomace extract (400 mg/kg body weight significantly suppressed the postprandial hyperglycemia by 35% in streptozocin-induced diabetic mice following starch challenge. Conclusion This is the first report that the grape pomace extracts selectively and significantly inhibits intestinal α-glucosidase and suppresses postprandial hyperglycemia in diabetic mice. The antioxidant and anti-postprandial hyperglycemic activities demonstrated on the tested grape pomace extract therefore suggest a potential for utilizing grape pomace-derived bioactive compounds in management of diabetes.

  8. Antioxidant rich grape pomace extract suppresses postprandial hyperglycemia in diabetic mice by specifically inhibiting alpha-glucosidase.

    Science.gov (United States)

    Hogan, Shelly; Zhang, Lei; Li, Jianrong; Sun, Shi; Canning, Corene; Zhou, Kequan

    2010-08-27

    Postprandial hyperglycemia is an early defect of type 2 diabetes and one of primary anti-diabetic targets. Treatment of postprandial hyperglycemia can be achieved by inhibiting intestinal α-glucosidase, the key enzyme for oligosaccharide digestion and further glucose absorption. Grape pomace is winemaking byproduct rich in bioactive food compounds such as phenolic antioxidants. This study evaluated the anti-diabetic potential of two specific grape pomace extracts by determining their antioxidant and anti-postprandial hyperglycemic activities in vitro and in vivo. The extracts of red wine grape pomace (Cabernet Franc) and white wine grape pomace (Chardonnay) were prepared in 80% ethanol. An extract of red apple pomace was included as a comparison. The radical scavenging activities and phenolic profiles of the pomace extracts were determined through the measurement of oxygen radical absorbance capacity, DPPH radical scavenging activity, total phenolic content and flavonoids. The inhibitory effects of the pomace extracts on yeast and rat intestinal α-glucosidases were determined. Male 6-week old C57BLKS/6NCr mice were treated with streptozocin to induce diabetes. The diabetic mice were then treated with vehicle or the grape pomace extract to determine whether the oral intake of the extract can suppress postprandial hyperglycemia through the inhibition of intestinal α-glucosidases. The red grape pomace extract contained significantly higher amounts of flavonoids and phenolic compounds and exerted stronger oxygen radical absorbance capacity than the red apple pomace extract. Both the grape pomace extracts but not the apple pomace extract exerted significant inhibition on intestinal α-glucosidases and the inhibition appears to be specific. In the animal study, the oral intake of the grape pomace extract (400 mg/kg body weight) significantly suppressed the postprandial hyperglycemia by 35% in streptozocin-induced diabetic mice following starch challenge. This is the first report that the grape pomace extracts selectively and significantly inhibits intestinal α-glucosidase and suppresses postprandial hyperglycemia in diabetic mice. The antioxidant and anti-postprandial hyperglycemic activities demonstrated on the tested grape pomace extract therefore suggest a potential for utilizing grape pomace-derived bioactive compounds in management of diabetes.

  9. Lactic Acid Bacteria Producing Inhibitor of Alpha Glucosidase Isolated from Ganyong (Canna Edulis) and Kimpul (Xanthosoma sagittifolium)

    Science.gov (United States)

    Nurhayati, Rifa; Miftakhussolikhah; Frediansyah, Andri; Lailatul Rachmah, Desy

    2017-12-01

    Type 2 diabetes is a disease that caused by the failure of insulin secretion by the beta cells of the pancreas and insulin resistance in peripheral levels. One therapy for diabetics is by inhibiting the activity of α-glucosidase. Lactic acid bacteria have the ability to inhibit of α-glucosidase activity. The aims of this research was to isolation and screening of lactic acid bacteria from ganyong tuber (Canna Edulis) and kimpul tuber (Xanthosoma sagittifolium), which has the ability to inhibit the activity of α-glucosidase. Eightteen isolates were identified as lactic acid bacteria and all of them could inhibit the activity of α-glukosidase. The GN 8 isolate was perform the highest inhibition acivity.

  10. Combination of alpha-glucosidase inhibitor and ribavirin for the treatment of Dengue virus infection in vitro and in vivo

    Science.gov (United States)

    Chang, Jinhong; Schul, Wouter; Butters, Terry D.; Yip, Andy; Liu, Boping; Goh, Anne; Lakshminarayana, Suresh B.; Alonzi, Dominic; Reinkensmeier, Gabriele; Pan, Xiaoben; Qu, Xiaowang; Weidner, Jessica M.; Wang, Lijuan; Yu, Wenquan; Borune, Nigel; Kinch, Mark A.; Rayahin, Jamie E.; Moriarty, Robert; Xu, Xiaodong; Shi, Pei-Yong; Guo, Ju-Tao; Block, Timothy M.

    2010-01-01

    Cellular α-glucosidases I and II are enzymes that sequentially trim the three terminal glucoses in the N-linked oligosaccharides of viral envelope glycoproteins. This process is essential for the proper folding of viral glycoproteins and subsequent assembly of many enveloped viruses, including dengue virus (DENV). Imino sugars are substrate mimics of α-glucosidases I and II. In this report, we show that two oxygenated alkyl imino sugar derivatives, CM-9-78 and CM-10-18, are potent inhibitors of both α-glucosidases I and II in vitro and in treated animals, and efficiently inhibit DENV infection of cultured human cells. Pharmacokinetic studies reveal that both compounds are well tolerated at doses up to 100mg/kg in rats and have favorable pharmacokinetic properties and bioavailability in mice. Moreover, we showed that oral administration of either CM-9-78 or CM-10-18 reduces the peak viremia of DENV in mice. Interestingly, while treatment of DENV infected mice with ribavirin alone did not reduce the viremia, combination therapy of ribavirin with sub-effective dose of CM-10-18 demonstrated a significantly enhanced antiviral activity, as indicated by a profound reduction of the viremia. Our findings thus suggest that combination therapy of two broad-spectrum antiviral agents may provide a practically useful approach for the treatment of DENV infection. PMID:21073903

  11. Alpha-glucosidase Inhibitory and Antioxidant Potential of Antidiabetic Herb Alternanthera sessilis: Comparative Analyses of Leaf and Callus Solvent Fractions.

    Science.gov (United States)

    Chai, Tsun-Thai; Khoo, Chee-Siong; Tee, Chong-Siang; Wong, Fai-Chu

    2016-01-01

    Alternanthera sessilis is a medicinal herb which is consumed as vegetable and used as traditional remedies of various ailments in Asia and Africa. This study aimed to investigate the antiglucosidase and antioxidant activity of solvent fractions of A. sessilis leaf and callus. Leaf and callus methanol extracts were fractionated to produce hexane, chloroform, ethyl acetate, butanol, and water fractions. Antiglucosidase and 1,1-diphenyl-2-picrylhydrazyl scavenging activities as well as total phenolic (TP), total flavonoid (TF), and total coumarin (TC) contents were evaluated. Lineweaver-Burk plot analysis was performed on leaf and callus fractions with the strongest antiglucosidase activity. Leaf ethyl acetate fraction (LEF) had the strongest antiglucosidase (EC 50 0.55 mg/mL) and radical scavenging (EC 50 10.81 μg/mL) activity among leaf fractions. Callus ethyl acetate fraction (CEF) and chloroform fraction had the highest antiglucosidase (EC 50 0.25 mg/mL) and radical scavenging (EC 50 34.12 μg/mL) activity, respectively, among callus fractions. LEF and CEF were identified as noncompetitive and competitive α-glucosidase inhibitors, respectively. LEF and CEF had greater antiglucosidase activity than acarbose. Leaf fractions had higher phytochemical contents than callus fractions. LEF had the highest TP, TF, and TC contents. Antiglucosidase and antioxidant activities of leaf fractions correlated with phytochemical contents. LEF had potent antiglucosidase activity and concurrent antioxidant activity. CEF had the highest antiglucosidase activity among all fractions. Callus culture is a promising tool for enhancing production of potent α-glucosidase inhibitors. Leaf ethyl acetate fraction (LEF) had the strongest antiglucosidase (EC 50 0.55 mg/mL) and radical scavenging (EC 50 10.81 μg/mL) activity among leaf fractionsCallus ethyl acetate fraction (CEF) and chloroform fraction had the highest antiglucosidase (EC 50 0.25 mg/mL) and radical scavenging (EC 50 34.12 μg/mL) activity, respectively, among callus fractionsLEF and CEF were identified as noncompetitive and competitive á-glucosidase inhibitors, respectivelyAntiglucosidase and antioxidant activities of leaf fractions correlated with phytochemical contents. Abbreviations used: LHF: Leaf hexane fraction, LCF: Leaf chloroform fraction, LEF: Leaf ethyl acetate fraction, LBF: Leaf butanol fraction, LWF: Leaf water fraction, CHF: Callus hexane fraction, CCF: Callus chloroform fraction, CEF: Callus ethyl acetate fraction, CBF: Callus butanol fraction, CWF: Callus water fraction, TP: Total phenolic, TF: Total flavonoid, TC: Total coumarin.

  12. Cuparane sesquiterpenes from Laurencia natalensis Kylin as inhibitors of alpha-glucosidase, dipeptidyl peptidase IV and xanthine oxidase

    Czech Academy of Sciences Publication Activity Database

    Rengasamy, K.R.R.; Poštová Slavětínská, Lenka; Kulkarni, M. G.; Stirk, W. A.; Van Staden, J.

    2017-01-01

    Roč. 25, Jul (2017), s. 178-183 ISSN 2211-9264 Institutional support: RVO:61388963 Keywords : 1-deoxyalgoane * dipeptidyl peptidase IV * diabetes * gout * Laurencia natalensis Subject RIV: CC - Organic Chemistry OBOR OECD: Organic chemistry Impact factor: 3.994, year: 2016

  13. Increased glucose metabolism and alpha-glucosidase inhibition in Cordyceps militaris water extract-treated HepG2 cells

    Science.gov (United States)

    Kim, Dae Jung; Kang, Yun Hwan; Kim, Kyoung Kon; Kim, Tae Woo; Park, Jae Bong

    2017-01-01

    BACKGROUND/OBJECTIVES Recent living condition improvements, changes in dietary habits, and reductions in physical activity are contributing to an increase in metabolic syndrome symptoms including diabetes and obesity. Through such societal developments, humankind is continuously exposed to metabolic diseases such as diabetes, and the number of the victims is increasing. This study investigated Cordyceps militaris water extract (CMW)-induced glucose uptake in HepG2 cells and the effect of CMW treatment on glucose metabolism. MATERIALS/METHODS Colorimetric assay kits were used to determine the glucokinase (GK) and pyruvate dehydrogenase (PDH) activities, glucose uptake, and glycogen content. Either RT-PCR or western blot analysis was performed for quantitation of glucose transporter 2 (GLUT2), hepatocyte nuclear factor 1 alpha (HNF-1α), phosphatidylinositol 3-kinase (PI3k), protein kinase B (Akt), phosphorylated AMP-activated protein kinase (pAMPK), phosphoenolpyruvate carboxykinase, GK, PDH, and glycogen synthase kinase 3 beta (GSK-3β) expression levels. The α-glucosidase inhibitory activities of acarbose and CMW were evaluated by absorbance measurement. RESULTS CMW induced glucose uptake in HepG2 cells by increasing GLUT2 through HNF-1α expression stimulation. Glucose in the cells increased the CMW-induced phosphorylation of AMPK. In turn, glycolysis was stimulated, and glyconeogenesis was inhibited. Furthermore, by studying the mechanism of action of PI3k, Akt, and GSK-3β, and measuring glycogen content, the study confirmed that the glucose was stored in the liver as glycogen. Finally, CMW resulted in a higher level of α-glucosidase inhibitory activity than that from acarbose. CONCLUSION CMW induced the uptake of glucose into HepG2 cells, as well, it induced metabolism of the absorbed glucose. It is concluded that CMW is a candidate or potential use in diabetes prevention and treatment. PMID:28584574

  14. In vitro anti-diabetic activity of flavonoids and pheophytins from Allophylus cominia Sw . on PTP1B, DPPIV, alpha-glucosidase and alpha-amylase enzymes.

    Science.gov (United States)

    Semaan, D G; Igoli, J O; Young, L; Marrero, E; Gray, A I; Rowan, E G

    2017-05-05

    Ethno-botanical information from diabetic patients in Cuba led to the identification of Allophylus cominia as a possible source of new drugs for the treatment of type 2 diabetes mellitus (T2-DM). Chemical characterization of the extracts from A. cominia was carried out using chromatographic and spectroscopic methods. The extracts were tested for their activity on PTP1B, DPPIV, α-glucosidase enzymes and α-amylase. The flavonoid rich fractions from A. cominia inhibited DPPIV enzyme (75.3±2.33%) at 30µg/ml and produced a concentration-dependent inhibition against DPPIV with a Ki value of 2.6µg/ml. At 30µg/ml, flavonoids and pheophytins extracts significantly inhibited PTP1B enzyme (100±2.6% and 68±1% respectively). The flavonoids, pheophytin A and pheophytin B fractions showed significant concentration-dependent inhibition against PTP1B with Ki values of 3µg/ml, 0.64µg/ml and 0.88µg/ml respectively. At 30µg/ml, the flavonoid fraction significantly inhibited α-glucosidase enzyme (86±0.3%) in a concentration-dependent pattern with a Ki value of 2µg/ml. None of the fractions showed significant effects on α-amylase. Fatty acids, tannins, pheophytins A and B, and a mixture of flavonoids were detected in the methanolic extract from A. cominia. The identified flavonoids were mearnsitrin, quercitrin, quercetin-3-alloside, and naringenin-7-glucoside. The pharmacological effects of the extracts from A. cominia earlier observed in experimental diabetic models was confirmed in this study. Thus a new drug or formulation for the treatment of T2-DM could be developed from A. cominia. Copyright © 2017 Elsevier Ireland Ltd. All rights reserved.

  15. Synthesis of (E)-N'-[1-(2,4-Dihydroxyphenyl)ethylidene]substituted hydrazides as possible alpha-glucosidase and butyrylcholinesterase Inhibitors

    International Nuclear Information System (INIS)

    Abbasi, M.A.; Shah, S.A.H.; Siddiqui, S.Z.; Khan, K.M.

    2017-01-01

    In the current research work, (E)-N'-[1-(2,4-dihydroxyphenyl)ethylidene]substituted hydrazides were synthesized in a couple of steps and their enzyme inhibition potential was analyzed. Firstly 2,4-hydroxyacetophenone (1) was reacted with hydrated hydrazine (2) under stirring to yield (E)-4-(1-hydrazonoethyl)benzene-1,3-diol (3) which was further reacted with different acid halides, (4a-i) to afford (E)-[1-(2,4-dihydroxyphenyl)ethylidene]substituted hydrazides (5a-i). These synthesized compounds were characterized by EI-MS, 1H-NMR spectral techniques and were also evaluated against a-glucosidase and butyrylcholinesterase enzymes. The synthesized compounds were found to be acceptable inhibitors of a-glucosidase and decent inhibition against butyrylcholinesterase. (author)

  16. Preliminary phytochemical screening and alpha-glucosidase inhibitory activity of Philippine taro (Colocasia esculenta (L.) Schott var. PSB-VG #9)

    Science.gov (United States)

    Lebosada, Richemae Grace R.; Librando, Ivy L.

    2017-01-01

    The study was conducted to determine the anti-hyperglycemic property in terms of α-glucosidase inhibitory activity of the various parts (corm, leaf and petiole) of Colocasia esculenta (L.) Schott var. PSB-VG #9. Each of the plant parts were extracted with 95% ethanol and concentrated using a rotary evaporator at 40 °C. The crude extracts were screened for the presence of alkaloids, flavonoids, glycosides and saponins using Thin Layer Chromatography. The α-glucosidase inhibitory activity of the crude extracts (50 mg/L) were assayed spectrophotometrically using a microplate reader. The results of the phytochemical screening revealed the presence of alkaloids, flavonoids, and saponins in the leaf part while flavonoids and saponins were detected in the petiole and only saponins were present in the corm. The assay showed that the percentage α-glucosidase inhibition of the 50 mg/L ethanolic crude extract of the corm, leaves and petiole of C. esculenta are 68.03, 71.64 and 71.39%, respectively. Statistical analysis shows significant differences in the α-glucosidase inhibition among the various plant parts. It can be concluded that the ethanolic crude extracts of the different parts of C. esculenta (L.) Schott var. PSB-VG #9 exhibited inhibitory activity against α-glucosidase and the presence of phytochemicals like alkaloids, flavonoids and saponins may have contributed greatly to the inhibitory activity of the plant extract and can be further subjected for isolation of the therapeutically active compounds with antidiabetes potency.

  17. Differential effects of sugars and the alpha-glucosidase inhibitor acarbose (Bay g 5421) on satiety in the Zucker obese rat.

    Science.gov (United States)

    Maggio, C A; Decarr, L B; Vasselli, J R

    1987-01-01

    To examine the satiety responses of Zucker obese and lean rats to simple sugars, adult male rats were given equicaloric intragastric infusions of fructose, glucose, and sucrose. All three sugars reduced the short-term intakes of both genotypes, although no reliable between-genotype differences in the satiety effects of the sugars were observed. Within each genotype, fructose had a larger satiety effect than sucrose. To examine a potential basis for the observed effects, rats were given sucrose infusions containing the intestinal glucosidase inhibitor acarbose (Bay g 5421). In obese rats, addition of a low dose of acarbose increased the satiety effect of sucrose infusion. Delaying carbohydrate absorption via acarbose administration may alter gastrointestinal and/or postabsorptive satiety processes, and may prove useful as a probe for investigating the nature of satiety signals.

  18. Implicative Algebras

    African Journals Online (AJOL)

    Tadesse

    In this paper we introduce the concept of implicative algebras which is an equivalent definition of lattice implication algebra of Xu (1993) and further we prove that it is a regular Autometrized. Algebra. Further we remark that the binary operation → on lattice implicative algebra can never be associative. Key words: Implicative ...

  19. Synthèses enzymatiques de néoglucoconjugués catalysées par l'alpha-glucosidase purifiée de la blatte Periplaneta americana (Linnaeus

    Directory of Open Access Journals (Sweden)

    Kamenan A.

    2005-01-01

    Full Text Available Enzymatic synthesis of neoglucoconjugates by purified α-glucosidase from cockroach Periplaneta americana (Linnaeus. Cockroach Periplaneta americana (Linnaeus contains in his digestive tract an acid (pH 5,0 and mesophile (50°C α-glucosidase. This enzyme, purified to homogeneity, hydrolyses highly maltose, sucrose and p-nitrophenyl-α-Dglucopyranoside. The ability of α-glucosidase from cockroach purified to homogeneity to catalyse transglucosylation reactions was tested using maltose and saccharose as glucosyl donors and 2-phenylethanol and phenol as acceptors. The experimental conditions were optimized in relation to the time course of the reaction, pH and concentrations of glucosyl donors and acceptors. The yields in transglucosylation reactions at 37 °C were very high and could attain 67% and 48% with 2-phenylethanol and phenol respectively as glucosyl acceptors. This α-glucosidase hydrolyzed the products formed. It seems that the products formed were the phenylethyl-α-D-glucoside and phenyl-α-D-glucoside. These results suggest that α- glucosidase from cockroach is an exoglucosidase which catalyse the splitting of the α-glucosyl residue from the non reducing terminal of the substrate to liberate α-glucose. This comportment indicates that this enzyme operated by a mechanism involving the retention of the anomeric configuration. On the basis of this work, α-glucosidase from P. americana appears to be a valuable tool for the preparation of α-neoglucoconjugates.

  20. Serviceberry [Amerlanchier alnifolia (Nutt.) Nutt. ex. M. Roem(Rosaceae)] leaf exhibits mammalian alpha glucosidase activity and suppresses postprandial glycemic response in a mouse model of diet induced obesity/hyperglycemia

    Science.gov (United States)

    Several plant-based remedies offer cost-effective management of diabetes, but few plant species adapted to North America have been validated for their antidiabetic properties. One such species is serviceberry (Amelanchier alnifolia), found in Browning, MT, which has been traditionally used by the Am...

  1. Drug: D00625 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D00625 Drug Miglitol (JP17/USAN/INN); Glyset (TN) ... C8H17NO5 D00625.gif ... Antidiabetic... agent ... DG01663 ... alpha-Glucosidase inhibitor ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor Unclas...sified ... DG02044 ... Hypoglycemics ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor Same as: C07708 Therapeu

  2. Drug: D01665 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D01665 Drug Voglibose (JP17/USAN/INN); Basen (TN) ... C10H21NO7 D01665.gif ... Antidiabetic... agent ... DG01663 ... alpha-Glucosidase inhibitor ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor Uncla...ssified ... DG02044 ... Hypoglycemics ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor Therapeutic category: 3

  3. SwissProt search result: AK066051 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK066051 J013051B02 (P10253) Lysosomal alpha-glucosidase precursor (EC 3.2.1.20) (A...cid maltase) (Aglucosidase alfa) [Contains: 76 kDa lysosomal alpha-glucosidase; 70 kDa lysosomal alpha-glucosidase] LYAG_HUMAN 1e-89 ...

  4. SwissProt search result: AK243062 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK243062 J100014O03 (P10253) Lysosomal alpha-glucosidase precursor (EC 3.2.1.20) (A...cid maltase) (Aglucosidase alfa) [Contains: 76 kDa lysosomal alpha-glucosidase; 70 kDa lysosomal alpha-glucosidase] LYAG_HUMAN 3e-72 ...

  5. SwissProt search result: AK121014 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121014 J023048A03 (P10253) Lysosomal alpha-glucosidase precursor (EC 3.2.1.20) (A...cid maltase) (Aglucosidase alfa) [Contains: 76 kDa lysosomal alpha-glucosidase; 70 kDa lysosomal alpha-glucosidase] LYAG_HUMAN 6e-81 ...

  6. SwissProt search result: AK121588 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121588 J033037N10 (P10253) Lysosomal alpha-glucosidase precursor (EC 3.2.1.20) (A...cid maltase) (Aglucosidase alfa) [Contains: 76 kDa lysosomal alpha-glucosidase; 70 kDa lysosomal alpha-glucosidase] LYAG_HUMAN 1e-126 ...

  7. SwissProt search result: AK063966 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK063966 001-124-A04 (P10253) Lysosomal alpha-glucosidase precursor (EC 3.2.1.20) (...Acid maltase) (Aglucosidase alfa) [Contains: 76 kDa lysosomal alpha-glucosidase; 70 kDa lysosomal alpha-glucosidase] LYAG_HUMAN 1e-145 ...

  8. SwissProt search result: AK105449 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK105449 001-125-B12 (P10253) Lysosomal alpha-glucosidase precursor (EC 3.2.1.20) (...Acid maltase) (Aglucosidase alfa) [Contains: 76 kDa lysosomal alpha-glucosidase; 70 kDa lysosomal alpha-glucosidase] LYAG_HUMAN 1e-142 ...

  9. SwissProt search result: AK102309 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK102309 J033090B18 (P10253) Lysosomal alpha-glucosidase precursor (EC 3.2.1.20) (A...cid maltase) (Aglucosidase alfa) [Contains: 76 kDa lysosomal alpha-glucosidase; 70 kDa lysosomal alpha-glucosidase] LYAG_HUMAN 1e-145 ...

  10. SwissProt search result: AK110088 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK110088 002-160-G07 (P10253) Lysosomal alpha-glucosidase precursor (EC 3.2.1.20) (...Acid maltase) (Aglucosidase alfa) [Contains: 76 kDa lysosomal alpha-glucosidase; 70 kDa lysosomal alpha-glucosidase] LYAG_HUMAN 1e-62 ...

  11. SwissProt search result: AK121428 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK121428 J023136H14 (P10253) Lysosomal alpha-glucosidase precursor (EC 3.2.1.20) (A...cid maltase) (Aglucosidase alfa) [Contains: 76 kDa lysosomal alpha-glucosidase; 70 kDa lysosomal alpha-glucosidase] LYAG_HUMAN 6e-54 ...

  12. Industrial implications of hydrogen

    International Nuclear Information System (INIS)

    Pressouyre, G.M.

    1982-01-01

    Two major industrial implications of hydrogen are examined: problems related to the effect of hydrogen on materials properties (hydrogen embrittlement), and problems related to the use and production of hydrogen as a future energy vector [fr

  13. Psoriasis : implications of biologics

    NARCIS (Netherlands)

    Lecluse, L.L.A.

    2010-01-01

    Since the end of 2004 several specific immunomodulating therapies: ‘biologic response modifiers’ or ‘biologics’ have been registered for moderate to severe psoriasis in Europe. This thesis is considering the implications of the introduction of the biologics for psoriasis patients, focusing on safety

  14. Implications of social structure

    DEFF Research Database (Denmark)

    Brask, Josefine Bohr

    Social systems in nature are characterised by heterogeneous social structures. The pattern of social interactions or associations between individuals within populations (i.e. their social network) is typically non-random. Such structuring may have important implications for the expression...... and evolution of behaviour, and for individual fitness. In this thesis I investigated implications of social structure for fitness and behaviour, with focus on three main areas: social structure & fitness, social structure & communication, and social structure & cooperation. These areas were investigated......, we investigate empirically the role of the social environment of individuals for their communication patterns. Our study species is a song bird, the black-capped chickadee (Poecile atricapillus). The results suggest that individual communication in this species is influenced by features of the local...

  15. Epigenetics: ambiguities and implications.

    Science.gov (United States)

    Stotz, Karola; Griffiths, Paul

    2016-12-01

    Everyone has heard of 'epigenetics', but the term means different things to different researchers. Four important contemporary meanings are outlined in this paper. Epigenetics in its various senses has implications for development, heredity, and evolution, and also for medicine. Concerning development, it cements the vision of a reactive genome strongly coupled to its environment. Concerning heredity, both narrowly epigenetic and broader 'exogenetic' systems of inheritance play important roles in the construction of phenotypes. A thoroughly epigenetic model of development and evolution was Waddington's aim when he introduced the term 'epigenetics' in the 1940s, but it has taken the modern development of molecular epigenetics to realize this aim. In the final sections of the paper we briefly outline some further implications of epigenetics for medicine and for the nature/nurture debate.

  16. Conditions for gene disruption by homologous recombination of exogenous DNA into the Sulfolobus solfataricus genome

    NARCIS (Netherlands)

    Albers, Sonja-Verena; Driessen, Arnold J.M.

    2008-01-01

    The construction of directed gene deletion mutants is an essential tool in molecular biology that allows functional studies on the role of genes in their natural environment. For hyperthermophilic archaea, it has been difficult to obtain a reliable system to construct such mutants. However, during

  17. Conditions for gene disruption by homologous recombination of exogenous DNA into the Sulfolobus solfataricus genome

    OpenAIRE

    Albers, Sonja-Verena; Driessen, Arnold J. M.

    2008-01-01

    The construction of directed gene deletion mutants is an essential tool in molecular biology that allows functional studies on the role of genes in their natural environment. For hyperthermophilic archaea, it has been difficult to obtain a reliable system to construct such mutants. However, during the past years, systems have been developed for Thermococcus kodakarensis and two Sulfolobus species, S. ac...

  18. Replication termination and chromosome dimer resolution in the archaeon Sulfolobus solfataricus.

    Science.gov (United States)

    Duggin, Iain G; Dubarry, Nelly; Bell, Stephen D

    2011-01-05

    Archaea of the genus Sulfolobus have a single-circular chromosome with three replication origins. All three origins fire in every cell in every cell cycle. Thus, three pairs of replication forks converge and terminate in each replication cycle. Here, we report 2D gel analyses of the replication fork fusion zones located between origins. These indicate that replication termination involves stochastic fork collision. In bacteria, replication termination is linked to chromosome dimer resolution, a process that requires the XerC and D recombinases, FtsK and the chromosomal dif site. Sulfolobus encodes a single-Xer homologue and its deletion gave rise to cells with aberrant DNA contents and increased volumes. Identification of the chromosomal dif site that binds Xer in vivo, and biochemical characterization of Xer/dif recombination revealed that, in contrast to bacteria, dif is located outside the fork fusion zones. Therefore, it appears that replication termination and dimer resolution are temporally and spatially distinct processes in Sulfolobus.

  19. Production of Recombinant and Tagged Proteins in the Hyperthermophilic Archaeon Sulfolobus solfataricus

    NARCIS (Netherlands)

    Albers, S.-V.; Jonuscheit, M.; Dinkelaker, S.; Urich, T.; Kletzin, A.; Tampé, R.; Driessen, A.J.M.; Schleper, C.

    Many systems are available for the production of recombinant proteins in bacterial and eukaryotic model organisms, which allow us to study proteins in their native hosts and to identify protein-protein interaction partners. In contrast, only a few transformation systems have been developed for

  20. The architects of crenarchaeal chromatin : A biophysical characterization of chromatin proteins from Sulfolobus solfataricus

    NARCIS (Netherlands)

    Driessen, Rosalie Paula Catharina

    2014-01-01

    Understanding of chromatin organization and compaction in Archaea is currently limited. The genome of several megabasepairs long is folded by a set of small chromatin proteins to fit into the micron-sized cell. A first step in understanding archaeal chromatin organization is to study the action of

  1. Drug: D03342 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D03342 Drug Camiglibose (USAN) ... (C13H25NO9)2. 3H2O D03342.gif ... Antidiabetic agen...t ... DG01663 ... alpha-Glucosidase inhibitor ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor Unclassified ... D...G02044 ... Hypoglycemics ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor ... CAS: 132438-21-2 PubChem: 17397492 LigandBox: D03342 ...

  2. Astrophysical implications of periodicity

    International Nuclear Information System (INIS)

    Muller, R.A.

    1988-01-01

    Two remarkable discoveries of the last decade have profound implications for astrophysics and for geophysics. These are the discovery by Alvarez et al., that certain mass extinctions are caused by the impact on the earth of a large asteroid or comet, and the discovery by Raup and Sepkoski that such extinctions are periodic, with a cycle time of 26 to 30 million years. The validity of both of these discoveries is assumed and the implications are examined. Most of the phenomena described depend not on periodicity, but just on the weaker assumption that the impacts on the earth take place primarily in showers. Proposed explanations for the periodicity include galactic oscillations, the Planet X model, and the possibility of Nemesis, a solar companion star. These hypotheses are critically examined. Results of the search for the solar companion are reported. The Deccan flood basalts of India have been proposed as the impact site for the Cretaceous impact, but this hypotheisis is in contradiction with the conclusion of Courtillot et al., that the magma flow began during a period of normal magnetic field. A possible resolution of this contradiction is proposed

  3. Implications of antisocial parents.

    Science.gov (United States)

    Torry, Zachary D; Billick, Stephen B

    2011-12-01

    Antisocial behavior is a socially maladaptive and harmful trait to possess. This can be especially injurious for a child who is raised by a parent with this personality structure. The pathology of antisocial behavior implies traits such as deceitfulness, irresponsibility, unreliability, and an incapability to feel guilt, remorse, or even love. This is damaging to a child's emotional, cognitive, and social development. Parents with this personality makeup can leave a child traumatized, empty, and incapable of forming meaningful personal relationships. Both genetic and environmental factors influence the development of antisocial behavior. Moreover, the child with a genetic predisposition to antisocial behavior who is raised with a parental style that triggers the genetic liability is at high risk for developing the same personality structure. Antisocial individuals are impulsive, irritable, and often have no concerns over their purported responsibilities. As a parent, this can lead to erratic discipline, neglectful parenting, and can undermine effective care giving. This paper will focus on the implications of parents with antisocial behavior and the impact that this behavior has on attachment as well as on the development of antisocial traits in children.

  4. Structuralism and Its Heuristic Implications.

    Science.gov (United States)

    Greene, Ruth M.

    1984-01-01

    The author defines structuralism (a method for modeling and analyzing event systems in a space-time framework), traces its origins to the work of J. Piaget and M. Fourcault, and discusses its implications for learning. (CL)

  5. Strategic Implications of Global Health

    National Research Council Canada - National Science Library

    Monaghan, Karen

    2008-01-01

    "Strategic Implications of Global Health" responds to a request from the Undersecretary of State for Democratization and Global Affairs for an intelligence assessment on the connections between health and U.S. national interests...

  6. The privacy implications of Bluetooth

    OpenAIRE

    Kostakos, Vassilis

    2008-01-01

    A substantial amount of research, as well as media hype, has surrounded RFID technology and its privacy implications. Currently, researchers and the media focus on the privacy threats posed by RFID, while consumer groups choose to boycott products bearing RFID tags. At the same, however, a very similar technology has quietly become part of our everyday lives: Bluetooth. In this paper we highlight the fact that Bluetooth is a widespread technology that has real privacy implications. Furthermor...

  7. Maritime Violence : Implications to Malaysia

    OpenAIRE

    Zubir, Nurulizwan Ahmad

    2012-01-01

    Abstract Maritime Piracy has been a serious threat to the international community especially in the SoutheastAsia region. This threat has caused tremendous implications towards the world economy, environment,political stability of the nations involved because 45% of the shipping company passes through theSoutheast Asia. The worrying fact is that these attacks were committed by terrorists as well as traditionalmaritime pirates. This paper examines on the implications of maritime crime in M...

  8. Dgroup: DG01803 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available DG01803 DGroup Antidiabetic, alpha-glucosidase inhibitor -bose ... D00216 ... Acarbose (...e (USAN) D09779 ... Emiglitate (JAN/INN) Antidiabetic agent ... DG01663 ... alpha-Glucosidase inhibitor Unclassified ... DG02044 ... Hypoglycemics ATC code: A10BF Antidiabetics GAA [HSA:2548] [KO:K12316] GANC [HSA:2595] [KO:K12317] MGAM [HSA:8972] [KO:K12047] ...

  9. Dgroup: DG01663 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available DG01663 DGroup alpha-Glucosidase inhibitor -bose, -glustat ... DG01803 ... Antidiabetic,...at ... D09605 ... Duvoglustat (USAN/INN) ... D09606 ... Duvoglustat hydrochloride (USAN) Antidiabetic agent ... alpha-glucosidase [KO:K12316 K12317 K12047] ...

  10. Drug: D00216 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available etic agent ... DG01663 ... alpha-Glucosidase inhibitor ... DG01803 ... Antidiabetic, alpha-glu...cosidase inhibitor Unclassified ... DG02044 ... Hypoglycemics ... DG01803 ... Antidiabetic, alpha-glucosidase inhibitor... D00216 Drug Acarbose (JAN/USAN/INN); Precose (TN) ... C25H43NO18 D00216.gif ... Actinoplanes [TAX:1865] Antidiab

  11. NCBI nr-aa BLAST: CBRC-DNOV-01-1573 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-1573 ref|ZP_01446186.1| probable alpha-glucosidase protein [Roseovariu...s sp. HTCC2601] gb|EAU43606.1| probable alpha-glucosidase protein [Roseovarius sp. HTCC2601] ZP_01446186.1 0.59 38% ...

  12. Quantum histories and their implications

    International Nuclear Information System (INIS)

    Kent, A.

    2000-01-01

    Classical mechanics and standard Copenhagen quantum mechanics respect subspace implications. For example, if a particle is confined in a particular region R of space, then in these theories we can deduce that it is confined in regions containing R. However, subspace implications are generally violated by versions of quantum theory that assign probabilities to histories, such as the consistent histories approach. I define here a new criterion, ordered consistency, which refines the criterion of consistency and has the property that inferences made by ordered consistent sets do not violate subspace relations. This raises the question: do the operators defining our observations form an ordered consistent history? If so, ordered consistency defines a version of quantum theory with greater predictive power than the consistent histories formalism. If not, and our observations are defined by a non-ordered consistent quantum history, then subspace implications are not generally valid. (orig.)

  13. THE ACTUAL IMPLICATIONS OF INFLATION

    Directory of Open Access Journals (Sweden)

    Murăriţa Ilie

    2011-12-01

    Full Text Available The authors have started from the idea that inflationary phenomenon is a companion, the cause and the effect of the globalization of poverty in the broader context of world economy globalization. Therefore, starting from a common definition of inflation, the first objective was to identify causal relationships that singularize contemporary inflationary process. After that, attention was focused on the implications of inflation in the current stage, bearing in mind that monetary financial theory and practice are operating with perfectly anticipated inflation or imperfectly anticipated inflation. Inflation has great implications on the long-term contracts and wage contracts.

  14. OSHA: Implications for Higher Education.

    Science.gov (United States)

    National Association of College and University Business Officers, Washington, DC.

    Presented in this document are several articles concerning recommendations about the Occupational Safety and Health Act of 1970 (OSHA) and its implications for higher education. It is time for an educated look at facilities and programs and the beginning of plans which, in the long run, will bring colleges and universities into compliance with…

  15. Implications of SNOMED CT versioning

    NARCIS (Netherlands)

    Lee, Dennis; Cornet, Ronald; Lau, Francis

    2011-01-01

    To determine the changes each Systematized Nomenclature of Medicine Clinical Terms (SNOMED CT) release undergoes and the implications of those changes. (1) We reviewed the SNOMED CT Component History documentation and analyzed the Component History table in detail. (2) We outlined a list of semantic

  16. Military Implications of Global Warming.

    Science.gov (United States)

    1999-05-20

    U.S. environmental issues also have important global implications. This paper analyzes current U.S. Policy as it pertains to global warming and climate...for military involvement to reduce global warming . Global warming and other environmental issues are important to the U.S. military. As the United

  17. Safety implications of control systems

    International Nuclear Information System (INIS)

    Smith, O.L.

    1983-01-01

    The Safety Implications of Control Systems Program has three major activities in support of USI-A47. The first task is a failure mode and effects analysis of all plant systems which may potentially induce control system disturbance that have safety implications. This task has made a preliminary study of overfill events and recommended cases for further analysis on the hybrid simulator. Work continues on overcooling and undercooling. A detailed investigation of electric power network is in progress. LERs are providing guidance on important failure modes that will provide initial conditions for further simulator studies. The simulator taks is generating a detailed model of the control system supported by appropriate neutronics, hydraulics, and thermodynamics submodels of all other principal plant components. The simulator is in the last stages of development. Checkout calculations are in progress to establish model stability, robustness, and qualitative credibility. Verification against benchmark codes and plant data will follow

  18. Cosmological implications of Heisenberg's principle

    CERN Document Server

    Gonzalo, Julio A

    2015-01-01

    The aim of this book is to analyze the all important implications of Heisenberg's Uncertainty Principle for a finite universe with very large mass-energy content such as ours. The earlier and main contributors to the formulation of Quantum Mechanics are briefly reviewed regarding the formulation of Heisenberg's Principle. After discussing “indeterminacy” versus ”uncertainty”, the universal constants of physics are reviewed and Planck's units are given. Next, a novel set of units, Heisenberg–Lemaitre units, are defined in terms of the large finite mass of the universe. With the help of Heisenberg's principle, the time evolution of the finite zero-point energy for the universe is investigated quantitatively. Next, taking advantage of the rigorous solutions of Einstein's cosmological equation for a flat, open and mixed universe of finite mass, the most recent and accurate data on the “age” (to) and the expansion rate (Ho) of the universe and their implications are reconsidered.

  19. MARITIME VIOLENCE : IMPLICATIONS TO MALAYSIA

    Directory of Open Access Journals (Sweden)

    Nurulizwan Ahmad Zubir

    2014-04-01

    Full Text Available Abstract Maritime Piracy has been a serious threat to the international community especially in the SoutheastAsia region. This threat has caused tremendous implications towards the world economy, environment,political stability of the nations involved because 45% of the shipping company passes through theSoutheast Asia. The worrying fact is that these attacks were committed by terrorists as well as traditionalmaritime pirates. This paper examines on the implications of maritime crime in Malaysia and discusseswhether the definition of piracy under the International Law could be applied to these attacks. Thispaper concludes that cooperation between the region’s states and the enhancement of a good securitysystem of one state are needed to combat maritime violence. Thus it is imperative that the internationallaw need to be changed in order to enhance the meaning of piracy and also to include sea terrorism. Key words: piracy, maritime, terrorist

  20. Implications of alternative fuel cycles

    International Nuclear Information System (INIS)

    Anon.

    1978-01-01

    The United States is re-examining alternative fuel cycles and nuclear power strategies, and doubtful attempts are being made to justify the economics of the 'throw-away' fuel cycle. At an international forum on 'An acceptable nuclear energy future for the world' at Fort Lauderdale, Karl Cohen of General Electric and a leading authority on this topic put the implications into perspective. Extracts from his address are presented

  1. Pharmacogenomics and migraine: possible implications

    DEFF Research Database (Denmark)

    Tfelt-Hansen, P.; Brosen, K.

    2008-01-01

    Pharmacogenomics is the science about how inherited factors influence the effects of drugs. Drug response is always a result of mutually interacting genes with important modifications from environmental and constitutional factors. Based on the genetic variability of pharmacokinetic and in some...... cases pharmacodynamic variability we mention possible implications for the acute and preventive treatment of migraine. Pharmacogenomics will most likely in the future be one part of our therapeutic armamentarium and will provide a stronger scientific basis for optimizing drug therapy on the basis...

  2. Networking activism: implications for Greece

    Directory of Open Access Journals (Sweden)

    Pantelis Vatikiotis

    2011-12-01

    Full Text Available The outbreak of December 2008 against police brutality through a wave of demonstrations and street protests in Athens, which was strongly advocated by protest activities and practices across the world, addresses several issues in relation to the transformative potentials of mediated collective action. The paper critically evaluates different accounts of December events, probing then into thevery networking of that movement. From this perspective, it points out another aspect of the local-global interplay in protest culture along new mediating practices (beyond the creation of transnational publics, that of the implications of transnational networking for local social activism and identification, addressing relevant questions in the Greek context.

  3. Practical implications of 'postmodern philosophy'

    Directory of Open Access Journals (Sweden)

    Savić Mile V.

    2002-01-01

    Full Text Available The article examines the implications of the discourse about postmodernity. Postmodernity is analyzed as a complex discursive figure. Within the discourse about postmodernity three levels are distinguished: the postmodern condition, postmodernism, and reflection of the postmodern condition. Special attention is paid to globalization and the problem of the enforcement of modern projects in East-European societies, particularly Serbia. These societies are termed object-societies, while their modification of modernity is called eastmodernity. The author's answer to the complexity of the postmodern condition is a conception of the politics of subsistence.

  4. Inflationary implications of supersymmetry breaking

    Energy Technology Data Exchange (ETDEWEB)

    Borghese, Andrea; Roest, Diederik; Zavala, Ivonne [Centre for Theoretical Physics, University of Groningen, Nijenborgh 4, 9747 AG Groningen (Netherlands)

    2013-07-23

    We discuss a general bound on the possibility to realise inflation in any minimal supergravity with F-terms. The derivation crucially depends on the sGoldstini, the scalar field directions that are singled out by spontaneous supersymmetry breaking. The resulting bound involves both slow-roll parameters and the geometry of the Kähler manifold of the chiral scalars. We analyse the inflationary implications of this bound, and in particular discuss to what extent the requirements of single field and slow-roll can both be met in F-term inflation.

  5. The chaperonin of the archaeon Sulfolobus solfataricus is an RNA-binding protein that participates in ribosomal RNA processing.

    OpenAIRE

    Ruggero, D; Ciammaruconi, A; Londei, P

    1998-01-01

    The 60 kDa molecular chaperones (chaperonins) are high molecular weight protein complexes having a characteristic double-ring toroidal shape; they are thought to aid the folding of denatured or newly synthesized polypeptides. These proteins exist as two functionally similar, but distantly related families, one comprising the bacterial and organellar chaperonins and another (the so-called CCT-TRiC family) including the chaperonins of the archaea and the eukaryotes. Although some evidence exist...

  6. A Bac Library and Paired-PCR Approach to Mapping and Completing the Genome Sequence of Sulfolobus Solfataricus P2

    DEFF Research Database (Denmark)

    She, Qunxin; Confalonieri, F.; Zivanovic, Y.

    2000-01-01

    The original strategy used in the Sulfolobus solfatnricus genome project was to sequence non overlapping, or minimally overlapping, cosmid or lambda inserts without constructing a physical map. However, after only about two thirds of the genome sequence was completed, this approach became counter......-productive because there was a high sequence bias in the cosmid and lambda libraries. Therefore, a new approach was devised for linking the sequenced regions which may be generally applicable. BAC libraries were constructed and terminal sequences of the clones were determined and used for both end mapping and PCR...

  7. CREAM: Results, Implications and Outlook

    CERN Document Server

    Seo, Eun-Suk

    The Cosmic Ray Energetics And Mass (CREAM) balloon-borne experiment has accumulated ∼161 days of exposure during six successful flights over Antarctica. Energy measurements are made with a transition radiation detector and an ionization calorimeter. Charge measurements are made with timing scintillators, pixelated Si, and Cherenkov detectors to minimize the effect of backscattered particles. High energy cosmicray data were collected over a wide energy range from ∼ 1010 to ∼ 1015 eV at an average altitude of ∼ 38.5 km, with ∼ 3.9 g/cm2 atmospheric overburden. All cosmic-ray elements from protons (Z = 1) to iron nuclei (Z = 26) are separated with excellent charge resolution. Recent results from the ongoing analysis including the discrepant hardening of elemental spectra at ∼ 200 GeV/n are presented and their implications on cosmic-ray origin, acceleration and propagation are discussed. The project status and plans are also presented.

  8. MARKETING IMPLICATION IN WINE ECONOMY

    Directory of Open Access Journals (Sweden)

    Ştefan MATEI

    2014-11-01

    Full Text Available The wine, a very complex product in viticulture, has proved its tremendous importance not only to the individual but rational nutrition and increasing national income of a country cultivators (evidenced by the upward trend of the share of crop production horticulture and viticulture in the global economy agricultural. More interesting is, given the continued growth in the number of scientific publications and their quality (at least since the 1980s - where "wine" is the centerpiece of these studies - we can not but be witnessing a growing interest more to this "potion" and found that the growing popularity of wine in the science reveals the emergence of a new academic field, ie "wine economy" (or wine-economy. This study aims to make a foray into "wine economy" and to outline some of the implications of marketing in this area.

  9. Conflict management: importance and implications.

    Science.gov (United States)

    McKibben, Laurie

    2017-01-26

    Conflict is a consistent and unavoidable issue within healthcare teams. Despite training of nurse leaders and managers around areas of conflict resolution, the problem of staff relations, stress, sickness and retention remain. Conflict arises from issues with interpersonal relationships, change and poor leadership. New members of staff entering an already established healthcare team should be supported and integrated, to encourage mutual role respect between all team members and establish positive working relationships, in order to maximise patient care. This paper explores the concept of conflict, the importance of addressing causes of conflict, effective management, and the relevance of positive approaches to conflict resolution. Good leadership, nurturing positive team dynamics and communication, encourages shared problem solving and acceptance of change. Furthermore mutual respect fosters a more positive working environment for those in healthcare teams. As conflict has direct implications for patients, positive resolution is essential, to promote safe and effective delivery of care, whilst encouraging therapeutic relationships between colleagues and managers.

  10. Ophthalmic implications of seasonal affective disorder

    International Nuclear Information System (INIS)

    Paramore, J.E.; King, V.M.

    1989-01-01

    A review of seasonal affective disorder (SAD) is presented with a discussion of its standard treatment of phototherapy. A number of ophthalmic implications related to SAD are proposed. These implications relate to both the condition and the phototherapy used in its treatment, especially the use of full spectrum light which contains ultraviolet and near ultraviolet radiation. 12 references

  11. Implications of deforestation and desertification on sustainable ...

    African Journals Online (AJOL)

    This paper examines the implications of deforestation and desertification in sustainable agriculture. The problems of deforestation and desertification were examined as they affect land and agricultural productivity. The socio-economic implications of deforestation and desertification in sustainable agriculture were equally ...

  12. Mining TCGA data using Boolean implications.

    Directory of Open Access Journals (Sweden)

    Subarna Sinha

    Full Text Available Boolean implications (if-then rules provide a conceptually simple, uniform and highly scalable way to find associations between pairs of random variables. In this paper, we propose to use Boolean implications to find relationships between variables of different data types (mutation, copy number alteration, DNA methylation and gene expression from the glioblastoma (GBM and ovarian serous cystadenoma (OV data sets from The Cancer Genome Atlas (TCGA. We find hundreds of thousands of Boolean implications from these data sets. A direct comparison of the relationships found by Boolean implications and those found by commonly used methods for mining associations show that existing methods would miss relationships found by Boolean implications. Furthermore, many relationships exposed by Boolean implications reflect important aspects of cancer biology. Examples of our findings include cis relationships between copy number alteration, DNA methylation and expression of genes, a new hierarchy of mutations and recurrent copy number alterations, loss-of-heterozygosity of well-known tumor suppressors, and the hypermethylation phenotype associated with IDH1 mutations in GBM. The Boolean implication results used in the paper can be accessed at http://crookneck.stanford.edu/microarray/TCGANetworks/.

  13. Green buildings: Implications for acousticians

    Science.gov (United States)

    Noble, Michael R.

    2005-04-01

    This presentation will deal with the practical implications of green design protocols of the US Green Building Council on interior acoustics of buildings. Three areas of particular consequence to acousticians will be discussed. Ventilation Systems: reduced energy consumption goals dictate reliance on natural cooling and ventilation using ambient air when possible. The consequent large openings in the building envelope to bring fresh air into rooms, and similar sized openings to transfer the mixed air out, can severely compromise the noise isolation of the rooms concerned. Radiant Cooling: the heavy concrete floors of buildings can be used as a thermal flywheel to lessen the cooling load, which forces the concrete ceilings to be exposed to the occupied rooms for heat transfer, and strictly limits the application of acoustical absorption on the ceilings. This challenges the room acoustics design. Green Materials: the LEED protocols require the elimination of potentially harmful finishes, including fibrous materials which may impact air quality or contribute to health problems. Since the backbone of sound absorption is glass and mineral fibres, this further challenges provision of superior room acoustics. Examples and commentary will be provided based on current and recent projects.

  14. Implications of increased ethanol production

    International Nuclear Information System (INIS)

    1992-06-01

    The implications of increased ethanol production in Canada, assuming a 10% market penetration of a 10% ethanol/gasoline blend, are evaluated. Issues considered in the analysis include the provision of new markets for agricultural products, environmental sustainability, energy security, contribution to global warming, potential government cost (subsidies), alternative options to ethanol, energy efficiency, impacts on soil and water of ethanol crop production, and acceptance by fuel marketers. An economic analysis confirms that ethanol production from a stand-alone plant is not economic at current energy values. However, integration of ethanol production with a feedlot lowers the break-even price of ethanol by about 35 cents/l, and even further reductions could be achieved as technology to utilize lignocellulosic feedstock is commercialized. Ethanol production could have a positive impact on farm income, increasing cash receipts to grain farmers up to $53 million. The environmental impact of ethanol production from grain would be similar to that from crop production in general. Some concerns about ethanol/gasoline blends from the fuel industry have been reduced as those blends are now becoming recommended in some automotive warranties. However, the concerns of the larger fuel distributors are a serious constraint on an expansion of ethanol use. The economics of ethanol use could be improved by extending the federal excise tax exemption now available for pure alcohol fuels to the alcohol portion of alcohol/gasoline blends. 9 refs., 10 tabs

  15. Health implications of hydropower development

    International Nuclear Information System (INIS)

    Biswas, A.K.

    1982-01-01

    Hydropower development had been neglected in many countries during the past few decades, but the situation dramatically changed during the 1970s owing to the constantly increasing costs of electricity generation by fossil-fuel and nuclear power plants. Currently, hydroelectric generation accounts for approximately 23% of total global electricity supply. Much of the hydropower potential in developing countries of Africa, Asia and Latin America still remains to be exploited. Like any other source of energy, hydropower development has several health impacts. Conceptually, health implications of hydropower development can be divided into two broad categories: short-term and long-term problems. Short-term health impacts occur during the planning, construction and immediate post-construction phases, whereas long-term impacts stem from the presence of large man-made lakes, development of extensive canal systems, alteration of the ecosystem of the area, and changing socio-economic conditions. Longer-term impacts are further classified into two categories: introduction of new diseases and/or intensification of existing ones due to the improvements of the habitats of disease-carrying vectors, and health problems arising from resettlement of the people whose homes and land-holdings are inundated by the reservoirs. All these impacts are discussed in detail. Health impacts of hydropower developments have not yet been studied extensively. It is often implicitly assumed that health impacts of major dams are minor compared with other social and environmental impacts. Future studies could possibly reverse this assumption. (author)

  16. Geometric Implications of Maxwell's Equations

    Science.gov (United States)

    Smith, Felix T.

    2015-03-01

    Maxwell's synthesis of the varied results of the accumulated knowledge of electricity and magnetism, based largely on the searching insights of Faraday, still provide new issues to explore. A case in point is a well recognized anomaly in the Maxwell equations: The laws of electricity and magnetism require two 3-vector and two scalar equations, but only six dependent variables are available to be their solutions, the 3-vectors E and B. This leaves an apparent redundancy of two degrees of freedom (J. Rosen, AJP 48, 1071 (1980); Jiang, Wu, Povinelli, J. Comp. Phys. 125, 104 (1996)). The observed self-consistency of the eight equations suggests that they contain additional information. This can be sought as a previously unnoticed constraint connecting the space and time variables, r and t. This constraint can be identified. It distorts the otherwise Euclidean 3-space of r with the extremely slight, time dependent curvature k (t) =Rcurv-2 (t) of the 3-space of a hypersphere whose radius has the time dependence dRcurv / dt = +/- c nonrelativistically, or dRcurvLor / dt = +/- ic relativistically. The time dependence is exactly that of the Hubble expansion. Implications of this identification will be explored.

  17. Implications of human tissue studies

    International Nuclear Information System (INIS)

    Kathren, R.L.

    1986-10-01

    Through radiochemical analysis of voluntary tissue donations, the United States Transuranium and Uranium Registries are gaining improved understanding of the distribution and biokinetics of actinide elements in occupationally exposed persons. Evaluation of the first two whole body contributions to the Transuranium Registry revealed an inverse proportionality between actinide concentration and bone ash fraction. The analysis of a whole body with a documented 241 Am deposition indicated a significantly shorter half-time in liver and a greater fraction resident in the skeleton than predicted by existing models. Other studies of the Registries are designed to evaluate in vivo estimates of actinide deposition with those derived from postmortem tissue analysis, compare results of animal experiments with human data, and reviw histopathologic slides for tissue toxicity that might be attributable to exposure to uranium and the transuranic elements. The implications of these recent findings and other work of the Registries are discussed from the standpoint of their potential impact on biokinetic modeling, internal dose assessment, safety standards, and operational health physics practices

  18. On the implications of confinement

    International Nuclear Information System (INIS)

    Roberts, C.D.

    1992-01-01

    In this paper, the authors consider some implications of confinement starting from the basic observation that cross-sections for the production of colored asymptotic states, such as free quarks and gluons, from color singlet initial states must be zero if QCD is to be confining. The authors discuss two pictures of confinement: the failure of the cluster decomposition property and the absence of a pole at timelike momenta in the propagator of a confined particle. The authors use QCD-based models as a framework to relate the failure of the cluster decomposition property to other ideas, such as the role of a nonzero gluon condensate. The authors' primary interest is to address the question of the absence of a mass pole through a study of model Schwinger-Dyson equations. These equations contain some of the dynamical information that is present in the study of the cluster decomposition property. The authors discuss the problems within this idea and its study using the Schwinger-Dyson equations

  19. National and international social implications

    International Nuclear Information System (INIS)

    Zablocki, B.D.

    1980-01-01

    Every new technology since slash-and-burn has required new social institutions to go along with it, and nuclear technology is no exception. There is, therefore, a need to go beyond decisionmaking among alternative peaceful proliferation schemes. There is a need also to look at the needs for new national and/or transnational institutions that will have to accompany any proliferations in area. There are five social implications that bear on the need to develop new social institutions. First is the issue of Great Power relations, in an era of nuclear proliferation. Second is the conflict between nationalism and internationalism. The third is the issue of the military and diplomatic strategies of small nations, particularly small nations on the threshold of nuclear capacity, and the question of military versus civilian rule in those nations. Fourth, and possibly the most important is the role of multinational corporations in nuclear regulation, and fifth, the question of secrecy and how that bears on power values of primacy in democratic states

  20. Energy implications of bottled water

    International Nuclear Information System (INIS)

    Gleick, P H; Cooley, H S

    2009-01-01

    As bottled water use continues to expand around the world, there is growing interest in the environmental, economical, and social implications of that use, including concerns about waste generation, proper use of groundwater, hydrologic effects on local surface and groundwater, economic costs, and more. A key concern is how much energy is required to produce and use bottled water. This paper estimates the energy footprint required for various phases of bottled water production, transportation, and use. We do not develop a single comprehensive life-cycle energy estimate because of differences among water sources, bottling processes, transportation costs, and other factors, but we quantify key energy inputs necessary for site-specific assessments. We also apply these inputs to three site-specific examples of the energy required from production to the point of use: local bottled water produced and used in Los Angeles, water bottled in the South Pacific and shipped by cargo ship to Los Angeles, and water bottled in France and shipped in various ways to Los Angeles. For water transported short distances, the energy requirements of bottled water are dominated by the energy used to produce the plastic bottles. Long-distance transport, however, can lead to energy costs comparable to, or even larger than, those of producing the bottle. All other energy costs-for processing, bottling, sealing, labeling, and refrigeration-are far smaller than those for the production of the bottle and transportation. These data can be used to generate specific estimates for different sources, treatments, and delivery options.

  1. Implications of Donald Macdonald's report

    International Nuclear Information System (INIS)

    Margolick, M.; Carr, J.; Hall, D.; Murphy, J.; Jennings, T.; Shepherd, J.

    1997-01-01

    The chairman of the session debating the implications of the Macdonald report identified three important aspects of utility restructuring: equity, efficiency and sustainability. Dr. Jan Carr, a member of the Macdonald Committee, predicted that the continental energy market will likely demand a much larger number of smaller energy transactions, and the value in having inherently low-cost generation located close to load centres, and/or close to the US border. Douglas Hall, Vice President of RBC Dominion Securities criticized the Macdonald Committee for leaving 70 per cent of Hydro's generating capacity in public hands. He favored transferring all assets to the private sector, and questioned the Committee's assumption that the utility could be broken down into four components that would share overhead and still compete against each other. John Murphy, President of the Power Workers Union stated that the Union was not ideologically opposed to competition in the electricity industry, but he questioned the Committee's assumption that competition would promote efficient supply of power at the least cost to the economy. Tony Jennings, Chief Executive of the Municipal Electric Association tackled a series of myths about municipal electric utilities, and IPPSO Counsel Jay Sheppard emphasized the need for making sure that the entity buying the power in the short term is truly independent and is not doing incestuous deals with its friends at Ontario Hydro Generation (one of the four components of the proposed, restructured Corporation) , because otherwise competition will not work

  2. Postgraduate diploma collaborative assignment: Implications for ...

    African Journals Online (AJOL)

    Postgraduate diploma collaborative assignment: Implications for ESL students ... and collaborative teaching/learning model involving the major course convenors. ... The quality of the work and mood of all concerned improved tremendously.

  3. Surveillance theory and its implications for law

    NARCIS (Netherlands)

    Timan, Tjerk; Galic, Masa; Koops, Bert-Jaap; Brownsword, Roger; Scotford, Eloise; Yeung, Karen

    2017-01-01

    This chapter provides an overview of key surveillance theories and their implications for law and regulation. It presents three stages of theories that characterise changes in thinking about surveillance in society and the disciplining, controlling, and entertaining functions of surveillance.

  4. Implications of Risk Management Practices on Financial ...

    African Journals Online (AJOL)

    Implications of Risk Management Practices on Financial Performance of Sugar ... The respondents were functional heads of the companies under the survey. ... of downside losses in order to minimize the negative impact of risk on returns.

  5. Epistemological and Treatment Implications of Nonlinear Dynamics

    Science.gov (United States)

    Stein, A. H.

    The treatment implications of understanding mind as solely epiphenomenal to nonlinearly founded neurobiology are discussed. G. Klimovsky's epistemological understanding of psychoanalysis as a science is rejected and treatment approaches integrating W. R. Bion's and D. W. Winnicott's work are supported.

  6. Gender equality mainstreaming: Implications for poverty reduction ...

    African Journals Online (AJOL)

    Gender equality mainstreaming: Implications for poverty reduction and sustainable development in Abia State of Nigeria. ... Empowerment of women when pursued beyond mere rhetoric and instrumentation, it will improve their wellbeing, self esteem, resource allocation, political voice and increased productivity generally.

  7. The pedagogical implications of information and communication ...

    African Journals Online (AJOL)

    The pedagogical implications of information and communication technology on adult education: a case study of the osun state colleges of ... Finally, the department should give individual students access to the use of 1C1 equipment.

  8. Implications for Forest Resource Degradation and Deforestation ...

    African Journals Online (AJOL)

    Effects of Socio-Economic Status and Food Consumption Pattern on Household Energy uses: Implications for Forest Resource Degradation and Deforestation around Wondo Genet Catchments, South-Central Ethiopia.

  9. Personal Narratives: Cultural Differences and Clinical Implications

    Science.gov (United States)

    Bliss, Lynn S.; McCabe, Allyssa

    2008-01-01

    A study was conducted to examine the misdiagnosis of cultural difference deficits and how mistaking deficits in narrative production for cultural differences can be avoided. Findings reveal the implications for intervention.

  10. Corporal punishment contestations, paradoxes and implications for ...

    African Journals Online (AJOL)

    Corporal punishment contestations, paradoxes and implications for school leadership: A case study of two South African high schools. ... South African Journal of Education. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current ...

  11. Climate Change Communication Research: Trends and Implications ...

    African Journals Online (AJOL)

    Climate Change Communication Research: Trends and Implications. ... African Journal of Sustainable Development ... with a specific focus on the themes that have dominated current studies, major research methods in use, major theories that ...

  12. Business ethics: implications for managed care contracts.

    Science.gov (United States)

    Stahl, D A

    1997-01-01

    Business ethics is a specialized study that emphasizes how moral standards apply to organizations, policies, procedures and behavior. Moral standards must be considered to understand the implications of business ethics in subacute care.

  13. Venous chest anatomy: clinical implications

    International Nuclear Information System (INIS)

    Chasen, M.H.; Charnsangavej, C.

    1998-01-01

    This article provides a practical approach to the clinical implications and importance of understanding the collateral venous anatomy of the thorax. Routine radiography, conventional venography, computed tomography (CT), and magnetic resonance (MR) imaging studies provide correlative anatomic models for the demonstration of how interconnecting collateral vascular networks within the thorax maintain venous stability at all times. Five major systems comprise the collateral venous network of the thorax ( Fig. 1 ). These include the paravertebral, azygos-hemiazygos, internal mammary, lateral thoracic, and anterior jugular venous systems (AJVS). The five systems are presented in the following sequence: (a) a brief introduction to the importance of catheter position and malposition in understanding access to the thoracic venous system, (b) the anatomy of the azygos-hemiazygos systems and their relationship with the paravertebral plexus, (c) the importance of the AJVS, (d) 'loop' concepts interconnecting the internal mammary and azygos-hemiazygos systems by means of the lateral thoracic and intercostal veins, and (e) the interconnecting venous networks on the thoracic side of the thoracoabdominal junction. Certain aspects of the venous anatomy of the thorax will not be discussed in this chapter and include (a) the intra-abdominal anastomoses between the superior and inferior vena cavae (IVC) via the internal mammary, lateral thoracic, and azygos-hemiazygos systems (beyond the scope of this article), (b) potential collateral vessels involving vertebral, parascapular, thyroidal, thymic, and other smaller veins that might anastomose with the major systems, and (c) anatomic variants and pitfalls that may mimic pathologic conditions (space limitations). (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)

  14. Neurosurgical implications of Carney complex.

    Science.gov (United States)

    Watson, J C; Stratakis, C A; Bryant-Greenwood, P K; Koch, C A; Kirschner, L S; Nguyen, T; Carney, J A; Oldfield, E H

    2000-03-01

    The authors present their neurosurgical experience with Carney complex. Carney complex, characterized by spotty skin pigmentation, cardiac myxomas, primary pigmented nodular adrenocortical disease, pituitary tumors, and nerve sheath tumors (NSTs), is a recently described, rare, autosomal-dominant familial syndrome that is relatively unknown to neurosurgeons. Neurosurgery is required to treat pituitary adenomas and a rare NST, the psammomatous melanotic schwannoma (PMS), in patients with Carney complex. Cushing's syndrome, a common component of the complex, is caused by primary pigmented nodular adrenocortical disease and is not secondary to an adrenocorticotropic hormone-secreting pituitary adenoma. The authors reviewed 14 cases of Carney complex, five from the literature and nine from their own experience. Of the 14 pituitary adenomas recognized in association with Carney complex, 12 developed growth hormone (GH) hypersecretion (producing gigantism in two patients and acromegaly in 10), and results of immunohistochemical studies in one of the other two were positive for GH. The association of PMSs with Carney complex was established in 1990. Of the reported tumors, 28% were associated with spinal nerve sheaths. The spinal tumors occurred in adults (mean age 32 years, range 18-49 years) who presented with pain and radiculopathy. These NSTs may be malignant (10%) and, as with the cardiac myxomas, are associated with significant rates of morbidity and mortality. Because of the surgical comorbidity associated with cardiac myxoma and/or Cushing's syndrome, recognition of Carney complex has important implications for perisurgical patient management and family screening. Study of the genetics of Carney complex and of the biological abnormalities associated with the tumors may provide insight into the general pathobiological abnormalities associated with the tumors may provide insight into the general pathobiological features of pituitary adenomas and NSTs.

  15. Implications of U.S. electricity deregulation

    International Nuclear Information System (INIS)

    Gottfried, D.A.

    1997-01-01

    This article is a concise summary of the potential impacts of electric utility deregulation, including the resolution of stranded costs, impact on electricity rates, reformation of utilities, and reshuffling of the nation's fuel portfolio. The national and state implications of the deregulation of the electricity industry are monumental and overwhelming. The implications occur on many fronts, including monetary, quality, reliability, and environmental issues. Many significant changes will occur as a result--some will be positive and others may be more disturbing

  16. Economic and policy implications of pandemic influenza.

    Energy Technology Data Exchange (ETDEWEB)

    Smith, Braeton J.; Starks, Shirley J.; Loose, Verne W.; Brown, Theresa Jean; Warren, Drake E.; Vargas, Vanessa N.

    2010-03-01

    Pandemic influenza has become a serious global health concern; in response, governments around the world have allocated increasing funds to containment of public health threats from this disease. Pandemic influenza is also recognized to have serious economic implications, causing illness and absence that reduces worker productivity and economic output and, through mortality, robs nations of their most valuable assets - human resources. This paper reports two studies that investigate both the short- and long-term economic implications of a pandemic flu outbreak. Policy makers can use the growing number of economic impact estimates to decide how much to spend to combat the pandemic influenza outbreaks. Experts recognize that pandemic influenza has serious global economic implications. The illness causes absenteeism, reduced worker productivity, and therefore reduced economic output. This, combined with the associated mortality rate, robs nations of valuable human resources. Policy makers can use economic impact estimates to decide how much to spend to combat the pandemic influenza outbreaks. In this paper economists examine two studies which investigate both the short- and long-term economic implications of a pandemic influenza outbreak. Resulting policy implications are also discussed. The research uses the Regional Economic Modeling, Inc. (REMI) Policy Insight + Model. This model provides a dynamic, regional, North America Industrial Classification System (NAICS) industry-structured framework for forecasting. It is supported by a population dynamics model that is well-adapted to investigating macro-economic implications of pandemic influenza, including possible demand side effects. The studies reported in this paper exercise all of these capabilities.

  17. Prime implicants in dynamic reliability analysis

    International Nuclear Information System (INIS)

    Tyrväinen, Tero

    2016-01-01

    This paper develops an improved definition of a prime implicant for the needs of dynamic reliability analysis. Reliability analyses often aim to identify minimal cut sets or prime implicants, which are minimal conditions that cause an undesired top event, such as a system's failure. Dynamic reliability analysis methods take the time-dependent behaviour of a system into account. This means that the state of a component can change in the analysed time frame and prime implicants can include the failure of a component at different time points. There can also be dynamic constraints on a component's behaviour. For example, a component can be non-repairable in the given time frame. If a non-repairable component needs to be failed at a certain time point to cause the top event, we consider that the condition that it is failed at the latest possible time point is minimal, and the condition in which it fails earlier non-minimal. The traditional definition of a prime implicant does not account for this type of time-related minimality. In this paper, a new definition is introduced and illustrated using a dynamic flowgraph methodology model. - Highlights: • A new definition of a prime implicant is developed for dynamic reliability analysis. • The new definition takes time-related minimality into account. • The new definition is needed in dynamic flowgraph methodology. • Results can be represented by a smaller number of prime implicants.

  18. Implicative Algebras | Kolluru | Momona Ethiopian Journal of Science

    African Journals Online (AJOL)

    In this paper we introduce the concept of implicative algebras which is an equivalent definition of lattice implication algebra of Xu (1993) and further we prove that it is a regular Autometrized Algebra. Further we remark that the binary operation → on lattice implicative algebra can never be associative. Keywords: Implicative ...

  19. In vitro inhibition activity of polyphenol-rich extracts from Syzygium aromaticum (L.) Merr. & Perry (Clove) buds against carbohydrate hydrolyzing enzymes linked to type 2 diabetes and Fe(2+)-induced lipid peroxidation in rat pancreas.

    Science.gov (United States)

    Adefegha, Stephen Adeniyi; Oboh, Ganiyu

    2012-10-01

    To investigate and compare the inhibitory properties of free and bound phenolic extracts of clove bud against carbohydrate hydrolyzing enzymes (alpha-amylase & alpha-glucosidase) and Fe(2+)-induced lipid peroxidation in rat pancreas in vitro. The free phenolics were extracted with 80% (v/v) acetone, while bound phenolics were extracted from the alkaline and acid hydrolyzed residue with ethyl acetate. Then, the interaction of the extracts with alpha-amylase and alpha-glucosidase was subsequently assessed. Thereafter, the total phenolic contents and antioxidant activities of the extracts were determined. The result revealed that both extracts inhibited alpha-amylase and alpha-glucosidase in a dose-dependent manner. However, the alpha-glucosidase inhibitory activity of the extracts were significantly (Ppancreas in vitro. This study provides a biochemical rationale by which clove elicits therapeutic effect on type 2 diabetes.

  20. ORF Alignment: NC_004307 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

  1. Uranium ore deposits: geology and processing implications

    International Nuclear Information System (INIS)

    Belyk, C.L.

    2010-01-01

    There are fifteen accepted types of uranium ore deposits and at least forty subtypes readily identified around the world. Each deposit type has a unique set of geological characteristics which may also result in unique processing implications. Primary uranium production in the past decade has predominantly come from only a few of these deposit types including: unconformity, sandstone, calcrete, intrusive, breccia complex and volcanic ones. Processing implications can vary widely between and within the different geological models. Some key characteristics of uranium deposits that may have processing implications include: ore grade, uranium and gangue mineralogy, ore hardness, porosity, uranium mineral morphology and carbon content. Processing difficulties may occur as a result of one or more of these characteristics. In order to meet future uranium demand, it is imperative that innovative processing approaches and new technological advances be developed in order that many of the marginally economic traditional and uneconomic non-traditional uranium ore deposits can be exploited. (author)

  2. Risk Implications of Energy Policy Instruments

    DEFF Research Database (Denmark)

    Kitzing, Lena

    papers and a working paper), based on a combination of micro-economic and policy analysis. Financial theory is used for the quantitative analysis of investment problems under uncertainty, including mean-variance portfolio theory, real option analysis, Monte Carlo simulations and time series analysis...... show, both qualitatively and quantitatively, that policy makers cannot neglect risk implications when designing RES support instruments without compromising either on effectiveness or cost-efficiency of energy policy. The central research questions are: how can risk implications of RES policy...... instruments be integrated into policy design, so that the policies provide adequate investment incentives? And can the consideration of such risk implications in policy design make overall energy policy more successful? These questions are answered in seven research papers (four journal papers, two conference...

  3. The economic implications of carbon cycle uncertainty

    International Nuclear Information System (INIS)

    Smith, Steven J.; Edmonds, James A.

    2006-01-01

    This paper examines the implications of uncertainty in the carbon cycle for the cost of stabilizing carbon dioxide concentrations. Using a state of the art integrated assessment model, we find that uncertainty in our understanding of the carbon cycle has significant implications for the costs of a climate stabilization policy, with cost differences denominated in trillions of dollars. Uncertainty in the carbon cycle is equivalent to a change in concentration target of up to 100 ppmv. The impact of carbon cycle uncertainties are smaller than those for climate sensitivity, and broadly comparable to the effect of uncertainty in technology availability

  4. Mainstreaming academic literacy teaching: Implications for how ...

    African Journals Online (AJOL)

    This article draws on research into the role of academic literacies within a range of disciplines and its implications for academic literacy teaching in Higher Education. The study explored ways of transforming current academic literacy teaching practices with a view to developing better synergy between the academic ...

  5. Cassava production and consumption: Health implications

    African Journals Online (AJOL)

    Mr A. O. Akinpelu

    HEALTH IMPLICATIONS OF CASSAVA PRODUCTION AND CONSUMPTION. AKINPELU, A.O. ... huge potential for the export market (Egesi et al., 2007). In urban areas ... farmer's/ household income and economic growth. Stakeholders in ..... dissertation submitted to the school of graduate studies in partial fulfilment of the.

  6. First Planck results and cosmological implications

    CERN Multimedia

    CERN. Geneva

    2013-01-01

    The Planck satellite has measured CMB anisotropies over the full sky with unprecedented sensitivity. The collaboration has released its first CMB temperature maps and cosmological analysis on the 21st of March. I will present a summary of these new CMB results, focusing mainly on their implications for our understanding of the Universe.

  7. Corporal Punishment: Legalities, Realities, and Implications.

    Science.gov (United States)

    Hinchey, Patricia H.

    2003-01-01

    Presents a quiz that will help readers determine the reliability of their own perceptions relating to corporal punishment in schools. Discusses U.S. Courts and corporal punishment, worldwide and nationwide legality, and the realities of corporal punishment in the United States. Discusses implications for what teachers can do to address corporal…

  8. The CHARGE Association: Implications for Teachers.

    Science.gov (United States)

    Jones, Thomas W.; Dunne, Michele T.

    1988-01-01

    CHARGE association is described as a diagnostic label for a group of congenital malformations, including coloboma, heart defects, atresia choanae, retarded postnatal growth/central nervous system defects, genital hypoplasia, and ear deformities. Etiology and characteristics of the CHARGE association are discussed, along with implications for…

  9. Ambiguity and Volatility : Asset Pricing Implications

    NARCIS (Netherlands)

    Pataracchia, B.

    2011-01-01

    Using a simple dynamic consumption-based asset pricing model, this paper explores the implications of a representative investor with smooth ambiguity averse preferences [Klibano¤, Marinacci and Mukerji, Econometrica (2005)] and provides a comparative analysis of risk aversion and ambiguity aversion.

  10. Insecurity and national economic development implications for ...

    African Journals Online (AJOL)

    Insecurity and national economic development implications for Nigeria's vision 20: 2020. ... International Journal of Development and Management Review ... These social menace trigger off a worrisome sense of insecurity that challenge Nigeria's efforts towards national economic development and consequently its vision ...

  11. Cultural Implications of Human Resource Development.

    Science.gov (United States)

    Hiranpruk, Chaiskran

    A discussion of the cultural effects of economic and, by extension, human resource development in Southeast Asia looks at short- and long-term implications. It is suggested that in the short term, increased competition will affect distribution of wealth, which can promote materialism and corruption. The introduction of labor-saving technology may…

  12. Proof complexity of intuitionistic implicational formulas

    Czech Academy of Sciences Publication Activity Database

    Jeřábek, Emil

    2017-01-01

    Roč. 168, č. 1 (2017), s. 150-190 ISSN 0168-0072 EU Projects: European Commission(XE) 339691 - FEALORA Institutional support: RVO:67985840 Keywords : proof complexity * intuitionistic logic * implicational fragment Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.647, year: 2016 http://www.sciencedirect.com/science/article/pii/S0168007216301154

  13. Investigating Teachers' Personal Visions and Beliefs: Implications ...

    African Journals Online (AJOL)

    Investigating Teachers' Personal Visions and Beliefs: Implications for Quality in Language Teacher Education. ... attitude, focus and performance. The growing influence of constructivism in teacher education and the increase in the amount of research into teacher cognition has put the notion of beliefs and vision into central ...

  14. Understanding predation: implications toward forest management

    Science.gov (United States)

    Harvey R. Smith

    1991-01-01

    It is generally accepted that when gypsy moths rest in the litter survival is low due to predation by ground-foraging generalist predators and that predation can maintain these populations indefinitely. Forest Service research on predators of gypsy moth continues to focus on population dynamics, the mechanisms of predation and forest management implications.

  15. Origin of comets - implications for planetary formation

    International Nuclear Information System (INIS)

    Weissman, P.R.; Arizona Univ., Tucson)

    1985-01-01

    Primordial and episodic theories for the origin of comets are discussed. The implications of the former type for the origin of the solar system are considered. Candidate sites for the formation of comets are compared. The possible existence of a massive inner Oort cloud is discussed

  16. African Regional Integration: Implications for Food Security

    NARCIS (Netherlands)

    Dijk, van M.

    2011-01-01

    This report looks at the African regional trade, regional integration agreements (RIAs) and the implications for food security. An overview is presented on the present state of African regional integration and the determinants of regional trade in agriculture and food commodities. In particular the

  17. Environmental conflicts: Key issues and management implications ...

    African Journals Online (AJOL)

    Environmental crises and problems throughout the world are widespread and increasing rapidly. In relation to these concerns, the article discusses the following aspects: people and the environment, environmental conflicts, climate change and environmental conflicts, and management implications. The section on people ...

  18. Social Constructionism and Ethics: Implications for Counseling

    Science.gov (United States)

    Guterman, Jeffrey T.; Rudes, James

    2008-01-01

    Social constructionism is set forth as an epistemological framework from which to establish an ethical base for the field of counseling. The development of the social constructionist movement in counseling is described. Implications of a social constructionist position are considered in relation to ethics. A case example is provided to illustrate…

  19. Implicational Schemata and the Attribution of Morality.

    Science.gov (United States)

    Reeder, Glenn D.; Spores, John M.

    Attribution of a disposition or trait to a person asserts information about the pattern of that person's behavior. Past research has suggested that a moral disposition implies only moral behavior, while an immoral disposition implies both moral and immoral behavior. The effect of these implicational schemata on attributions of morality was…

  20. Climate Change: Generic Implications for Agriculture

    Indian Academy of Sciences (India)

    Climate Change: Generic Implications for Agriculture. Increasing carbon dioxide: Good for most crops. Increase in mean temperature: orter ... Increasing rainfall intensity and dry days- more floods and droughts: Higher production variability. Himalayan glaciers to recede: irrigation in IGP gradually becomes less dependable ...

  1. Current Trends In Educational Technology: Implication On ...

    African Journals Online (AJOL)

    This paper presents the current trends in educational technology and the implication on educational managers in Nigeria. The current trends in the field of educational technology are centred on the influence of information and communication technology on the development of educational management. Various challenges ...

  2. Assisted Reproductive Technologies : Implications for Women's ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Assisted Reproductive Technologies : Implications for Women's Reproductive Rights and Social Citizenship. There is a general perception that assisted reproductive technologies (ARTs) affect only a small number of affluent women in India. However, the ART industry - tied as it is to the vigorously pushed medical tourism ...

  3. Ethical Implications of Digital Imaging in Photojournalism.

    Science.gov (United States)

    Terry, Danal; Lasorsa, Dominic L.

    Arguing that the news media are about to adopt digital imaging systems that will have far-reaching implications for the practice of journalism, this paper discusses how the news media is expected to adopt the new technology and explains why the marriage of journalism and digital imaging will create ethical issues with respect to photo manipulation…

  4. The implications of the German Risk Study

    International Nuclear Information System (INIS)

    Birkhofer, A.; Koeberlein, K.

    1980-01-01

    The methods and results of the German Risk Study published in 1979 are summarized and its implications for reactor safety are discussed. It has led to suggestions that risk analysis should be more widely used for nuclear and other technological systems. It has also identified the need for specific system modifications and confirmed trends in safety research. (author)

  5. Alternative Families and Children: Implications for Education.

    Science.gov (United States)

    Alexander, Jannette; Eiduson, Bernice T.

    1980-01-01

    Since 1973, the UCLA Family Styles Project has studied a sample of nontraditional Caucasian families (single mothers, social contract families, communal families) plus a comparison group of conventional nuclear families. Findings are reported on parents' personal/social values and changes in childrearing practices. Implications for education are…

  6. Managerialism and higher education governance: Implications for ...

    African Journals Online (AJOL)

    This article identifies some of the implications of corporate forms of higher education governance for the management of South African universities. It explores corporate higher educational governance with reference to institutional autonomy incorporating academic freedom. It is the contention of this article that the primary ...

  7. Some Implications of Human-Structure Interaction

    DEFF Research Database (Denmark)

    Pedersen, Lars

    2013-01-01

    On structures, humans may be active which may cause structural vibrations as human activity can excite structural vibration modes. However, humans may also be passive (sitting or standing on the structure). The paper addresses this subject and explores the implications of having passive humans...

  8. Feminist Developmental Theory: Implications for Counseling.

    Science.gov (United States)

    Wastell, Colin A.

    1996-01-01

    Discusses the importance of counseling guided by a life-span development model. Emphasizes that one popular theory should be modified by taking into account a broader understanding of life-span development in terms of commonalities and differences in male and female development. Examines implications with borderline personality disorder and…

  9. Implications of Telecommuting in a Library Environment.

    Science.gov (United States)

    Meglio, Delores

    1991-01-01

    Discussion of telecommuting possibilities focuses on a program at Information Access Company that allows indexers and abstractors to work at home. Employer and employee expectations are discussed, equipment provisions are described, employee benefits are examined, and implications for the library environment are suggested. (LRW)

  10. Globalisation; Its Implications and Consequences for Developing ...

    African Journals Online (AJOL)

    This paper attempts to look at the concept of globalisations and analyse its implications and consequences for developing nations in Africa. It is premised on the general perception that globalisations is a positive and powerful force for the improved material well-being of humankind, that would aid the developing countries ...

  11. Mycobacterial Species Identification and Public Health Implications ...

    African Journals Online (AJOL)

    Mycobacterial Species Identification and Public Health Implications of Tuberculosis Among Nomadic Pastoralists in Three Local Governments of Plateau State, North ... Bovine and human tuberculosis is endemic in Nigeria, and apart from meat inspection at the abattoir, which is not very effective, no control measures are ...

  12. Implications of the behavioral approach to hypnosis.

    Science.gov (United States)

    Starker, S

    1975-07-01

    The findings of behaviorally oriented research regarding the importance of cognitive-motivational variables in hypnosis are examined and some clinical and theoretical implications are explored. Hypnosis seems usefully conceptualized as a complex configuration or gestalt of interacting variables on several different levels, for example, cognitive, motivational, social, physiologic.

  13. Changing business environment: implications for farming

    OpenAIRE

    Malcolm, Bill

    2011-01-01

    The natural, technological, economic, political and social environment in which farmers farm constantly changes. History has lessons about change in agriculture and about farmers coping with change, though the future is unknowable and thus always surprising. The implication for farm operation is to prepare, do not predict.

  14. Tour Guiding Research Insights, Issues and Implications

    DEFF Research Database (Denmark)

    Meged, Jane Widtfeldt

    2017-01-01

    The book Tour guiding research – insights, issues and implications by Betty Weiler and Rosemary Black is a most welcome contribution to the specific research field of guided tours within tourism studies. It sets forth to “give an authoritative state-of-art review of the scholarly literature on tour...

  15. Energy from forests: environmental and wildlife implications

    Energy Technology Data Exchange (ETDEWEB)

    Pimentel, D [Cornell Univ., Ithaca, NY; Chick, S; Vergara, W

    1981-09-01

    This report analyzes the feasibility of utilizing forests in North America as an energy source. The analysis focuses on three major aspects: (1) the technology of converting wood biomass to energy; (2) the potential of wood as a source of energy; and (3) the environmental implications of using forest products for energy. 49 references, 6 tables.

  16. Total Quality Management: Implications for Educational Assessment.

    Science.gov (United States)

    Rankin, Stuart C.

    1992-01-01

    Deming's "System of Profound Knowledge" is even more fundamental than his 14-principle system transformation guide and is based on 4 elements: systems theory, statistical variation, a theory of knowledge, and psychology. Management should revamp total system processes so that quality of product is continually improved. Implications for…

  17. The nuclear and its psychological implications

    International Nuclear Information System (INIS)

    Blanc, D.

    2001-01-01

    From the 13. to 15. january 1977, the S.F.R.P. has organised at Paris, with the patronage of The National Institute of Health and Medical Research, the French Society of Radiology, a colloquium devoted to the nuclear and its psycho-implications sociological. It is a second edition, realised at the demand of the Antoine Beclere Center. (N.C.)

  18. Environmental conflicts: Key issues and management implications

    African Journals Online (AJOL)

    main manifestations and implications of these conflicts are examined in the next section ... with invasive or alien species. This special ... the majority of potential pest species. ... Production of goods: food, durable materials and industrial products, ... well as a remarkably stable life support system that has allowed human.

  19. Clinical Implications Of Childhood Bilingualism | Southwood ...

    African Journals Online (AJOL)

    Stellenbosch Papers in Linguistics Plus. Journal Home · ABOUT THIS JOURNAL · Advanced Search · Current Issue · Archives · Journal Home > Vol 32 (2003) >. Log in or Register to get access to full text downloads. Username, Password, Remember me, or Register. Clinical Implications Of Childhood Bilingualism.

  20. Federal Tax Implications of Charitable Gift Annuities

    Science.gov (United States)

    Teitell, Conrad

    1975-01-01

    Surveys the federal tax implications of "immediate" charitable gift annuities (annuity payments beginning within one year of transfer) and "deferred payment" charitable gift annuities (beginning at a specified date), both of which enable individuals to make a charitable gift, retain a form of life income, and achieve federal…

  1. Transnational Education: Current Developments and Policy Implications

    Science.gov (United States)

    Gu, Jianxin

    2009-01-01

    Ever since the transnational education trend took off since the 1980s, transnational education has come to bearing political, economic and cultural implications. Different approaches have been formulated to achieve specific policy objectives by both importing and exporting countries. Such approaches demonstrate a four dimensional composition,…

  2. Knowledge and Awareness Implication on E-Waste Management ...

    African Journals Online (AJOL)

    Knowledge and Awareness Implication on E-Waste Management among ... and Awareness Implication on E-Waste Management among Nigerian Collegiate ... with e-waste may pose potential threat to human health and the environment.

  3. Chinese Cultural Implications for ERP Implementation

    Directory of Open Access Journals (Sweden)

    Mukesh Srivastava

    2009-05-01

    Full Text Available Implementation of an enterprise resource planning (ERP system in a global environment can be fragmented due to the internal enterprise culture, which is representative of societal culture. In China, this is especially true due to the nationalistic culture of business. The way ERP systems are perceived, treated, and integrated within the business plays a critical role in the success or failure of the implementation. When a Western developed ERP system is implemented in a country where the culture differs greatly from that of the developer, implementation may require localization in order to be successful. In doing so, strategic benefits of ERP systems may be diminished. This research paper looks into the characteristics of Chinese localization by Western vendors and the implications to the Chinese enterprise. Keywords: ERP, Chinese Cultural Implications, Societal Culture, Strategy

  4. Teacher's experiences in PBL: implications for practice

    Science.gov (United States)

    Alves, Anabela C.; Sousa, Rui M.; Fernandes, Sandra; Cardoso, Elisabete; Carvalho, Maria Alice; Figueiredo, Jorge; Pereira, Rui M. S.

    2016-03-01

    Project-Based Learning (PBL) has been implemented in the first year of the Industrial Engineering and Management programme at the University of Minho, Portugal, since 2004/2005. The purpose of this paper is to analyse and discuss teachers' experiences in PBL in this programme and to explore its implications for student learning and for teaching practices in higher education. For data collection, the research method used was written narratives to these teachers, at the end of the PBL semester. Findings suggest that teachers express a positive view of PBL as a learning approach. They identify student motivation and engagement, along with a better understanding of the application of concepts in real-life situations, as important outcomes of the project for students. Besides this, teachers also highlight the importance of the development of transversal skills by students throughout the project. Recommendations for future work and implications for practice will also be discussed.

  5. Clinical implications of contemporary gender theory.

    Science.gov (United States)

    Kulish, Nancy

    2010-04-01

    The current intellectual scene in psychoanalysis is marked by vigorous theoretical controversies about gender. The ideas being debated have important implications for clinical work, which have not been thoroughly explicated or integrated into common practice. These implications include the following: gender can accrue idiosyncratic meanings; gender identity is considered fluid and rigidity of gender identity deemed problematic; gender-related conflicts are typically described as divergent; analysis of superego conflicts related to gender becomes particularly important; and, finally, gender-related biases are seen as inevitable and must be taken into account in the clinical situation. A detailed clinical example illustrates the application of these ideas. While the more dramatic cases related to gender have been more frequent subjects of study, conflicts about gender are everyday occurrences for our patients and deserve further attention.

  6. Cosmological implications of grand unified theories

    International Nuclear Information System (INIS)

    Nanopoulos, D.V.

    1982-01-01

    These lectures, mainly devoted to the cosmological implications of GUTs, also include the essential ingredients of GUTs and some of their important applications to particle physics. Section 1 contains some basic points concerning the structure of the standard strong and electroweak interactions prior to grand unification. A detailed expose of GUTs is attempted in sect. 2, including their basci principles and their consequences for particle physics. The minimal, simplest GUT, SU 5 is analysed in some detail and it will be used throughout these lectures as the GUT prototype. Finally, sect. 3 contains the most important cosmological implications of GUTs, including baryon number generation in the early Universe (in rather lengthy detail), dissipative processes in the very early Universe, grand unified monopoles, etc. (orig./HSI)

  7. Climate Change and Interacting Stressors: Implications for ...

    Science.gov (United States)

    EPA announced the release of the final document, Climate Change and Interacting Stressors: Implications for Coral Reef Management in American Samoa. This report provides a synthesis of information on the interactive effects of climate change and other stressors on the reefs of American Samoa as well as an assessment of potential management responses. This report provides the coral reef managers of American Samoa, as well as other coral reef managers in the Pacific region, with some management options to help enhance the capacity of local coral reefs to resist the negative effects of climate change. This report was designed to take advantage of diverse research and monitoring efforts that are ongoing in American Samoa to: analyze and compile the results of multiple research projects that focus on understanding climate-related stressors and their effects on coral reef ecosystem degradation and recovery; and assess implications for coral reef managment of the combined information, including possible response options.

  8. Automotive fuels - environmental and health implications

    International Nuclear Information System (INIS)

    Lucas, A.G.

    1992-01-01

    This document covers papers presented to the Institute of Petroleum's conference ''Automotive Fuels: Environmental and Health Implications'' held on the 9th October 1991. This wide ranging title meant that topics covered included the biochemistry, pathology and epidemiology of automotive fuel use, combustion science, environmental chemistry and atmospheric modelling. Also discussed are the technology of fuel and engine manufacture, limiting and containing emissions and social and political aspects relating to the use of automotive fuels. (UK)

  9. Civil implications of commercial nuclear power

    International Nuclear Information System (INIS)

    Wilkinson, P.; Gallie, N.

    1985-01-01

    The following aspects are discussed; spent fuel transport by rail, routes and possible accidents; reactors, possible accidents and effects of radioactive releases to the environment; possible effects of sabotage and terrorist attacks; possible hazards from fuel reprocessing plants; radioactive wastes, inventories and possible effects of escape to environment; biological radiation effects; civil war effects and democratic freedoms; the miners' strike and its implications. (U.K.)

  10. Inferring Genetic Ancestry: Opportunities, Challenges, and Implications

    OpenAIRE

    Royal, Charmaine D.; Novembre, John; Fullerton, Stephanie M.; Goldstein, David B.; Long, Jeffrey C.; Bamshad, Michael J.; Clark, Andrew G.

    2010-01-01

    Increasing public interest in direct-to-consumer (DTC) genetic ancestry testing has been accompanied by growing concern about issues ranging from the personal and societal implications of the testing to the scientific validity of ancestry inference. The very concept of “ancestry” is subject to misunderstanding in both the general and scientific communities. What do we mean by ancestry? How exactly is ancestry measured? How far back can such ancestry be defined and by which genetic tools? How ...

  11. ECONOMIC IMPLICATIONS OF INSUFFICIENT HEALTH LITERACY

    OpenAIRE

    Dukić, Nikolina; Arbula Blecich, Andrea; Cerović, Ljerka

    2013-01-01

    The main goal of this paper is to elaborate the importance of health literacy in cost-effective utilization of health care services which influence the efficiency of the entire health care sector. In order to complement the theoretical framework of the economic implications and the circular influence of health literacy on the economy, an empirical analysis was carried out using S–TOFHLA. The results suggest that the patients’ personal characteristics and the accessibil...

  12. Physician-Rating Web Sites: Ethical Implications.

    Science.gov (United States)

    Samora, Julie Balch; Lifchez, Scott D; Blazar, Philip E

    2016-01-01

    To understand the ethical and professional implications of physician behavior changes secondary to online physician-rating Web sites (PRWs). The American Society for Surgery of the Hand (ASSH) Ethics and Professionalism Committee surveyed the ASSH membership regarding PRWs. We sent a 14-item questionnaire to 2,664 active ASSH members who practice in both private and academic settings in the United States. We received 312 responses, a 12% response incidence. More than 65% of the respondents had a slightly or highly unfavorable impression of these Web sites. Only 34% of respondents had ever updated or created a profile for PRWs, although 62% had observed inaccuracies in their profile. Almost 90% of respondents had not made any changes in their practice owing to comments or reviews. One-third of respondents had solicited favorable reviews from patients, and 3% of respondents have paid to improve their ratings. PRWs are going to become more prevalent, and more research is needed to fully understand the implications. There are several ethical implications that PRWs pose to practicing physicians. We contend that it is morally unsound to pay for good reviews. The recourse for physicians when an inaccurate and potentially libelous review has been written is unclear. Some physicians have required patients to sign a waiver preventing them from posting negative comments online. We propose the development of a task force to assess the professional, ethical, and legal implications of PRWs, including working with companies to improve accuracy of information, oversight, and feedback opportunities. It is expected that PRWs will play an increasing role in the future; it is unclear whether there will be a uniform reporting system, or whether these online ratings will influence referral patterns and/or quality improvement. Copyright © 2016 American Society for Surgery of the Hand. Published by Elsevier Inc. All rights reserved.

  13. Bioavailability: implications for science/cleanup policy

    Energy Technology Data Exchange (ETDEWEB)

    Denit, Jeffery; Planicka, J. Gregory

    1998-12-01

    This paper examines the role of bioavailability in risk assessment and cleanup decisions. Bioavailability refers to how chemicals ''behave'' and their ''availability'' to interact with living organisms. Bioavailability has significant implications for exposure risks, cleanup goals, and site costs. Risk to human health and the environment is directly tied to the bioavailability of the chemicals of concern.

  14. 2014 and beyond: implications for displacement

    Directory of Open Access Journals (Sweden)

    Aidan O’Leary

    2014-05-01

    Full Text Available 2014 marks a watershed for Afghanistan, with the withdrawal of the International Security Assistance Force after twelve years, and the very real risks this withdrawal poses to the capacity of the Afghan state to meet the many internal and external challenges faced by the country. These challenges have significant implications for displaced and returning Afghans and for the potential for displacement in the future.

  15. Competitive implications of cross-border banking

    OpenAIRE

    Claessens, Stijn

    2006-01-01

    This paper reviews the recent literature on cross-border banking, with a focus on policy implications. Cross-border banking has increased sharply in recent decades, particularly in the form of entry, and has affected the development of financial systems, access to financial services, and stability. Reviewing the empirical literature, the author finds much, although not uniform, evidence that cross-border banking supports the development of an efficient and stable financial system that offers ...

  16. Market-Driven Management: the Policy Implications

    OpenAIRE

    Bellini, Nicola

    2008-01-01

    The first policy implication of the diffusion of a Market-Driven Management approach is the same as the spreading of globalization, i.e. the obsolescence of industrial policies as traditionally designed and managed by Nation-States with the established toolbox of protectionism and subsidies, picking 'national champions', etc. The growing asymmetry between the physical jurisdiction of political bodies and the global operation space of modern corporations feeds the apparent trend toward company...

  17. Investigating Variations in Gameplay: Cognitive Implications

    Directory of Open Access Journals (Sweden)

    Kamran Sedig

    2015-01-01

    Full Text Available There is increasing interest in creating computer games for learning, problem solving, and other high-level cognitive activities. When investigating whether gameplay is conducive to such activities, gameplay is often studied as a whole. As a result, cognitive implications can be linked to the game but not to its structural elements. Given that gameplay arises from interaction between the player and the game, it is the structural components of interaction that should be investigated to better understand the design of gameplay. Furthermore, minor variations in the components of interaction can have significant cognitive implications. However, such variation has not been studied yet. Thus, to gain a better understanding of how we can study the effect of interaction on the cognitive aspect of gameplay, we conducted an exploratory investigation of two computer games. These games were isomorphic at a deep level and only had one minor difference in the structure of their interaction. Volunteers played these games and discussed the cognitive processes that emerged. In one game, they primarily engaged in planning, but in the other game they primarily engaged in visualizing. This paper discusses the results of our investigation as well as its implications for the design of computer games.

  18. Energy Drinks: Implications for the Breastfeeding Mother.

    Science.gov (United States)

    Thorlton, Janet; Ahmed, Azza; Colby, David A

    2016-01-01

    Breastfeeding women may experience disrupted sleep schedules and be tempted to turn to popular energy drinks to reduce fatigue and enhance alertness, prompting the question: What are the maternal and child health implications for breastfeeding mothers consuming energy drinks? Caffeine and vitamin-rich energy drinks contain a variety of herbal ingredients and vitamins; however, ingredient amounts may not be clearly disclosed on product labels. Interactions between herbal ingredients and caffeine are understudied and not well defined in the literature. Some infants can be sensitive to caffeine and display increased irritability and sleep disturbances when exposed to caffeine from breastmilk. Breastfeeding women who consume energy drinks may be ingesting herbal ingredients that have not undergone scientific evaluation, and if taking prenatal vitamins, may unknowingly exceed the recommended daily intake. Caffeinated products are marketed in newer ways, fueling concerns about health consequences of caffeine exposure. We present implications associated with consumption of caffeine and vitamin-rich energy drinks among breastfeeding women. Product safety, labeling, common ingredients, potential interactions, and clinical implications are discussed. Healthcare providers should encourage breastfeeding women to read product labels for ingredients, carbohydrate content, serving size, and to discourage consumption of energy drinks when breastfeeding and/or taking prenatal vitamins, to avoid potential vitamin toxicity.

  19. Myasthenia Gravis and Its Aeromedical Implications.

    Science.gov (United States)

    Jagathesan, Tania; O'Brien, Michael D

    2017-01-01

    Myasthenia gravis is an autoimmune condition where antibodies form against the acetylcholine receptors at the neuromuscular junction, eventually causing damage to the motor end plate. The clinical features include muscle fatigability as well as ocular, bulbar, and limb weakness, which can have implications on the role of a pilot or air traffic controller. This retrospective study reviewed the United Kingdom Civil Aviation Authority (UK CAA) experience of myasthenia gravis. A search of the United Kingdom Civil Aviation Authority medical records database from 1990 to 2016 identified 11 individuals with a diagnosis of myasthenia gravis. Data were extracted for the class of medical certificate, age at diagnosis, symptoms, acetylcholine receptor antibody status, treatment, the time from diagnosis to loss of medical certification, and the reasons for loss of certification. There were two Class 1 certificate holders (for professional flying) and six Class 2 certificate holders (for private pilot flying) and three air traffic controllers. The mean and median ages at diagnosis were 53 and 57 yr, respectively, with a range of 28-67 yr. The mean and median intervals from diagnosis to loss of certification were 22 and 11 mo, respectively, with a range of 0 to 108 mo. The aeromedical implications of myasthenia gravis, including complications, types of treatment, and functional impact, are considered. A policy for medical certification following a diagnosis of myasthenia gravis is proposed.Jagathesan T, O'Brien MD. Myasthenia gravis and its aeromedical implications. Aerosp Med Hum Perform. 2017; 88(1):30-33.

  20. [Gut microbiota: Description, role and pathophysiologic implications].

    Science.gov (United States)

    Landman, C; Quévrain, E

    2016-06-01

    The human gut contains 10(14) bacteria and many other micro-organisms such as Archaea, viruses and fungi. Studying the gut microbiota showed how this entity participates to gut physiology and beyond this to human health, as a real "hidden organ". In this review, we aimed to bring information about gut microbiota, its structure, its roles and its implication in human pathology. After bacterial colonization in infant, intestinal microbial composition is unique for each individual although more than 95% can be assigned to four major phyla. The use of culture independent methods and more recently the development of high throughput sequencing allowed to depict precisely gut microbiota structure and diversity as well as its alteration in diseases. Gut microbiota is implicated in the maturation of the host immune system and in many fundamental metabolic pathways including sugars and proteins fermentation and metabolism of bile acids and xenobiotics. Imbalance of gut microbial populations or dysbiosis has important functional consequences and is implicated in many digestive diseases (inflammatory bowel diseases, colorectal cancer, etc.) but also in obesity and autism. These observations have led to a surge of studies exploring therapeutics which aims to restore gut microbiota equilibrium such as probiotics or fecal microbiota transplantation. But recent research also investigates biological activity of microbial products which could lead to interesting therapeutics leads. Copyright © 2015 Société Nationale Française de Médecine Interne (SNFMI). Published by Elsevier SAS. All rights reserved.

  1. Bioenergy and its implication for yoga therapy

    Directory of Open Access Journals (Sweden)

    Chathapuram Rajan Narayanan

    2018-01-01

    Full Text Available Electro photonic imaging (EPI is being researched relative to its application for yoga therapy. Three parameters of interest in EPI measurements are as follows: Communication energy (C, integral or normalized area (IA, and Entropy (E. It is important to note that C indicates the total energy of communication for the organ system; IA is an indication of total amount of energy that is available for the organ system while entropy is an indication of the amount of coherence of the energy. Coherence and entropy are inversely related; this means less the entropy, more the coherence and vice versa. Illustrative cases of successful therapy with yoga practices in a wide variety of abnormal conditions are examined, and in every case, entropy is shown to decrease for the affected organ system while communication energy stays within stable range. Relative to the electromagnetic (Rubik and living matrix (Oschman models, it is suggested that the regulation of energy, its coherence in the biological system and interaction with life processes provide the basis for model building and design of health-promoting procedures. Further, this approach is examined relative to yoga theory, traditional medicine systems, and scientific developments in the field of gene expression and neuroplasticity and a generalized model that we call Unified System of Medicine is proposed. This model has direct implications on methods used to control the environmental factors to get robust results from EPI application for therapeutic purposes. Implications for furthering research in yoga therapy using EPI and implications of EPI as a translational technology between traditional medicine systems and modern medicine is discussed.

  2. Reliability implications for commercial Plowshare applications

    Energy Technology Data Exchange (ETDEWEB)

    Brumleve, T D [Plowshare Systems Research Division, Sandia Laboratories, Livermore, CA (United States)

    1970-05-15

    Based on the premise that there will always be a finite chance of a Plowshare project failure, the implications of such a failure are examined. It is suggested that the optimum reliability level will not necessarily be the highest attainable, but rather that which results in minimum average project cost. The type of performance guarantee that the U. S. should provide for nuclear explosive services, the determination of nuclear yield, courses of action to take in the event of failure, and methods to offset remedial costs are discussed. (author)

  3. Stopping Power Measurements: Implications in Nuclear Astrophysics

    International Nuclear Information System (INIS)

    Carmen Angulo; Thierry Delbar; Jean-Sebastien Graulich; Pierre Leleux

    1999-01-01

    The stopping powers of C, CH 2 , Al, Ni, and polyvinylchloride (PVC) for several light ions ( 9 Be, 11 B, 12 C, 14 N, 16 O, 19 F, 20 Ne) with an incident energy of 1 MeV/amu have been measured at the Louvain-la-Neuve cyclotron facility. Stopping powers are given relative to the one for 5.5 MeV 4 He ions with an uncertainty of less than 1%. We compare our results with two widely used semiempirical models and we discuss some implications in nuclear astrophysics studies

  4. Corporate Language and Implications for Organizational Learning

    DEFF Research Database (Denmark)

    Zølner, Mette

    2013-01-01

    This paper explores empirically implications of language use for MNCs’ learning from subsidiaries. Drawing on sociolinguistic literature, the article argues that while employing a single corporate language facilitates quick and direct communication of explicit knowledge, such a language design...... is insufficient to leverage contextually specific and culturally embedded knowledge. This indicates the need for disentangling language and culture. The paper further argues for the need to go beyond national language to consider how prevailing kinds of corporate talk may curb headquarters potential for learning...

  5. Conflicting belief systems: some implications for education

    Directory of Open Access Journals (Sweden)

    E.J. van Niekerk

    1999-03-01

    Full Text Available In this article the conceptions of knowledge and time within Christianity, secular humanism and traditional African religion are juxtaposed. In order to emphasise the vital role o f belief systems in the field of education, some educational implications are inferred from these different conceptions of knowledge and time. The need to create enough space within the South African education system so that parents will be able to send their children to schools where education is conducted according to their particular belief systems is also foregrounded.

  6. Literature and the Sarau: Political Implications

    Directory of Open Access Journals (Sweden)

    Rejane Pivetta de Oliveira

    2017-06-01

    Full Text Available This paper discusses the phenomenon of the cultural gatherings that currently take place in the urban peripheries of Brazil’s larger cities, such as, for example, Sarau da Cooperifa, organized by Sérgio Vaz, and Sarau Suburbano, managed by Alessandro Buzo, both in São Paulo. We attempt to understand how they are organized and the cultural functions they perform in the context of a debate on literature as a cultural practice (Williams 1977; 2015 with aesthetic and political implications (Rancière 1996; 2009.

  7. Machine implications for detectors and physics

    International Nuclear Information System (INIS)

    Tauchi, Toshiaki

    2001-01-01

    Future linear colliders are very different at many aspects because of low repetition rate (5∼200 Hz) and high accelerating gradient (22∼150 MeV/m). For high luminosity, the beam sizes must be squeezed in extremely small region at interaction point (IP). We briefly describe new phenomena at the IP, i.e. beamstrahlung process, creations of e + e - pairs and minijets. We also report machine implications related to the energy spread, beamstrahlung, bunch-train structure, beam polarizations and backgrounds for detectors and physics

  8. Implicational (semilinear) logics III: completeness properties

    Czech Academy of Sciences Publication Activity Database

    Cintula, Petr; Noguera, Carles

    2018-01-01

    Roč. 57, 3-4 (2018), s. 391-420 ISSN 0933-5846 R&D Projects: GA ČR GA13-14654S EU Projects: European Commission(XE) 689176 - SYSMICS Institutional support: RVO:67985807 ; RVO:67985556 Keywords : abstract algebraic logic * protoalgebraic logics * implicational logics * disjunctional logics * semilinear logics * non-classical logics * completeness theorems * rational completeness Subject RIV: BA - General Mathematics; BA - General Mathematics (UTIA-B) OBOR OECD: Computer science s, information science , bioinformathics (hardware development to be 2.2, social aspect to be 5.8) Impact factor: 0.394, year: 2016

  9. Child sexual abuse: consequences and implications.

    Science.gov (United States)

    Hornor, Gail

    2010-01-01

    Sexual abuse is a problem of epidemic proportions in the United States. Given the sheer numbers of sexually abused children, it is vital for pediatric nurse practitioners to understand both short-term and long-term consequences of sexual abuse. Understanding consequences of sexual abuse can assist the pediatric nurse practitioner in anticipating the physical and mental health needs of patients and also may assist in the identification of sexual abuse victims. Sexual abuse typically does not occur in isolation. Implications for practice will be discussed. Copyright © 2010 National Association of Pediatric Nurse Practitioners. Published by Mosby, Inc. All rights reserved.

  10. Cosmological implications of Higgs near-criticality.

    Science.gov (United States)

    Espinosa, J R

    2018-03-06

    The Standard Model electroweak (EW) vacuum, in the absence of new physics below the Planck scale, lies very close to the boundary between stability and metastability, with the last option being the most probable. Several cosmological implications of this so-called 'near-criticality' are discussed. In the metastable vacuum case, the main challenges that the survival of the EW vacuum faces during the evolution of the Universe are analysed. In the stable vacuum case, the possibility of implementing Higgs inflation is critically examined.This article is part of the Theo Murphy meeting issue 'Higgs cosmology'. © 2018 The Author(s).

  11. Reliability implications for commercial Plowshare applications

    International Nuclear Information System (INIS)

    Brumleve, T.D.

    1970-01-01

    Based on the premise that there will always be a finite chance of a Plowshare project failure, the implications of such a failure are examined. It is suggested that the optimum reliability level will not necessarily be the highest attainable, but rather that which results in minimum average project cost. The type of performance guarantee that the U. S. should provide for nuclear explosive services, the determination of nuclear yield, courses of action to take in the event of failure, and methods to offset remedial costs are discussed. (author)

  12. Implications of organizational ethics to healthcare.

    Science.gov (United States)

    Ells, Carolyn; MacDonald, Chris

    2002-01-01

    Organizational ethics is an emerging field concerned with the study and practice of the ethical behaviour of organizations. For effective application to healthcare settings, we argue that organizational ethics requires attention to organizations' special characteristics combined with tools borrowed from the fields of business ethics and bioethics. We identify and discuss several implications of this burgeoning field to healthcare organizations, showing how organizational ethics can facilitate policy making, accountability, self-evaluation, and patient and business perspectives. In our conclusion, we suggest an action plan for healthcare organizations to help them respond appropriately to their ethical responsibilities.

  13. Dust and radon: the legal implications

    International Nuclear Information System (INIS)

    Van Sittert, J.M.O.

    1990-01-01

    It is known that radon gas is not generally considered to be a major problem when encountered in the working environment. However, in its process of decay, a series of four short lived daughter products are formed. In a dust-laden atmosphere these daughter products, which are ionized readily, attach to the particulate material and when inhaled are deposited in the alveoli of the lungs. Therefore, if respirable dust is controlled, the effects of radon daughters will also be minimized. The legal requirements for dust control in South Africa and their implications are discussed. 1 ill

  14. TECHNICAL AND PRACTICAL IMPLICATIONS OF SHORT SELLING

    Directory of Open Access Journals (Sweden)

    Radu BORES

    2016-07-01

    Full Text Available This paper aims at providing insight into some of the implication of short selling for markets, investors as well as regulators. Findings show that capital flows are adversely affected by strict regulation and bans of short sales, while market liquidity, and bid-ask spread can be improved by allowing short selling. Additionally portfolios that incorporate short selling strategies can have lower volatility in returns. The informational content of short sales can provide important feedback for informed investors and lead to better price discovery.

  15. Global Climate Change: National Security Implications

    Science.gov (United States)

    2008-05-01

    it cost to treat asthma in children and other health problems caused by the dirt we were putting out of the smokestacks. It was passed by the...in Latin America for a number of years. General Clark used to say, “In SOUTHCOM, take no credit and expect none.” And I think that was a good rule...damage the health of our children .35 People also need to better understand the implications of globalization. Not all currently appreciate how our

  16. Implicational (semilinear) logics III: completeness properties

    Czech Academy of Sciences Publication Activity Database

    Cintula, Petr; Noguera, Carles

    2018-01-01

    Roč. 57, 3-4 (2018), s. 391-420 ISSN 0933-5846 R&D Projects: GA ČR GA13-14654S EU Projects: European Commission(XE) 689176 - SYSMICS Institutional support: RVO:67985807 ; RVO:67985556 Keywords : abstract algebraic logic * protoalgebraic logics * implicational logics * disjunctional logics * semilinear logics * non-classical logics * completeness theorems * rational completeness Subject RIV: BA - General Mathematics; BA - General Mathematics (UTIA-B) OBOR OECD: Computer sciences, information science, bioinformathics (hardware development to be 2.2, social aspect to be 5.8) Impact factor: 0.394, year: 2016

  17. Gradient dissimilation in Mongolian: Implications for diachrony

    DEFF Research Database (Denmark)

    Jatteau, Adèle; Hejná, Michaela

    2018-01-01

    This paper explores the implications of ‘gradient dissimilation’ (Jatteau & Hejná 2016) for the diachronic implementation of dissimilation. Since this sound change is usually considered as typically sporadic, lexically regular cases should result from lexical diffusion. In contrast with this ass......This paper explores the implications of ‘gradient dissimilation’ (Jatteau & Hejná 2016) for the diachronic implementation of dissimilation. Since this sound change is usually considered as typically sporadic, lexically regular cases should result from lexical diffusion. In contrast...... with this assumption, we explore the hypothesis that gradient dissimilation may represent the phonetic precursor of completed, regular dissimilatory processes. Such cases of dissimilation might then be reanalysed as Neogrammarian types of change. To assess this question, we gather and analyse new data from Halh...... Mongolian, a language reported to show gradient dissimilation (Svantesson et al. 2005), and compare it to two completed patterns of dissimilation reconstructed within the Mongolic family: Mongolian Chahar and Monguor. The results suggest that the gradient dissimilation in Halh may represent the phonetic...

  18. Forensic implications: adolescent sexting and cyberbullying.

    Science.gov (United States)

    Korenis, Panagiota; Billick, Stephen Bates

    2014-03-01

    Adolescence is marked by establishing a sense of identity, core values, a sense of one's relationship to the outside world and heightened peer relationships. In addition, there is also risk taking, impulsivity, self exploration and dramatic increase in sexuality. The dramatic increase in the use of cell phones and the Internet has additional social implications of sexting and cyberbullying. Sexting refers to the practice of sending sexually explicit material including language or images to another person's cell phone. Cyberbullying refers to the use of this technology to socially exclude, threaten, insult or shame another person. Studies of cell phone use in the 21st century report well over 50% of adolescents use them and that text messaging is the communication mode of choice. Studies also show a significant percentage of adolescents send and receive sex messaging, both text and images. This paper will review this expanding literature. Various motivations for sexting will also be reviewed. This new technology presents many dangers for adolescents. The legal implications are extensive and psychiatrists may play an important role in evaluation of some of these adolescents in the legal context. This paper will also make suggestions on future remedies and preventative actions.

  19. Global implications of China's healthcare reform.

    Science.gov (United States)

    Yan, Fei; Tang, Shenglan; Zhang, Jian

    2016-01-01

    The ongoing healthcare reform in China has a powerful spillover effect beyond the health sector and the borders of China. A successful completion of the Chinese reform will offer a new model for social justice development, shift the global economy toward sustainability and create a new hub for science and technology in medical and health science. However, reforming the healthcare system in the most populated country is a daunting task. China will not live up to its promise, and all the potentials may end with hype not hope if coherent national strategies are not constructed and state-of-the-art navigation is not achieved with staggering domestic and global challenges. The cost of failure will be immensely high, socioeconomic costs for Chinese and an opportunity cost for the world as a whole. A full appreciation of the global implications of China's healthcare reform is crucial in keeping China receptive toward good practices evidence-approved elsewhere and open minded to fulfill its international obligations. More critically, the appreciation yields constructive engagements from global community toward a joint development and global prosperity. The current report provides a multiple disciplinary assessment on the global implications of the healthcare reform in China. Copyright © 2014 John Wiley & Sons, Ltd.

  20. Generic implications of the Chernobyl accident

    International Nuclear Information System (INIS)

    Sege, G.

    1989-01-01

    The US Nuclear Regulatory Commission (NRC) staff's assessment of the generic implications of the Chernobyl accident led to the conclusion that no immediate changes in the NRC's regulations regarding design or operation of US commercial reactors are needed. However, further consideration of certain issues was recommended. This paper discusses those issues and the studies being addressed to them. Although 24 tasks relating to light water reactor issues are identified in the Chernobyl follow-up research program, only four are new initiatives originating from Chernobyl implications. The remainder are limited modifications of ongoing programs designed to ensure that those programs duly reflect any lessons that may be drawn from the Chernobyl experience. The four new study tasks discussed include a study of reactivity transients, to reconfirm or bring into question the adequacy of potential reactivity accident sequences hitherto selected as a basis for design approvals; analysis of risk at low power and shutdown; a study of procedure violations; and a review of current NRC testing requirements for balance of benefits and risks. Also discussed, briefly, are adjustments to ongoing studies in the areas of operational controls, design, containment, emergency planning, and severe accident phenomena

  1. Transformation of University Organizations:Leadership and Managerial Implications

    Directory of Open Access Journals (Sweden)

    Cemil ULUKAN

    2005-10-01

    Full Text Available Transformation of University Organizations:Leadership and Managerial Implications Cemil ULUKAN, Ph.D Anadolu UniversityOpen Education Faculty Eskisehir-TURKEYABSTRACT Technology and globalization are forcing higher education institutions to transform themselves. This paper aims to contribute to a better understanding the leadership and managerial implications of recent developments for higher education. Reviewing unique characteristics and the fundamental changes shaping higher education, the paper examines the need for organizational transformation and the major managerial implications.

  2. Public health implications of emerging zoonoses.

    Science.gov (United States)

    Meslin, F X; Stöhr, K; Heymann, D

    2000-04-01

    Many new, emerging and re-emerging diseases of humans are caused by pathogens which originate from animals or products of animal origin. A wide variety of animal species, both domestic and wild, act as reservoirs for these pathogens, which may be viruses, bacteria or parasites. Given the extensive distribution of the animal species affected, the effective surveillance, prevention and control of zoonotic diseases pose a significant challenge. The authors describe the direct and indirect implications for public health of emerging zoonoses. Direct implications are defined as the consequences for human health in terms of morbidity and mortality. Indirect implications are defined as the effect of the influence of emerging zoonotic disease on two groups of people, namely: health professionals and the general public. Professional assessment of the importance of these diseases influences public health practices and structures, the identification of themes for research and allocation of resources at both national and international levels. The perception of the general public regarding the risks involved considerably influences policy-making in the health field. Extensive outbreaks of zoonotic disease are not uncommon, especially as the disease is often not recognised as zoonotic at the outset and may spread undetected for some time. However, in many instances, the direct impact on health of these new, emerging or re-emerging zoonoses has been small compared to that of other infectious diseases affecting humans. To illustrate the tremendous indirect impact of emerging zoonotic diseases on public health policy and structures and on public perception of health risks, the authors provide a number of examples, including that of the Ebola virus, avian influenza, monkeypox and bovine spongiform encephalopathy. Recent epidemics of these diseases have served as a reminder of the existence of infectious diseases and of the capacity of these diseases to occur unexpectedly in new

  3. Epigenetics: relevance and implications for public health.

    Science.gov (United States)

    Rozek, Laura S; Dolinoy, Dana C; Sartor, Maureen A; Omenn, Gilbert S

    2014-01-01

    Improved understanding of the multilayer regulation of the human genome has led to a greater appreciation of environmental, nutritional, and epigenetic risk factors for human disease. Chromatin remodeling, histone tail modifications, and DNA methylation are dynamic epigenetic changes responsive to external stimuli. Careful interpretation can provide insights for actionable public health through collaboration between population and basic scientists and through integration of multiple data sources. We review key findings in environmental epigenetics both in human population studies and in animal models, and discuss the implications of these results for risk assessment and public health protection. To ultimately succeed in identifying epigenetic mechanisms leading to complex phenotypes and disease, researchers must integrate the various animal models, human clinical approaches, and human population approaches while paying attention to life-stage sensitivity, to generate effective prescriptions for human health evaluation and disease prevention.

  4. Income inequality: Implications and relevant economic policies

    Directory of Open Access Journals (Sweden)

    Arestis Philip

    2016-01-01

    Full Text Available The aim of this contribution is to discuss closely the implications of income inequality and the economic policies to tackle it, especially so in view of inequality being one of the main causes of the 2007/2008 international financial crisis and the “great recession” that subsequently emerged. Wealth inequality is also important in this respect, but the focus is on income inequality. Ever since the financial crisis and the subsequent “great recession”, inequality of income, and wealth, has increased and the demand for economic policy initiatives to produce a more equal distribution of income and wealth has become more urgent. Such reduction would help to increase the level of economic activity as has been demonstrated again more recently. A number of economic policy initiatives for this purpose will be the focus of this contribution.

  5. Implications of global warming on human health

    International Nuclear Information System (INIS)

    Singh, R.K.; Syam, P.V.S.

    1997-01-01

    Due to the build up of green house gases in atmosphere, less heat escapes through the atmosphere promoting global warming. This may result in world wide droughts, sea-level rise inundating islands and coastal countries, cataclysmic hurricanes etc. Human health as a result of these changes, will be affected both physiologically and psychologically. Physiological effects may be more pronounced in cases occurring due to changes in rainfall and temperature patterns, food production amounts, water availability, etc. Psychological impact may be more in cases of catastrophes like floods, hurricanes or famine. In this paper, an attempt has been made to highlight the implications of global warming on human health due to temperature change. Food production changes and ultra-violet radiation effects and cataclysmic disaster effects. (author)

  6. Gestalt theory: implications for radiology education.

    Science.gov (United States)

    Koontz, Nicholas A; Gunderman, Richard B

    2008-05-01

    The Gestalt theory of modern psychology is grounded in the ideas that holistic rather than atomistic approaches are necessary to understand the mind, and that the mental whole is greater than the sum of its component parts. Although the Gestalt school fell out of favor due to its descriptive rather than explanatory nature, it permanently changed our understanding of perception. For the radiologist, such fundamental Gestalt concepts as figure-ground relationships and a variety of "grouping principles" (the laws of closure, proximity, similarity, common region, continuity, and symmetry) are ubiquitous in daily work, not to mention in art and personal life. By considering the applications of these principles and the stereotypical ways in which humans perceive visual stimuli, a radiology learner may incur fewer errors of diagnosis. This article serves to introduce several important principles of Gestalt theory, identify examples of these principles in widely recognizable fine art, and highlight their implications for radiology education.

  7. Environmental implications of China's WTO accession

    International Nuclear Information System (INIS)

    Vennemo, Haakon; Aunan, Kristin; He, Jianwu; Hu, Tao; Li, Shantong; Rypdal, Kristin

    2005-01-01

    China's accession to the WTO in 2001 completed the country's entry into the global economy. We investigate environmental implications of WTO-accession. There are several hypotheses in this area: The scale hypothesis says that production is scaled up and in turn, pollution increases. The composition hypothesis says that composition of industries changes and pollution reflects the new composition. The technique hypothesis says that production methods become cleaner and pollution decreases. We analyze the relative strength of the hypotheses by means of an environmental CGE-model, and in the case of air pollution find support for a composition effect in favor of clean industries. Thanks to the composition effect, emissions to air of greenhouse gases fall. Emissions of particles and SO2 also fall, but emissions of NOx and VOC rise. Since particle and SO2-emissions fall we estimate that public health improves (author)

  8. Policy Implications of Air Quality Research

    Science.gov (United States)

    Sheinbaum, C.

    2004-12-01

    While an integrated assessment approach will be required to achieve and sustain improvements in the air quality of Mexico City Metropolitan Area's (MCMA), policy strategies must be based on a solid understanding of the pollutant emissions and atmospheric processes that lead to unacceptable levels of air pollution. The required level of understanding can only be achieved by comprehensive atmospheric measurements followed by a coordinated atmospheric modeling program. The innovative, two-phase atmospheric measurement program, which was a collaborative effort between Massachusetts Institute of Technology and the Mexican Metropolitan Environmental Commission, with exploratory measurements in February 2002 and extensive measurements from late March through early May of 2003, was an important step towards meeting these requirements. Although the extensive data sets from the two measurement programs are still being analyzed by the investigators, their preliminary analysis efforts have yielded important insights into the nature and extent of air pollution problem in the MCMA, which in turn will have important policy implications.

  9. Tumor dedifferentiation: diagnostic and therapeutic implications

    Directory of Open Access Journals (Sweden)

    Abhimanyu Jha

    2017-09-01

    Full Text Available Some of the neoplasm especially malignant tumors are notorious in masquerading their cell of origin because of additional mutations which drives them to differentiate into unusual phenotype. This is implicated to a phenomenon of tumor dedifferentiation which can mislead into inappropriate categorization and therapy. Dedifferentiation is well recognized in sarcomas such as liposarcoma, chondrosarcoma and MPNST. However, it can also develop in carcinomas, melanomas and lymphomas at initial diagnosis, following therapy or at recurrence.  The phenomenon has been reported in both primary tumors as well as at metastatic foci. A correct and early pathological identification of this phenomenon might profoundly help in guiding appropriate therapy. Clinical and radiological findings, immunohistochemistry and genetic analysis are often required for correct lineage identification of these tumors.

  10. Hyperspectral forest monitoring and imaging implications

    Science.gov (United States)

    Goodenough, David G.; Bannon, David

    2014-05-01

    The forest biome is vital to the health of the earth. Canada and the United States have a combined forest area of 4.68 Mkm2. The monitoring of these forest resources has become increasingly complex. Hyperspectral remote sensing can provide a wealth of improved information products to land managers to make more informed decisions. Research in this area has demonstrated that hyperspectral remote sensing can be used to create more accurate products for forest inventory (major forest species), forest health, foliar biochemistry, biomass, and aboveground carbon. Operationally there is a requirement for a mix of airborne and satellite approaches. This paper surveys some methods and results in hyperspectral sensing of forests and discusses the implications for space initiatives with hyperspectral sensing

  11. IPAD products and implications for the future

    Science.gov (United States)

    Miller, R. E., Jr.

    1980-01-01

    The betterment of productivity through the improvement of product quality and the reduction of cost is addressed. Productivity improvement is sought through (1) reduction of required resources, (2) improved ask results through the management of such saved resources, (3) reduced downstream costs through manufacturing-oriented engineering, and (4) lowered risks in the making of product design decisions. The IPAD products are both hardware architecture and software distributed over a number of heterogeneous computers in this architecture. These IPAD products are described in terms of capability and engineering usefulness. The future implications of state-of-the-art IPAD hardware and software architectures are discussed in terms of their impact on the functions and on structures of organizations concerned with creating products.

  12. [Mental Imagery: Neurophysiology and Implications in Psychiatry].

    Science.gov (United States)

    Martínez, Nathalie Tamayo

    2014-03-01

    To provide an explanation about what mental imagery is and some implications in psychiatry. This article is a narrative literature review. There are many terms in which imagery representations are described in different fields of research. They are defined as perceptions in the absence of an external stimulus, and can be created in any sensory modality. Their neurophysiological substrate is almost the same as the one activated during sensory perception. There is no unified theory about its function, but it is possibly the way that our brain uses and manipulates the information to respond to the environment. Mental imagery is an everyday phenomenon, and when it occurs in specific patterns it can be a sign of mental disorders. Copyright © 2014 Asociación Colombiana de Psiquiatría. Publicado por Elsevier España. All rights reserved.

  13. Cognitive implications of facilitating echoic persistence.

    Science.gov (United States)

    Baldwin, Carryl L

    2007-06-01

    Seventeen participants performed a tone-pattern-matching task at different presentation levels while concurrently engaged in a simulated-driving task. Presentation levels of 60, 65, and 70 dBC (SPL) were combined factorially with tone-matching delays of 2, 3, and 4 sec. Intensity had no effect on performance in single-task conditions and short-delay conditions. However, when the participants were engaged concurrently in the driving task, a significant interaction between presentation level and delay was observed. In the longest delay condition, the participants performed the tone-pattern-matching task more efficiently (more quickly and without additional errors) as presentation intensity increased. These findings demonstrate the interaction between sensory and cognitive processes and point to a direct-intensity relationship where intensity affects the persistence of echoic memory. Implications for facilitating auditory processing and improving auditory interfaces in complex systems (i.e., transportation environments), particularly for older and hearing-impaired listeners, are discussed.

  14. Regulated necrosis and its implications in toxicology.

    Science.gov (United States)

    Aki, Toshihiko; Funakoshi, Takeshi; Uemura, Koichi

    2015-07-03

    Recent research developments have revealed that caspase-dependent apoptosis is not the sole form of regulated cell death. Caspase-independent, but genetically regulated, forms of cell death include pyroptosis, necroptosis, parthanatos, and the recently discovered ferroptosis and autosis. Importantly, regulated necrosis can be modulated by small molecule inhibitors/activators, confirming the cell autonomous mechanism of these forms of cell death. The success of small molecule-mediated manipulation of regulated necrosis has produced great changes in the field of cell death research, and has also brought about significant changes in the fields of pharmacology as well as toxicology. In this review, we intend to summarize the modes of regulated cell death other than apoptosis, and discuss their implications in toxicology. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  15. Implications of the Human Genome Project

    Energy Technology Data Exchange (ETDEWEB)

    Kitcher, P.

    1998-11-01

    The Human Genome Project (HGP), launched in 1991, aims to map and sequence the human genome by 2006. During the fifteen-year life of the project, it is projected that $3 billion in federal funds will be allocated to it. The ultimate aims of spending this money are to analyze the structure of human DNA, to identify all human genes, to recognize the functions of those genes, and to prepare for the biology and medicine of the twenty-first century. The following summary examines some of the implications of the program, concentrating on its scientific import and on the ethical and social problems that it raises. Its aim is to expose principles that might be used in applying the information which the HGP will generate. There is no attempt here to translate the principles into detailed proposals for legislation. Arguments and discussion can be found in the full report, but, like this summary, that report does not contain any legislative proposals.

  16. Projections of energy requirements and their implications

    International Nuclear Information System (INIS)

    Hogroian, P.

    1978-01-01

    The subject is covered in sections, entitled as shown. Numerical data are indicated in parenthesis. The record of nuclear power forecasting (estimates of the growth of world nuclear power, penetration of the electric power market by nuclear power); brief review of energy forecasting techniques and problems; some views of future world energy demand (estimates of world primary energy requirements); possible allocations of energy resources to needs (allocation of resources (oil, oil from tar sands, shale, natural gas, coal, coal to gasification, hydroelectricity, renewable resources, nuclear) to the world's primary energy needs in the year 2000); observations on the adequacy of energy resources; implications for nuclear energy (postulated growth of world nuclear power, annual fuel cycle requirements of the world, annual uranium requirements of the world). (U.K.)

  17. Glutamate in schizophrenia: clinical and research implications.

    Science.gov (United States)

    Goff, D C; Wine, L

    1997-10-30

    The excitatory amino acids, glutamate and aspartate, are of interest to schizophrenia research because of their roles in neurodevelopment, neurotoxicity and neurotransmission. Recent evidence suggests that densities of glutamatergic receptors and the ratios of subunits composing these receptors may be altered in schizophrenia, although it is unclear whether these changes are primary or compensatory. Agents acting at the phencyclidine binding site of the NMDA receptor produce symptoms of schizophrenia in normal subjects, and precipitate relapse in patients with schizophrenia. The improvement of negative symptoms with agents acting at the glycine modulatory site of the NMDA receptor, as well as preliminary evidence that clozapine may differ from conventional neuroleptic agents in its effects on glutamatergic systems, suggest that clinical implications may follow from this model. While geriatric patients may be at increased risk for glutamate-mediated neurotoxicity, very little is known about the specific relevance of this model to geriatric patients with schizophrenia.

  18. Life Sciences Implications of Lunar Surface Operations

    Science.gov (United States)

    Chappell, Steven P.; Norcross, Jason R.; Abercromby, Andrew F.; Gernhardt, Michael L.

    2010-01-01

    The purpose of this report is to document preliminary, predicted, life sciences implications of expected operational concepts for lunar surface extravehicular activity (EVA). Algorithms developed through simulation and testing in lunar analog environments were used to predict crew metabolic rates and ground reaction forces experienced during lunar EVA. Subsequently, the total metabolic energy consumption, the daily bone load stimulus, total oxygen needed, and other variables were calculated and provided to Human Research Program and Exploration Systems Mission Directorate stakeholders. To provide context to the modeling, the report includes an overview of some scenarios that have been considered. Concise descriptions of the analog testing and development of the algorithms are also provided. This document may be updated to remain current with evolving lunar or other planetary surface operations, assumptions and concepts, and to provide additional data and analyses collected during the ongoing analog research program.

  19. The antecedents and implications of interracial anxiety.

    Science.gov (United States)

    Plant, E Ashby; Devine, Patricia G

    2003-06-01

    Drawing on previous theorizing from both the prejudice and social anxiety literatures, a model of the antecedents and implications of intergroup anxiety is offered. It is argued that a lack of positive previous experiences with outgroup members creates negative expectancies about interracial interactions, which result in intergroup anxiety. This anxiety is posited to result in heightened hostility toward outgroup members and a desire to avoid interacting with outgroup members. Study 1 examined White participants' responses to interacting with Black people using a range of self-report measures; the associations between these responses supported the relationships outlined in the model. Study 2 explored White participants' responses to an anticipated interaction with a Black person or a White person. The findings revealed that high levels of anxiety about an interaction with a Black person, but not a White person, were associated with a lower likelihood of returning for the interaction.

  20. Waste management implications of concentrating slimes

    International Nuclear Information System (INIS)

    1988-02-01

    The anticipated increase in demand for sand-size tailings from the uranium industry suggests that the fine-grained or 'slime' fraction will require special attention for disposal. The Atomic Energy Control Board (AECB) required information on the behaviour and environmental significance of the fine-grained tailings fraction in disposal facilities. Beak Consultants and Golder Associates were contracted to review the significant characteristics of slimes disposal and prepare a report on the physical and chemical characteristics of fine-grained tailings (Phase 1). This report (Phase 2) presents a summary of disposal and management practices for slimes and outlines potential concerns related to these practices. The report also presents an approach to disposal planning and the implications of available and potential management techniques. Experience with the disposal of uranium slimes is scarce and, therefore, relevant information was borrowed from the other mining sectors to predict the consequences of various disposal scenarios

  1. Nursing implications for Hepatic arterial perfusion scintigraphy

    International Nuclear Information System (INIS)

    Ellender, R.

    1999-01-01

    Nurses working in Nuclear Medicine assist in Hepatic Artery Catheter (HAC) perfusion studies. This scan is not widely performed in Australia, the St George hospital for example performs approximately five per year. The purpose of this article is firstly to review the indications and rationale of HAC patency studies. Secondly, this article will stress the clinical implications for the Nuclear Medicine Nurse during this study. Emphasis will be placed on the importance of patient education during the procedure. A brief overview of hepatic anatomy and the radiopharmaceuticals administered during the scan is discussed. Finally, a step by step protocol is presented to show how the perfusion/ shunt study is performed. Copyright (1999) The Australian and New Zealand Society of Nuclear Medicine Inc

  2. Destination image: Origins, Developments and Implications

    Directory of Open Access Journals (Sweden)

    Sérgio Dominique Ferreira Lopes

    2011-04-01

    Full Text Available Over the last few decades, tourism has become one of the main sectors of the global economy, not only because of its contribution to the Gross Domestic Product (GDP of different countries, but also because of the employment it generates. Since 2009, however, the results of tourism have been severely affected by the economic and financial crisis and it is now essential to analyze the key elements of tourist consumer behavior. In this context, the image that a destination transmits to the market becomes one of the elements which influence tourists the most when choosing a tourist destination. The authors therefore aim to identify the main elements that characterize the image of a tourist destination, as well as their implications for the management of tourist destinations.

  3. Prescription drug abuse: problem, policies, and implications.

    Science.gov (United States)

    Phillips, Janice

    2013-01-01

    This article provides an overview on prescription drug abuse and highlights a number of related legislative bills introduced during the 112th Congress in response to this growing epidemic. Prescription drug abuse has emerged as the nation's fastest growing drug problem. Although prescription drugs have been used effectively and appropriately for decades, deaths from prescription pain medicine in particular have reached epidemic proportions. Bills related to prescription drug abuse introduced during the 112th Congress focus on strengthening provider and consumer education, tracking and monitoring prescription drug abuse, improving data collection on drug overdose fatalities, combating fraud and abuse in Medicare and Medicaid programs, reclassifying drugs to make them more difficult to prescribe and obtain, and enforcing stricter penalties for individuals who operate scam pain clinics and sell pain pills illegitimately. This article underscores the importance of a multifaceted approach to combating prescription drug abuse and concludes with implications for nursing. Copyright © 2013. Published by Mosby, Inc.

  4. Exploring Forensic Implications of the Fusion Drive

    Directory of Open Access Journals (Sweden)

    Shruti Gupta

    2014-09-01

    Full Text Available This paper explores the forensic implications of Apple's Fusion Drive. The Fusion Drive is an example of auto-tiered storage. It uses a combination of a flash drive and a magnetic drive. Data is moved between the drives automatically to maximize system performance. This is different from traditional caches because data is moved and not simply copied. The research included understanding the drive structure, populating the drive, and then accessing data in a controlled setting to observe data migration strategies. It was observed that all the data is first written to the flash drive with 4 GB of free space always maintained. If data on the magnetic drive is frequently accessed, it is promoted to the flash drive while demoting other information. Data is moved at a block-level and not a file-level. The Fusion Drive didn't alter the timestamps of files with data migration.

  5. Rumen bypass nutrients: Manipulation and implications

    International Nuclear Information System (INIS)

    Leng, R.A.; Nolan, J.V.; Preston, T.R.

    1983-01-01

    The feeds available for ruminants in developing countries are either agro-industrial by-products or specially grown forage crops. Many of these feeds are low in protein and require supplementation with non-protein N (NPN) to maintain efficient rumen function and digestibility. The principles for utilizing high energy, low protein feeds by ruminants are discussed in relation to the supply of NPN, the establishment of efficient rumen function, maximizing feed intake by means of supplements, and increasing total energy and protein intake by using supplements which bypass the rumen. To illustrate it the application of these principles to feeding systems based on molasses, chopped whole sugar cane and derinded sugar cane is discussed. The implications of the principles in increasing the feeding value of straw are also discussed. (author)

  6. Low energy implications of minimal superstring unification

    International Nuclear Information System (INIS)

    Khalil, S.; Vissani, F.; Masiero, A.

    1995-11-01

    We study the phenomenological implications of effective supergravities based on string vacua with spontaneously broken N =1 supersymmetry by dilation and moduli F-terms. We further require Minimal String Unification, namely that large string threshold corrections ensure the correct unification of the gauge couplings at the grand unification scale. The whole supersymmetric mass spectrum turns out to be determined in terms of only two independent parameters, the dilaton-moduli mixing angle and the gravitino mass. In particular we discuss the region of the parameter space where at least one superpartner is ''visible'' at LEPII. We find that the most likely candidates are the scalar partner of the right-handed electron and the lightest chargino, with interesting correlations between their masses and with the mass of the lightest higgs. We show how discovering SUSY particles at LEPII might rather sharply discriminate between scenarios with pure dilaton SUSY breaking and mixed dilaton-moduli breaking. (author). 10 refs, 7 figs

  7. Pharmacologic Implications of Marijuana Use During Pregnancy.

    Science.gov (United States)

    Fantasia, Heidi Collins

    Marijuana is the most commonly used recreational drug in the United States, including among women of childbearing age and women who are pregnant. Changing legal statutes that allow for the use of medical marijuana and the decriminalization of marijuana for personal use reflect more permissive societal views on the use of this drug. Active compounds in marijuana cross the placenta rapidly and are excreted in breast milk. Results of studies of the effects of marijuana on a developing fetus and neonate are conflicting, but researchers have identified chronic marijuana exposure as a risk factor for preterm birth and small-for-gestational-age infants. This article reviews the pharmacology of marijuana and discusses implications for nurses who work with women of childbearing age. © 2017 AWHONN, the Association of Women’s Health, Obstetric and Neonatal Nurses.

  8. Implications of inherent safe nuclear power system

    International Nuclear Information System (INIS)

    Song, Yo-Taik

    1987-01-01

    The safety of present day nuclear power reactors and research reactors depends on a combination of design features of passive and active systems, and the alert judgement of their operators. A few inherently safe designs of nuclear reactors for power plants are currently under development. In these designs, the passive systems are emphasized, and the active systems are minimized. Also efforts are made to eliminate the potential for human failures that initiate the series of accidents. If a major system fails in these designs, the core is flooded automatically with coolants that flow by gravity, not by mechanical pumps or electromagnetic actuators. Depending on the choice of the coolants--water, liquid metal and helium gas--there are three principal types of inherently safe reactors. In this paper, these inherently safe reactor designs are reviewed and their implications are discussed. Further, future perspectives of their acceptance by nuclear industries are discussed. (author)

  9. Implications of LHCb measurements and future prospects

    CERN Document Server

    Aaij, R; Adametz, A; Adeva, B; Adinolfi, M; Adrover, C; Affolder, A; Ajaltouni, Z; Albrecht, J; Alessio, F; Alexander, M; Ali, S; Alkhazov, G; Alvarez Cartelle, P; Alves Jr, A A; Amato, S; Amhis, Y; Anderlini, L; Anderson, J; Andreassen, R; Anelli, M; Appleby, R B; Aquines Gutierrez, O; Archilli, F; Artamonov, A; Artuso, M; Aslanides, E; Auriemma, G; Bachmann, S; Back, J J; Baesso, C; Baldini, W; Band, H; Barlow, R J; Barschel, C; Barsuk, S; Barter, W; Bates, A; Bauer, Th; Bay, A; Beddow, J; Bediaga, I; Beigbeder-Beau, C; Belogurov, S; Belous, K; Belyaev, I; Ben-Haim, E; Benayoun, M; Bencivenni, G; Benson, S; Benton, J; Berezhnoy, A; Bernard, F; Bernet, R; Bettler, M -O; van Beuzekom, M; van Beveren, V; Bien, A; Bifani, S; Bird, T; Bizzeti, A; Bjørnstad, P M; Blake, T; Blanc, F; Blanks, C; Blouw, J; Blusk, S; Bobrov, A; Bocci, V; Bochin, B; Boer Rookhuizen, H; Bogdanova, G; Bonaccorsi, E; Bondar, A; Bondar, N; Bonivento, W; Borghi, S; Borgia, A; Bowcock, T J V; Bowen, E; Bozzi, C; Brambach, T; van den Brand, J; Brarda, L; Bressieux, J; Brett, D; Britsch, M; Britton, T; Brook, N H; Brown, H; Büchler-Germann, A; Burducea, I; Bursche, A; Buytaert, J; Cacérès, T; Cachemiche, J -P; Cadeddu, S; Callot, O; Calvi, M; Calvo Gomez, M; Camboni, A; Campana, P; Carbone, A; Carboni, G; Cardinale, R; Cardini, A; Carranza-Mejia, H; Carson, L; Carvalho Akiba, K; Casajus Ramo, A; Casse, G; Cattaneo, M; Cauet, Ch; Ceelie, L; Chadaj, B; Chanal, H; Charles, M; Charlet, D; Charpentier, Ph; Chebbi, M; Chen, P; Chiapolini, N; Chrzaszcz, M; Ciambrone, P; Ciba, K; Cid Vidal, X; Ciezarek, G; Clarke, P E L; Clemencic, M; Cliff, H V; Closier, J; Coca, C; Coco, V; Cogan, J; Cogneras, E; Collins, P; Comerma-Montells, A; Contu, A; Cook, A; Coombes, M; Corajod, B; Corti, G; Couturier, B; Cowan, G A; Craik, D; Cunliffe, S; Currie, R; D'Ambrosio, C; D'Antone, I; David, P; David, P N Y; De Bonis, I; De Bruyn, K; De Capua, S; De Cian, Michel; De Groen, P; De Miranda, J M; De Paula, L; De Simone, P; Decamp, D; Deckenhoff, M; Decreuse, G; Degaudenzi, H; Del Buono, L; Deplano, C; Derkach, D; Deschamps, O; Dettori, F; Di Canto, A; Dickens, J; Dijkstra, H; Diniz Batista, P; Dogaru, M; Domingo Bonal, F; Domke, M; Donleavy, S; Dordei, F; Dosil Suárez, A; Dossett, D; Dovbnya, A; Drancourt, C; Duarte, O; Dumps, R; Dupertuis, F; Duval, P -Y; Dzhelyadin, R; Dziurda, A; Dzyuba, A; Easo, S; Egede, U; Egorychev, V; Eidelman, S; van Eijk, D; Eisenhardt, S; Ekelhof, R; Eklund, L; El Rifai, I; Elsasser, Ch; Elsby, D; Evangelisti, F; Falabella, A; Färber, C; Fardell, G; Farinelli, C; Farry, S; Faulkner, P J W; Fave, V; Felici, G; Fernandez Albor, V; Ferreira Rodrigues, F; Ferro-Luzzi, M; Filippov, S; Fitzpatrick, C; Föhr, C; Fontana, M; Fontanelli, F; Forty, R; Fournier, C; Francisco, O; Frank, M; Frei, C; Frei, R; Frosini, M; Fuchs, H; Furcas, S; Gallas Torreira, A; Galli, D; Gandelman, M; Gandini, P; Gao, Y; Garofoli, J; Garosi, P; Garra Tico, J; Garrido, L; Gascon, D; Gaspar, C; Gauld, R; Gersabeck, E; Gersabeck, M; Gershon, T; Gets, S; Ghez, Ph; Giachero, A; Gibson, V; Gligorov, V V; Göbel, C; Golovtsov, V; Golubkov, D; Golutvin, A; Gomes, A; Gong, G; Gong, H; Gordon, H; Gotti, C; Grabalosa Gándara, M; Graciani Diaz, R; Granado Cardoso, L A; Graugés, E; Graziani, G; Grecu, A; Greening, E; Gregson, S; Gromov, V; Grünberg, O; Gui, B; Gushchin, E; Guz, Yu; Guzik, Z; Gys, T; Hachon, F; Hadjivasiliou, C; Haefeli, G; Haen, C; Haines, S C; Hall, S; Hampson, T; Hansmann-Menzemer, S; Harnew, N; Harnew, S T; Harrison, J; Harrison, P F; Hartmann, T; He, J; van der Heijden, B; Heijne, V; Hennessy, K; Henrard, P; Hernando Morata, J A; van Herwijnen, E; Hicks, E; Hill, D; Hoballah, M; Hofmann, W; Hombach, C; Hopchev, P; Hulsbergen, W; Hunt, P; Huse, T; Hussain, N; Hutchcroft, D; Hynds, D; Iakovenko, V; Ilten, P; Imong, J; Jacobsson, R; Jaeger, A; Jamet, O; Jans, E; Jansen, F; Jansen, L; Jansweijer, P; Jaton, P; Jing, F; John, M; Johnson, D; Jones, C R; Jost, B; Kaballo, M; Kandybei, S; Karacson, M; Karavichev, O; Karbach, T M; Kashchuk, A; Kechadi, T; Kenyon, I R; Kerzel, U; Ketel, T; Keune, A; Khanji, B; Kihm, T; Kluit, R; Kochebina, O; Komarov, V; Koopman, R F; Koppenburg, P; Korolev, M; Kos, J; Kozlinskiy, A; Kravchuk, L; Kreplin, K; Kreps, M; Kristic, R; Krocker, G; Krokovny, P; Kruse, F; Kucharczyk, M; Kudenko, Y; Kudryavtsev, V; Kvaratskheliya, T; La Thi, V N; Lacarrere, D; Lafferty, G; Lai, A; Lambert, D; Lambert, R W; Lanciotti, E; Landi, L; Lanfranchi, G; Langenbruch, C; Laptev, S; Latham, T; Lax, I; Lazzeroni, C; Le Gac, R; van Leerdam, J; Lees, J -P; Lefèvre, R; Leflat, A; Lefrançois, J; Leroy, O; Lesiak, T; Li, Y; Li Gioi, L; Likhoded, A; Liles, M; Lindner, R; Linn, C; Liu, B; Liu, G; von Loeben, J; Lopes, J H; Lopez Asamar, E; Lopez-March, N; Lu, H; Luisier, J; Luo, H; Mac Raighne, A; Machefert, F; Machikhiliyan, I V; Maciuc, F; Maev, O; Maino, M; Malde, S; Manca, G; Mancinelli, G; Mangiafave, N; Marconi, U; Märki, R; Marks, J; Martellotti, G; Martens, A; Martín Sánchez, A; Martinelli, M; Martinez Santos, D; Martins Tostes, D; Massafferri, A; Matev, R; Mathe, Z; Matteuzzi, C; Matveev, M; Maurice, E; Mauricio, J; Mazurov, A; McCarthy, J; McNulty, R; Meadows, B; Meissner, M; Mejia, H; Mendez-Munoz, V; Merk, M; Milanes, D A; Minard, M -N; Molina Rodriguez, J; Monteil, S; Moran, D; Morawski, P; Mountain, R; Mous, I; Muheim, F; Mul, F; Müller, K; Munneke, B; Muresan, R; Muryn, B; Muster, B; Naik, P; Nakada, T; Nandakumar, R; Nasteva, I; Nawrot, A; Needham, M; Neufeld, N; Nguyen, A D; Nguyen, T D; Nguyen-Mau, C; Nicol, M; Niess, V; Nikitin, N; Nikodem, T; Nikolaiko, Y; Nisar, S; Nomerotski, A; Novoselov, A; Oblakowska-Mucha, A; Obraztsov, V; Oggero, S; Ogilvy, S; Okhrimenko, O; Oldeman, R; Orlandea, M; Ostankov, A; Otalora Goicochea, J M; van Overbeek, M; Owen, P; Pal, B K; Palano, A; Palutan, M; Panman, J; Papanestis, A; Pappagallo, M; Parkes, C; Parkinson, C J; Passaleva, G; Patel, G D; Patel, M; Patrick, G N; Patrignani, C; Pavel-Nicorescu, C; Pazos Alvarez, A; Pellegrino, A; Penso, G; Pepe Altarelli, M; Perazzini, S; Perego, D L; Perez Trigo, E; Pérez-Calero Yzquierdo, A; Perret, P; Perrin-Terrin, M; Pessina, G; Petridis, K; Petrolini, A; van Petten, O; Phan, A; Picatoste Olloqui, E; Piedigrossi, D; Pietrzyk, B; Pilař, T; Pinci, D; Playfer, S; Plo Casasus, M; Polci, F; Polok, G; Poluektov, A; Polycarpo, E; Popov, D; Popovici, B; Potterat, C; Powell, A; Prisciandaro, J; Pugatch, M; Pugatch, V; Puig Navarro, A; Qian, W; Rademacker, J H; Rakotomiaramanana, B; Rangel, M S; Raniuk, I; Rauschmayr, N; Raven, G; Redford, S; Reid, M M; dos Reis, A C; Rethore, F; Ricciardi, S; Richards, A; Rinnert, K; Rives Molina, V; Roa Romero, D A; Robbe, P; Rodrigues, E; Rodriguez Perez, P; Roeland, E; Rogers, G J; Roiser, S; Romanovsky, V; Romero Vidal, A; de Roo, K; Rouvinet, J; Roy, L; Rudloff, K; Ruf, T; Ruiz, H; Sabatino, G; Saborido Silva, J J; Sagidova, N; Sail, P; Saitta, B; Salzmann, C; Sanmartin Sedes, B; Santacesaria, R; Santamarina Rios, C; Santovetti, E; Saornil Gamarra, S; Sapunov, M; Saputi, A; Sarti, A; Satriano, C; Satta, A; Savidge, T; Savrie, M; Schaack, P; Schiller, M; Schimmel, A; Schindler, H; Schleich, S; Schlupp, M; Schmelling, M; Schmidt, B; Schneider, O; Schneider, T; Schopper, A; Schuijlenburg, H; Schune, M -H; Schwemmer, R; Sciascia, B; Sciubba, A; Seco, M; Semennikov, A; Senderowska, K; Sepp, I; Serra, N; Serrano, J; Seyfert, P; Shao, B; Shapkin, M; Shapoval, I; Shatalov, P; Shcheglov, Y; Shears, T; Shekhtman, L; Shevchenko, O; Shevchenko, V; Shires, A; Sigurdsson, S; Silva Coutinho, R; Skwarnicki, T; Slater, M W; Sluijk, T; Smith, N A; Smith, E; Smith, M; Sobczak, K; Sokoloff, M D; Soler, F J P; Soomro, F; Souza, D; Souza De Paula, B; Spaan, B; Sparkes, A; Spradlin, P; Squerzanti, S; Stagni, F; Stahl, S; Steinkamp, O; Stenyakin, O; Stoica, S; Stone, S; Storaci, B; Straticiuc, M; Straumann, U; Subbiah, V K; Swientek, S; Szczekowski, M; Szczypka, P; Szumlak, T; T'Jampens, S; Teklishyn, M; Teodorescu, E; Teubert, F; Thomas, C; Thomas, E; Tikhonov, A; van Tilburg, J; Tisserand, V; Tobin, M; Tocut, V; Tolk, S; Tonelli, D; Topp-Joergensen, S; Torr, N; Tournefier, E; Tourneur, S; Tran, M T; Tresch, M; Tsaregorodtsev, A; Tsopelas, P; Tuning, N; Ubeda Garcia, M; Ukleja, A; Ullaland, O; Urner, D; Uwer, U; Vagnoni, V; Valenti, G; Vazquez Gomez, R; Vazquez Regueiro, P; Vecchi, S; Velthuis, J J; Veltri, M; Veneziano, G; Vesterinen, M; Viaud, B; Vieira, D; Vilasis-Cardona, X; Vink, W; Volkov, S; Volkov, V; Vollhardt, A; Volyanskyy, D; Voong, D; Vorobyev, A; Vorobyev, V; Voß, C; Voss, H; Vouters, G; Waldi, R; Wallace, R; Wandernoth, S; Wang, J; Ward, D R; Warda, K; Watson, N K; Webber, A D; Websdale, D; Wenerke, P; Whitehead, M; Wicht, J; Wiedner, D; Wiggers, L; Wilkinson, G; Williams, M P; Williams, M; Wilson, F F; Wishahi, J; Witek, M; Witzeling, W; Wotton, S A; Wright, S; Wu, S; Wyllie, K; Xie, Y; Xing, Z; Xue, T; Yang, Z; Young, R; Yuan, X; Yushchenko, O; Zangoli, M; Zappon, F; Zavertyaev, M; Zeng, M; Zhang, F; Zhang, L; Zhang, W C; Zhang, Y; Zhelezov, A; Zhong, L; Zverev, E; Zvyagin, A; Zwart, A; Bharucha, A; Bigi, I.I.; Bobeth, C; Bobrowski, M; Brod, Joachim; Buras, A J; Davies, C T H; Datta, A.; Delaunay, C; Descotes-Genon, S; Ellis, J; Feldmann, T; Fleischer, R; Gedalia, O; Girrbach, J; Guadagnoli, D; Hiller, G; Hochberg, Y; Hurth, T; Isidori, G; Jager, S; Jung, M; Kagan, A; Kamenik, J F; Lenz, A; Ligeti, Z; London, D; Mahmoudi, F; Matias, J; Nandi, S; Nir, Y; Paradisi, P; Perez, G; Petrov, A A; Rattazzi, R; Sharpe, S R; Silvestrini, L; Soni, A; Straub, D M; van Dyk, D; Virto, J; Wang, Y M; Weiler, A; Zupan, J

    2013-01-01

    During 2011 the LHCb experiment at CERN collected $1.0 {\\mbox{fb}^{-1}}$ of $\\sqrt{s} = 7 {\\mathrm{\\,Te\\kern -0.1em V}}$ $pp$ collisions. Due to the large heavy quark production cross-sections, these data provide unprecedented samples of heavy flavoured hadrons. The first results from LHCb have made a significant impact on the flavour physics landscape and have definitively proved the concept of a dedicated experiment in the forward region at a hadron collider. This document discusses the implications of these first measurements on classes of extensions to the Standard Model, bearing in mind the interplay with the results of searches for on-shell production of new particles at ATLAS and CMS. The physics potential of an upgrade to the LHCb detector, which would allow an order of magnitude more data to be collected, is emphasised.

  10. Promoting biofuels: Implications for developing countries

    International Nuclear Information System (INIS)

    Peters, Joerg; Thielmann, Sascha

    2008-01-01

    Interest in biofuels is growing worldwide as concerns about the security of energy supply and climate change are moving into the focus of policy makers. With the exception of bioethanol from Brazil, however, production costs of biofuels are typically much higher than those of fossil fuels. As a result, promotion measures such as tax exemptions or blending quotas are indispensable for ascertaining substantial biofuel demand. With particular focus on developing countries, this paper discusses the economic justification of biofuel promotion instruments and investigates their implications. Based on data from India and Tanzania, we find that substantial biofuel usage induces significant financial costs. Furthermore, acreage availability is a binding natural limitation that could also lead to conflicts with food production. Yet, if carefully implemented under the appropriate conditions, biofuel programs might present opportunities for certain developing countries

  11. Nuclear power: Health implications of transuranium elements

    International Nuclear Information System (INIS)

    1982-01-01

    This report provides general guidelines for national public health and environmental authorities. It does not provide detailed technical data, but instead broadly surveys the whole field, indicating the present position as assessed by members of the Working Group. The Working Group considered three major facets: physiological, toxicological and dosimetric aspects of the transuranium elements; the application of occupational health control, including health physics; and environmental behaviour together with public health implications associated with the transuranium elements. The intention was to cover all aspects relevant to health, with respect both to those who are occupationally engaged in work with such elements and to the general public who might be affected as the result of such operations. Consideration was also given to routine and emergency situations

  12. IRON-TOLERANT CYANOBACTERIA: IMPLICATIONS FOR ASTROBIOLOGY

    Science.gov (United States)

    Brown, Igor I.; Allen, Carlton C.; Mummey, Daniel L.; Sarkisova, Svetlana A.; McKay, David S.

    2006-01-01

    The review is dedicated to the new group of extremophiles - iron tolerant cyanobacteria. The authors have analyzed earlier published articles about the ecology of iron tolerant cyanobacteria and their diversity. It was concluded that contemporary iron depositing hot springs might be considered as relative analogs of Precambrian environment. The authors have concluded that the diversity of iron-tolerant cyanobacteria is understudied. The authors also analyzed published data about the physiological peculiarities of iron tolerant cyanobacteria. They made the conclusion that iron tolerant cyanobacteria may oxidize reduced iron through the photosystem of cyanobacteria. The involvement of both Reaction Centers 1 and 2 is also discussed. The conclusion that iron tolerant protocyanobacteria could be involved in banded iron formations generation is also proposed. The possible mechanism of the transition from an oxygenic photosynthesis to an oxygenic one is also discussed. In the final part of the review the authors consider the possible implications of iron tolerant cyanobacteria for astrobiology.

  13. Implications of Canadian oil tax policies

    Energy Technology Data Exchange (ETDEWEB)

    Copplestone, G H

    1983-01-01

    This thesis examines some of the implications of the policy initiatives taken by both levels of government during the 1974-80 period (i.e., from the OPEC oil embargo and subsequent quadrupling of posted world oil prices to the introduction of the National Energy Program, or NEP). A survey of the fiscal instruments employed by both the federal and the oil-producing provincial levels of government to distribute the oil revenues generated in Canada is presented. The focus of this survey is primarily on the pre-NEP regime and the immediate post-NEP regime. The remainder of the thesis then deals with some of the distributional and efficiency aspects of these tax regimes. The thesis also examines the economic efficiency aspects of the pre- and post-NEP tax regimes. In particular, it addresses the issue of an inefficient allocation of resources within the oil industry itself.

  14. Racism and cardiovascular disease: implications for nursing.

    Science.gov (United States)

    Jackson, Jennifer; McGibbon, Elizabeth; Waldron, Ingrid

    2013-01-01

    The social determinants of health (SDH) are recognized as a prominent influence on health outcomes across the lifespan. Racism is identified as a key SDH. In this article, the authors describe the concept of racism as an SDH, its impact in discriminatory actions and inactions, and the implications for cardiovascular nurses. Although research in Canada on the links among racism, stress, and cardiovascular disease is limited, there is growing evidence about the stress of racism and its long-term impact on cardiovascular health. The authors discuss how cardiovascular nursing could be enhanced through an understanding of racism-related stress, and race-based differences in cardiovascular care. The authors conclude with strategies for action to address this nursing concern.

  15. Economic implications of resistance to antimalarial drugs.

    Science.gov (United States)

    Phillips, M; Phillips-Howard, P A

    1996-09-01

    The widespread evolution of drug resistance in malarial parasites has seriously hampered efforts to control this debilitating disease. Chloroquine, the mainstay of malaria treatment for many decades, is now proving largely ineffective in many parts of the world, particularly against the most severe form of malaria--falciparum. Alternative drugs have been developed, but they are frequently less safe and are all between 50 and 700% more expensive than chloroquine. Choice of drug clearly has important budgetary implications and national malaria control programmes need to weigh up the costs and benefits in deciding whether to change to more effective but more expensive drugs. The growth in drug resistance also has implications for the choice of diagnostic tool. Clinical diagnosis of malaria is relatively cheap, but less specific than some technological approaches. As more expensive drugs are employed, the cost of wasted treatment on suspected cases who do not in fact have malaria rises and the more worthwhile it becomes to invest in more specific diagnostic techniques. This paper presents an economic framework for analysing the various malaria drug and diagnostic tool options available. It discusses the nature of the key factors that need to be considered when making choices of malaria treatment (including treatment costs, drug resistance, the costs of treatment failure and compliance) and diagnosis (including diagnosis cost and accuracy, and the often overlooked costs associated with delayed treatment), and uses some simple equations to illustrate the impact of these on the relative cost effectiveness of the alternatives being considered. On the basis of some simplifying assumptions and illustrative calculations, it appears that in many countries more effective drugs and more specific and rapid diagnostic approaches will be worth adopting even although they imply additional expense.

  16. Education System Reform in China after 1978: Some Practical Implications

    Science.gov (United States)

    Sun, Miantao

    2010-01-01

    Purpose: This paper aims to provide an overview of education system reform in China since 1978, and its practical implications. Design/methodology/approach: Data were collected from literature review and interview. An overview of education system reform and its practical implications was found through data analysis. Findings: There has been two…

  17. Paradoxical implications of personal social media use for work

    NARCIS (Netherlands)

    van Zoonen, W.; Rice, R.E.

    2017-01-01

    New information and communication technologies can have paradoxical implications: they may be liberating and constraining at the same time. This field study examines the direct implications of personal social media use for work on employees’ autonomy and work pressure, and the indirect effects on

  18. The SANE Research Project: Its Implications for Higher Education.

    Science.gov (United States)

    Harrison, Andrew; Dugdale, Shirley

    2003-01-01

    Describes a 2-year research program called Sustainable Accommodation for the New Economy (SANE), which is exploring the implications of the distributed workplace. Its focus is on the creation of sustainable, collaborative workplaces for knowledge workers across Europe, encompassing both virtual and physical spaces. Discusses its implications for…

  19. The Technological Society: Implications for Women in the Workplace.

    Science.gov (United States)

    Cianni, Mary; Weitz, Anna D.

    1986-01-01

    Although increased technology is altering the nature of work, familiar barriers continue to exist for women. Examines the equity of access to technology, the career implications for those employed at home, and the realities of newly promised occupational opportunities. Implications for counselors are discussed. (Author/BL)

  20. Poverty and Brain Development in Children: Implications for Learning

    Science.gov (United States)

    Dike, Victor E.

    2017-01-01

    Debates on the effect of poverty on brain development in children and its implications for learning have been raging for decades. Research suggests that poverty affects brain development in children and that the implications for learning are more compelling today given the attention the issue has attracted. For instance, studies in the fields of…

  1. Kierkegaardian Implications of Punishment, Guilt, and Forgiveness for Education.

    Science.gov (United States)

    Senyshyn, Yaroslav

    1998-01-01

    Explores Soren Kierkegaard's notion of punishment, which should interest educators because it provides a way to avoid the pitfalls of unjust punishment by viewing it in conjunction with the implications of guilt and forgiveness. The paper notes the need to question the notion of punishment closely and seek to understand its implications. (SM)

  2. Rubella Deaf-Blind Child: Implications of Psychological Assessment. Proceedings.

    Science.gov (United States)

    Rouin, Carole

    Presented are proceedings of a conference involving authorities in testing and evaluating the blind, deaf, and deaf-blind. In a paper titled "Psychological Implications of Assessing the Deaf", C. Goetzinger discusses references used in audiology, anatomy and physiology of the ear, degrees of hearing impairment, and implications of the various…

  3. Motivation and Gifted Students: Implications of Theory and Research

    Science.gov (United States)

    Clinkenbeard, Pamela R.

    2012-01-01

    An analysis of contemporary motivation theories reveals implications for gifted and talented students. The expectancy-value framework, intrinsic-extrinsic motivation theories, goal orientations, self-efficacy and other self-perceptions, and attribution theory are described and discussed with respect to implications for the psychology and education…

  4. Transcriptome analysis of Sulfolobus solfataricus infected with two related fuselloviruses reveals novel insights into the regulation of CRISPR-Cas system

    DEFF Research Database (Denmark)

    Fusco, Salvatore; Liguori, Rossana; Limauro, Danila

    2015-01-01

    in a double-infected strain to explore both virus-host and virus-virus interactions. Whereas SSV1 did not induce major changes of the host gene expression, SSV2 elicited a strong host response, which includes the transcriptional activation of CRISPR loci and cas genes. As a consequence, a significant decrease...... of the SSV2 copy number has been observed, which in turn led to provirus-capture into the host chromosome. Results of this study have revealed novel aspects of the host-viral interaction in the frame of the CRISPR-response....

  5. Structural and kinetic studies of the allosteric transition in Sulfolobus solfataricus uracil phosphoribosyltransferase: Permanent activation by engineering of the C-terminus

    DEFF Research Database (Denmark)

    Christoffersen, Stig; Kadziola, Anders; Johansson, Eva

    2009-01-01

    and PPi, in the other sites. Combined with three existing structures of uracil phosphoribosyltransferase in complex with UMP and the allosteric inhibitor cytidine triphosphate (CTP), these structures provide valuable insight into the mechanism of allosteric transition from inhibited to active enzyme...

  6. Alexithymia in eating disorders: therapeutic implications

    Directory of Open Access Journals (Sweden)

    Pinna F

    2014-12-01

    Full Text Available Federica Pinna, Lucia Sanna, Bernardo Carpiniello Department of Public Health, Clinical and Molecular Medicine - Unit of Psychiatry, University of Cagliari, Cagliari, Italy Abstract: A high percentage of individuals affected by eating disorders (ED achieve incomplete recovery following treatment. In an attempt to improve treatment outcome, it is crucial that predictors of outcome are identified, and personalized care approaches established in line with new treatment targets, thus facilitating patient access to evidence-based treatments. Among the psychological factors proposed as predictors of outcome in ED, alexithymia is of outstanding interest. The objective of this paper is to undertake a systematic review of the literature relating to alexithymia, specifically in terms of the implications for treatment of ED. In particular, issues concerning the role of alexithymia as a predictor of outcome and as a factor to be taken into account in the choice of treatment will be addressed. The effect of treatments on alexithymia will also be considered. A search of all relevant literature published in English using PubMed, PsycINFO, and Scopus databases was carried out on the basis of the following keywords: alexithymia, anorexia nervosa, bulimia nervosa, eating disorders, and treatment; no time limits were imposed. Despite the clinical relevance of alexithymia, the number of studies published on the above cited aspects is somewhat limited, and these studies are largely heterogeneous and feature significant methodological weaknesses. Overall, data currently available mostly correlate higher levels of alexithymia with a less favorable outcome in ED. Accordingly, alexithymia is seen as a relevant treatment target with the aim of achieving recovery of these patients. Treatments focusing on improving alexithymic traits, and specifically those targeting emotions, seem to show greater efficacy, although alexithymia levels often remain high even after specific

  7. Policy implications of technologies for cognitive enhancement

    Energy Technology Data Exchange (ETDEWEB)

    Sarewitz, Daniel R. (Arizona State University, Tempe, AZ); Karas, Thomas H.

    2007-02-01

    The Advanced Concepts Group at Sandia National Laboratory and the Consortium for Science, Policy and Outcomes at Arizona State University convened a workshop in May 2006 to explore the potential policy implications of technologies that might enhance human cognitive abilities. The group's deliberations sought to identify core values and concerns raised by the prospect of cognitive enhancement. The workshop focused on the policy implications of various prospective cognitive enhancements and on the technologies/nanotechnology, biotechnology, information technology, and cognitive science--that enable them. The prospect of rapidly emerging technological capabilities to enhance human cognition makes urgent a daunting array of questions, tensions, ambitions, and concerns. The workshop elicited dilemmas and concerns in ten overlapping areas: science and democracy; equity and justice; freedom and control; intergenerational issues; ethics and competition; individual and community rights; speed and deliberations; ethical uncertainty; humanness; and sociocultural risk. We identified four different perspectives to encompass the diverse issues related to emergence of cognitive enhancement technologies: (1) Laissez-faire--emphasizes freedom of individuals to seek and employ enhancement technologies based on their own judgment; (2) Managed technological optimism--believes that while these technologies promise great benefits, such benefits cannot emerge without an active government role; (3) Managed technological skepticism--views that the quality of life arises more out of society's institutions than its technologies; and (4) Human Essentialism--starts with the notion of a human essence (whether God-given or evolutionary in origin) that should not be modified. While the perspectives differ significantly about both human nature and the role of government, each encompasses a belief in the value of transparency and reliable information that can allow public discussion and

  8. People management implications of virtual workplace arrangements

    Directory of Open Access Journals (Sweden)

    K. Ortlepp

    2006-12-01

    Full Text Available Purpose: The purpose of this paper is to investigate the factors that led to an organisation implementing a particular form of virtual workplace arrangement, namely, home-based work. The benefits and disadvantages associated with this form of work arrangement are explored from both the managers' and home-based employees' perspectives. Design/Methodology/Approach: Given the exploratory nature of the empirical study on which this paper is based, a qualitative research design was adopted so as to ensure that the data collection process was dynamic and probing in nature. Semi-structured in-depth interviews were therefore used as instruments for data collection. Findings: The research findings indicate that virtual work arrangements such as home-based work arrangements have advantages for both employers and employees. For instance, reduction of costs associated with office space and facilities, decrease in absenteeism rates, increased employee job satisfaction and improvements in employees' general quality of life. However, a number of negative experiences related to this form of virtual work arrangement are also evident, for example, feelings of isolation as well as stress related to the inability to have firm boundaries between work and family responsibilities. Implications: Based on the insights gained from the findings in the empirical study, a number of areas that need to be given specific attention when organisations are introducing virtual workplace arrangements of this nature are identified. Recommendations made in this article are important for human resource management specialists as well as core business policy makers considering different forms of organisational design. Originality/Value: Maximising the quality of production and service provided has become the prime objective in most organisations in the 21st century. Technology has made it possible for some jobs to be performed at any place at any time and has facilitated the

  9. Some practical implications of source term reassessment

    International Nuclear Information System (INIS)

    1988-03-01

    This report provides a brief summary of the current knowledge of severe accident source terms and suggests how this knowledge might be applied to a number of specific aspects of reactor safety. In preparing the report, consideration has been restricted to source term issues relating to light water reactors (LWRs). Consideration has also generally been restricted to the consequences of hypothetical severe accidents rather than their probability of occurrence, although it is recognized that, in the practical application of source term research, it is necessary to take account of probability as well as consequences. The specific areas identified were as follows: Exploration of the new insights that are available into the management of severe accidents; Investigating the impact of source term research on emergency planning and response; Assessing the possibilities which exist in present reactor designs for preventing or mitigating the consequences of severe accidents and how these might be used effectively; Exploring the need for backfitting and assessing the implications of source term research for future designs; and Improving the quantification of the radiological consequences of hypothetical severe accidents for probabilistic safety assessments (PSAs) and informing the public about the realistic risks associated with nuclear power plants. 7 refs

  10. The Implications of Deep Mitigation Pathways

    Science.gov (United States)

    Calvin, K. V.

    2016-12-01

    The 21st Conference of Parties to the UNFCCC agreement called for limiting climate change to "well below 2°C above pre-industrial levels and pursuing efforts to limit the temperature increase to 1.5°C." A climate target of 1.5°C places a stringent constraint on allowable emissions over the twenty-first century. Roegli et al. (2015) set that constraint at 200-415 GtCO2 between 2011 and 2100 for a likely chance of staying below 1.5°C in 2100. Limiting emissions to these levels requires that global emissions peak and decline over the coming decades, with net negative global emissions by mid-century. This level of decarbonization requires dramatic shifts in the energy and agricultural sectors, and comes at significant economic costs. This talk explores the effect of mitigating climate change to 1.5°C on the economy, energy system, and terrestrial system. We quantify the required deployment of various low carbon technologies, as well as the amount of existing capital that is abandoned in an effort to limit emissions. We show the shifts required in the terrestrial system, including its contribution to carbon sequestration through afforestation and bioenergy. Additionally, we show the implications of deep mitigation pathways on energy, food, and carbon prices. We contrast these results with a reference, no climate policy, world and a 2°C.

  11. Relativistic implications of the quantum phase

    International Nuclear Information System (INIS)

    Low, Stephen G

    2012-01-01

    The quantum phase leads to projective representations of symmetry groups in quantum mechanics. The projective representations are equivalent to the unitary representations of the central extension of the group. A celebrated example is Wigner's formulation of special relativistic quantum mechanics as the projective representations of the inhomogeneous Lorentz group. However, Wigner's formulation makes no mention of the Weyl-Heisenberg group and the hermitian representation of its algebra that are the Heisenberg commutation relations fundamental to quantum physics. We put aside the relativistic symmetry and show that the maximal quantum symmetry that leaves the Heisenberg commutation relations invariant is the projective representations of the conformally scaled inhomogeneous symplectic group. The Weyl-Heisenberg group and noncommutative structure arises directly because the quantum phase requires projective representations. We then consider the relativistic implications of the quantum phase that lead to the Born line element and the projective representations of an inhomogeneous unitary group that defines a noninertial quantum theory. (Understanding noninertial quantum mechanics is a prelude to understanding quantum gravity.) The remarkable properties of this symmetry and its limits are studied.

  12. Clinical implications of vitamin D deficiency

    Directory of Open Access Journals (Sweden)

    Beata Matyjaszek-Matuszek

    2015-06-01

    Full Text Available Vitamin D deficiency is a common medical problem worldwide and its prevalence rises along with latitude, obesity, sedentary lifestyle, limited sunlight exposure and aging. A great body of evidence has shown that patients with vitamin D deficiency have increased cardiovascular risks and total mortality. Conversely, the presence of comorbidities progressive with age such as abdominal obesity, insulin resistance, type 2 diabetes and hypertension places the patients at an increased risk of vitamin D deficiency. The multidirectional effect of vitamin D deficiency is present in different phases of the aging process. Based on the literature review, the risk factors for vitamin D insufficiency most often found in post-menopausal women include limited sun exposure and time spent outdoors, inadequate dietary vitamin D intake, winter season and increased age. Vitamin D supplementation in this group might offer prevention of falls and fractures and may be beneficial for cardiovascular health, what may be especially important in osteoporotic and elderly populations. Prevention and treatment processes involve education regarding sunlight exposure and pharmacological cholecalciferol supplementation according to the recommendations for Central Europe. This manuscript reviews the role of vitamin D and its deficiency and considers their clinical implications, with particular regard to peri- and postmenopausal women.

  13. Big Data: Implications for Health System Pharmacy.

    Science.gov (United States)

    Stokes, Laura B; Rogers, Joseph W; Hertig, John B; Weber, Robert J

    2016-07-01

    Big Data refers to datasets that are so large and complex that traditional methods and hardware for collecting, sharing, and analyzing them are not possible. Big Data that is accurate leads to more confident decision making, improved operational efficiency, and reduced costs. The rapid growth of health care information results in Big Data around health services, treatments, and outcomes, and Big Data can be used to analyze the benefit of health system pharmacy services. The goal of this article is to provide a perspective on how Big Data can be applied to health system pharmacy. It will define Big Data, describe the impact of Big Data on population health, review specific implications of Big Data in health system pharmacy, and describe an approach for pharmacy leaders to effectively use Big Data. A few strategies involved in managing Big Data in health system pharmacy include identifying potential opportunities for Big Data, prioritizing those opportunities, protecting privacy concerns, promoting data transparency, and communicating outcomes. As health care information expands in its content and becomes more integrated, Big Data can enhance the development of patient-centered pharmacy services.

  14. Environmental health implications of global climate change

    Energy Technology Data Exchange (ETDEWEB)

    Watson, Robert T.; Patz, Jonathan; Gubler, Duane J.; Parson, Edward A.; Vincent, James H.

    2005-07-01

    This paper reviews the background that has led to the now almost-universally held opinion in the scientific community that global climate change is occurring and is inescapably linked with anthropogenic activity. The potential implications to human health are considerable and very diverse. These include, for example, the increased direct impacts of heat and of rises in sea level, exacerbated air and water-borne harmful agents, and - associated with all the preceding - the emergence of environmental refugees. Vector-borne diseases, in particular those associated with blood-sucking arthropods such as mosquitoes, may be significantly impacted, including redistribution of some of those diseases to areas not previously affected. Responses to possible impending environmental and public health crises must involve political and socio-economic considerations, adding even greater complexity to what is already a difficult challenge. In some areas, adjustments to national and international public health practices and policies may be effective, at least in the short and medium terms. But in others, more drastic measures will be required. Environmental monitoring, in its widest sense, will play a significant role in the future management of the problem. (Author)

  15. Rehabilitation of executive functions: Implications and strategies

    Directory of Open Access Journals (Sweden)

    Bruno Kluwe-Schiavon

    2013-01-01

    Full Text Available Executive Functions (EF concern a range of abilities including problem-solving, planning, initiation, selfmonitoring,conscious attention, cope with new situations and the ability to modify plans if necessary. It’s a high cognitive function that is crucial for a person to get engaged and maintain daily activities whilst keeping a good quality of life. Problems in the EF were formerly known as Dysexecutive Syndrome (DS. There are many models concerning DS, although the literature on the subject still remains unclear. Several works appoint the effects brought by elderly life, as well as abuse of drugs and some psychopathologies. These factors are known to increase the distress of the frontal circuits and that could be associated to executive deficits. The effects of DS would compromise individuals in day-to-day routine, academic, social and labor fields. There is a growing body of studies trying to determine the causes, implications, associations and the best way to take care of these effects. This work intends to review DS, focusing on the most important fields related to this area, such as psychopathology associations, cognitive reserve, assessment and cognitive rehabilitation programs.

  16. Language Learning Strategies: Classification and Pedagogical Implication

    Directory of Open Access Journals (Sweden)

    Ag. Bambang Setiyadi

    2001-01-01

    Full Text Available Many studies have been conducted to explore language learning strategies (Rubin, 1975, Naiman et . al ., 1978; Fillmore, 1979; O'Malley et . al ., 1985 and 1990; Politzer and Groarty, 1985; Prokop, 1989; Oxford, 1990; and Wenden, 1991. In the current study a total of 79 university students participating in a 3 month English course participated. This study attempted to explore what language learning strategies successful learners used and to what extent the strategies contributed to success in learning English in Indonesia . Factor analyses, accounting for 62.1 %, 56.0 %, 41.1 %, and 43.5 % of the varience of speaking, listening, reading and writing measures in the language learning strategy questionnaire, suggested that the questionnaire constituted three constructs. The three constructs were named metacognitive strategies, deep level cognitive and surface level cognitive strategies. Regression analyses, performed using scales based on these factors revealed significant main effects for the use of the language learning strategies in learning English, constituting 43 % of the varience in the posttest English achievement scores. An analysis of varience of the gain scores of the highest, middle, and the lowest groups of performers suggested a greater use of metacognitive strategies among successful learners and a greater use of surface level cognitive strategies among unsuccessful learners. Implications for the classroom and future research are also discussed.

  17. Climate change: potential implications for Ireland's biodiversity

    Science.gov (United States)

    Donnelly, Alison

    2018-03-01

    A national biodiversity and climate change adaptation plan is being developed for Ireland by the Department of Communications, Climate Action, and Environment. In order to inform such a plan, it was necessary to review and synthesize some of the recent literature pertaining to the impact of climate change on biodiversity in Ireland. Published research on this topic fell within three broad categories: (i) changes in the timing of life-cycle events (phenology) of plants, birds, and insects; (ii) changes in the geographic range of some bird species; and (iii) changes in the suitable climatic zones of key habitats and species. The synthesis revealed evidence of (i) a trend towards earlier spring activity of plants, birds, and insects which may result in a change in ecosystem function; (ii) an increase in the number of bird species; and (iii) both increases and decreases in the suitable climatic area of key habitats and species, all of which are expected to impact Ireland's future biodiversity. This process identified data gaps and limitations in available information both of which could be used to inform a focused research strategy. In addition, it raises awareness of the potential implications of climate change for biodiversity in Ireland and elsewhere and demonstrates the need for biodiversity conservation plans to factor climate change into future designs.

  18. Implications of conformal invariance in momentum space

    Science.gov (United States)

    Bzowski, Adam; McFadden, Paul; Skenderis, Kostas

    2014-03-01

    We present a comprehensive analysis of the implications of conformal invariance for 3-point functions of the stress-energy tensor, conserved currents and scalar operators in general dimension and in momentum space. Our starting point is a novel and very effective decomposition of tensor correlators which reduces their computation to that of a number of scalar form factors. For example, the most general 3-point function of a conserved and traceless stress-energy tensor is determined by only five form factors. Dilatations and special conformal Ward identities then impose additional conditions on these form factors. The special conformal Ward identities become a set of first and second order differential equations, whose general solution is given in terms of integrals involving a product of three Bessel functions (`triple- K integrals'). All in all, the correlators are completely determined up to a number of constants, in agreement with well-known position space results. In odd dimensions 3-point functions are finite without renormalisation while in even dimensions non-trivial renormalisation in required. In this paper we restrict ourselves to odd dimensions. A comprehensive analysis of renormalisation will be discussed elsewhere. This paper contains two parts that can be read independently of each other. In the first part, we explain the method that leads to the solution for the correlators in terms of triple- K integrals while the second part contains a self-contained presentation of all results. Readers interested only in results may directly consult the second part of the paper.

  19. Practical implications of neutron survey instrument performance

    International Nuclear Information System (INIS)

    Tanner, R. J.; Bartlett, D. T.; Hager, I. G.; Jones, I. N.; Molinos, C.; Roberts, N. J.; Taylor, G. C.; Thomas, D. J.

    2004-01-01

    Improvements have been made to the Monte Carlo modelling used to calculate the response of the neutron survey instruments most commonly used in the UK, for neutron energies up to 20 MeV. The improved modelling of the devices includes the electronics and battery pack, allowing better calculations of both the energy and angle dependence of response. These data are used to calculate the response of the instruments in rotationally and fully isotropic, as well as unidirectional fields. Experimental measurements with radionuclide sources and monoenergetic neutron fields have been, and continue to be made, to test the calculated response characteristics. The enhancements to the calculations have involved simulation of the sensitivity of the response to variations in instrument manufacture, and will include the influence of the user and floor during measurements. The practical implications of the energy and angle dependence of response, variations in manufacture, and the influence of the user are assessed by folding the response characteristics with workplace energy and direction distributions. (authors)

  20. Implications and Prospects of the GNEP

    International Nuclear Information System (INIS)

    Ryu, Jae-Soo; Lee, Byung-Wook; Lee, Han-Myung; Ko, Han-Suk; Lee, Kwang-Seok; Kim, Hak-Ro

    2008-01-01

    As increased recognition for a role of an economical carbon-free nuclear energy, it is expected that possibility for introduction and an expansion of nuclear power plants (NPPs) will be increased around the world,1) with pursuing self-reliant nuclear fuel cycle in certain states to secure assurances of nuclear fuel supply. However, the pursuit of sensitive nuclear technology such as enrichment and reprocessing has led to concerns about nuclear proliferation. The disclosure of nuclear black market has threatened the current global nonproliferation regime.2) To respond to these concerns, efforts have been made to overcome the loophole of the existing nuclear nonproliferation regime. In February 2004, US President Bush proposed that nuclear exporters refuse to transfer sensitive nuclear technology to prevent new states from producing fissile material to close a loophole in the NPT.3) Meanwhile as the amount of spent nuclear fuel (SNF) by once-through fuel cycle increases, the US needs multiple repositories by the end of the century.4) In February 2006, therefore, Bush administration announced the Global Nuclear Energy Partnership (GNEP), which can bring about expansion of nuclear energy including SNF management while decreasing the risk of nuclear proliferation. It is expected that the GNEP will have an effect on national nuclear programs of participating countries as well as nuclear international cooperation. In this regard, this paper discusses the implication of the GNEP and its prospects

  1. Online customer experience: Implications for digital banking

    Directory of Open Access Journals (Sweden)

    Štavljanin Velimir

    2017-01-01

    Full Text Available Banks will be facing great challenges in the coming period. Some of these challenges are a lack of differentiation, disloyal customers, new non-traditional competitors, increased interaction and expectations from digital channels. Many consulting firms, but also the academic community, propose a solution in the form of implementing the concept of customer experience management. As research shows that a large number of challenges come from the online environment, it is necessary for banks to ensure excellence in the online environment by applying the concept of online customer experience. In order to create this experience, it is up to the banks to meet all the necessary antecedents, which can involve the elements in terms of control, processes and content. This can be a very difficult job if one is unfamiliar with the basics, but it could also be a rewarding job which will reflect on the business performance. Although the focus of the paper is online customer experience, even in the developed countries 'digital' customers are rare. Most of them are multichannel oriented and an important aspect is the multichannel integration and the strategy focused on customer experience. This paper presents an overview of the literature in the field of online customer experience, with the aim of introducing the public with the concept as well as presenting the implications which this concept has for digital banking.

  2. Conservation Documentation and the Implications of Digitisation

    Directory of Open Access Journals (Sweden)

    Michelle Moore

    2001-11-01

    Full Text Available Conservation documentation can be defined as the textual and visual records collected during the care and treatment of an object. It can include records of the object's condition, any treatment done to the object, any observations or conclusions made by the conservator as well as details on the object's past and present environment. The form of documentation is not universally agreed upon nor has it always been considered an important aspect of the conservation profession. Good documentation tells the complete story of an object thus far and should provide as much information as possible for the future researcher, curator, or conservator. The conservation profession will benefit from digitising its documentation using software such as databases and hardware like digital cameras and scanners. Digital technology will make conservation documentation more easily accessible, cost/time efficient, and will increase consistency and accuracy of the recorded data, and reduce physical storage space requirements. The major drawback to digitising conservation records is maintaining access to the information for the future; the notorious pace of technological change has serious implications for retrieving data from any machine- readable medium.

  3. Atropa belladonna neurotoxicity: Implications to neurological disorders.

    Science.gov (United States)

    Kwakye, Gunnar F; Jiménez, Jennifer; Jiménez, Jessica A; Aschner, Michael

    2018-06-01

    Atropa belladonna, commonly known as belladonna or deadly nightshade, ranks among one of the most poisonous plants in Europe and other parts of the world. The plant contains tropane alkaloids including atropine, scopolamine, and hyoscyamine, which are used as anticholinergics in Food and Drug Administration (FDA) approved drugs and homeopathic remedies. These alkaloids can be very toxic at high dose. The FDA has recently reported that Hyland's baby teething tablets contain inconsistent amounts of Atropa belladonna that may have adverse effects on the nervous system and cause death in children, thus recalled the product in 2017. A greater understanding of the neurotoxicity of Atropa belladonna and its modification of genetic polymorphisms in the nervous system is critical in order to develop better treatment strategies, therapies, regulations, education of at-risk populations, and a more cohesive paradigm for future research. This review offers an integrated view of the homeopathy and neurotoxicity of Atropa belladonna in children, adults, and animal models as well as its implications to neurological disorders. Particular attention is dedicated to the pharmaco/toxicodynamics, pharmaco/toxicokinetics, pathophysiology, epidemiological cases, and animal studies associated with the effects of Atropa belladonna on the nervous system. Additionally, we discuss the influence of active tropane alkaloids in Atropa belladonna and other similar plants on FDA-approved therapeutic drugs for treatment of neurological disorders. Copyright © 2018. Published by Elsevier Ltd.

  4. Prostate cancer epigenetics and its clinical implications.

    Science.gov (United States)

    Yegnasubramanian, Srinivasan

    2016-01-01

    Normal cells have a level of epigenetic programming that is superimposed on the genetic code to establish and maintain their cell identity and phenotypes. This epigenetic programming can be thought as the architecture, a sort of cityscape, that is built upon the underlying genetic landscape. The epigenetic programming is encoded by a complex set of chemical marks on DNA, on histone proteins in nucleosomes, and by numerous context-specific DNA, RNA, protein interactions that all regulate the structure, organization, and function of the genome in a given cell. It is becoming increasingly evident that abnormalities in both the genetic landscape and epigenetic cityscape can cooperate to drive carcinogenesis and disease progression. Large-scale cancer genome sequencing studies have revealed that mutations in genes encoding the enzymatic machinery for shaping the epigenetic cityscape are among the most common mutations observed in human cancers, including prostate cancer. Interestingly, although the constellation of genetic mutations in a given cancer can be quite heterogeneous from person to person, there are numerous epigenetic alterations that appear to be highly recurrent, and nearly universal in a given cancer type, including in prostate cancer. The highly recurrent nature of these alterations can be exploited for development of biomarkers for cancer detection and risk stratification and as targets for therapeutic intervention. Here, we explore the basic principles of epigenetic processes in normal cells and prostate cancer cells and discuss the potential clinical implications with regards to prostate cancer biomarker development and therapy.

  5. Prostate cancer epigenetics and its clinical implications

    Directory of Open Access Journals (Sweden)

    Srinivasan Yegnasubramanian

    2016-01-01

    Full Text Available Normal cells have a level of epigenetic programming that is superimposed on the genetic code to establish and maintain their cell identity and phenotypes. This epigenetic programming can be thought as the architecture, a sort of cityscape, that is built upon the underlying genetic landscape. The epigenetic programming is encoded by a complex set of chemical marks on DNA, on histone proteins in nucleosomes, and by numerous context-specific DNA, RNA, protein interactions that all regulate the structure, organization, and function of the genome in a given cell. It is becoming increasingly evident that abnormalities in both the genetic landscape and epigenetic cityscape can cooperate to drive carcinogenesis and disease progression. Large-scale cancer genome sequencing studies have revealed that mutations in genes encoding the enzymatic machinery for shaping the epigenetic cityscape are among the most common mutations observed in human cancers, including prostate cancer. Interestingly, although the constellation of genetic mutations in a given cancer can be quite heterogeneous from person to person, there are numerous epigenetic alterations that appear to be highly recurrent, and nearly universal in a given cancer type, including in prostate cancer. The highly recurrent nature of these alterations can be exploited for development of biomarkers for cancer detection and risk stratification and as targets for therapeutic intervention. Here, we explore the basic principles of epigenetic processes in normal cells and prostate cancer cells and discuss the potential clinical implications with regards to prostate cancer biomarker development and therapy.

  6. The public health implications of melioidosis

    Directory of Open Access Journals (Sweden)

    Timothy J.J. Inglis

    Full Text Available Melioidosis, which is caused by the bacterium Burkholderia pseudomallei, is a potentially fatal tropical infection, little known outside its main endemic zone of Southeast Asia and northern Australia. Though it has received more attention in recent years on account of its claimed suitability as a biological weapon agent, the principal threat from melioidosis is a result of naturally occurring events. Occasional case clusters, sporadic cases outside the known endemic zone and infections in unusual demographic groups highlight a changing epidemiology. As melioidosis is the result of an environmental encounter and not person-to-person transmission, subtle changes in its epidemiology indicate a role environmental factors, such as man-made disturbances of soil and surface water. These have implications for travel, occupational and tropical medicine and in particular for risk assessment and prevention. Practical problems with definitive laboratory diagnosis, antibiotic treatment and the current lack of a vaccine underline the need for prevention through exposure avoidance and other environmental health measures. It is likely that the increasing population burden of the tropical zone and extraction of resources from the humid tropics will increase the prevalence of melioidosis. Climate change-driven extreme weather events will both increase the prevalence of infection and gradually extend its main endemic zone.

  7. [Hepatitis E virus: Blood transfusion implications].

    Science.gov (United States)

    Gallian, P; Piquet, Y; Assal, A; Djoudi, R; Chiaroni, J; Izopet, J; Tiberghien, P

    2014-11-01

    Hepatitis E virus (HEV) is a non-enveloped RNA virus transmitted by the fecal-oral route. Autochthonous hepatitis E occurring in developed countries is caused by genotypes 3 and 4 and is a zoonotic infection. Humans are infected mostly after ingestion of undercooked meat from infected animals. Most HEV 3 and 4 infections are clinically inapparent. However, genotype 3 (HEV 3) can lead to chronic hepatitis in immuno-compromised patients such as organ-transplant recipients and patients with haematological malignancies. In Europe, HEV 3 is implicated in transfusion-transmitted HEV infection. In France, as observed in several European countries, prevalence of HEV RNA and specific IgG antibodies are high indicating that viral circulation is important. The systematic HEV NAT screening of blood donations used for preparation of solvent detergent plasma indicate that 1 to 2218 donation is infected by HEV RNA. The need or implementation's impacts of safety measures to prevent HEV transmission by blood transfusion are under reflexion by French's health authorities. The HEV NAT screening is the only available tool of prevention. Alternative strategies are under investigation including individual or mini pool NAT testing all or part of blood donations. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  8. [Clinical implications of polycystic ovary syndrome].

    Science.gov (United States)

    Dravecká, Ingrid

    Polycystic ovary syndrome (PCOS) is a heterogeneous and complex endocrine disease which among the female population belongs to the most widespread endocrinopathies and it is the most frequent cause of hyperthyroidism, anticoagulation and infertility. Insulin resistance is one of the important diabetology factors impacting hyperglycaemia in a majority of women with PCOS (60-80 %). Clinical expressions of PCOS include reproduction disorders, metabolic characteristics and psychological implications. Reproduction disorders include hyperthyroidism, menstruation cycle disorders, infertility and pregnancy complications as well as early abortions, gestational diabetes and pregnancy induced hypertension. Long-term metabolic risks of PCOS include type 2 diabetes mellitus, dyslipidemia, arterial hypertension and endothelial dysfunction. The available data confirms higher incidence of cardiovascular diseases in women with PCOS. In particular among obese women PCOS is more frequently associated with non-alcoholic hepatic steatosis, sleep apnoea syndrome and endometrial cancer. The literature includes some controversial data about the relationship between PCOS and autoimmunity. Women with PCOS are more prone to suffer from insufficient confidence with higher incidence of anxiety, depression, bipolar disorder and eating disorders. autoimmunity - diabetes mellitus - pregnancy - insulin resistance - metabolic syndrome - menstrual disorders - polycystic ovary syndrome.

  9. Effects of Odor on Emotion, with Implications

    Directory of Open Access Journals (Sweden)

    Mikiko eKadohisa

    2013-10-01

    Full Text Available The sense of smell is found widely in the animal kingdom. Human and animal studies show that odor perception is modulated by experience and/or physiological state (such as hunger, and that some odors can arouse emotion, and can lead to the recall of emotional memories. Further, odors can influence psychological and physiological states. Individual odorants are mapped via gene-specified receptors to corresponding glomeruli in the olfactory bulb, which directly projects to the piriform cortex and the amygdala without a thalamic relay. The odors to which a glomerulus responds reflect the chemical structure of the odorant. The piriform cortex and the amygdala both project to the orbitofrontal cortex which with the amygdala is involved in emotion and associative learning, and to the entorhinal/hippocampal system which is involved in long-term memory including episodic memory. Evidence that some odors can modulate emotion and cognition is described, and the possible implications for the treatment of psychological problems, for example in reducing the effects of stress, are considered.

  10. Environmental implications of carbon limits on market ...

    Science.gov (United States)

    Combined heat and power (CHP) is promoted as an economical, energy-efficient option for combating climate change. To fully examine the viability of CHP as a clean-technology solution, its market potential and impacts need to be analyzed as part of scenarios of the future energy system, particularly those with policies limiting greenhouse gas (GHG) emissions. This paper develops and analyzes scenarios using a bottom-up, technology rich optimization model of the U.S. energy system. Two distinct carbon reduction goals were set up for analysis. In Target 1, carbon emission reduction goals were only included for the electric sector. In Target 2, carbon emission reduction goals were set across the entire energy system with the target patterned after the U.S.’s commitment to reducing GHG emissions as part of the Paris Agreement reached at the COP21 summit. From a system-wide carbon reduction standpoint, Target 2 is significantly more stringent. In addition, these scenarios examine the implications of various CHP capacity expansion and contraction assumptions and energy prices. The largest CHP capacity expansion are observed in scenarios that included Target 1, but investments were scaled back in scenarios that incorporated Target 2. The latter scenario spurred rapid development of zero-emissions technologies within the electric sector, and purchased electricity increased dramatically in many end-use sectors. The results suggest that CHP may play a role in a carbon-c

  11. Surgical orodental implications in ankylosing spondylitis

    Directory of Open Access Journals (Sweden)

    Mohammad Mehdizadeh

    2012-01-01

    Full Text Available Temporomandibular joint and the pelvic complex are bidirectionally related. Ankylosing spondylitis (AS is a seronegative arthropathy with the key feature of bony fusion of lumbar vertebrae. A 39 year old known case of AS was presented to private office for left lower impacted third molar surgical removal. Previously, he was rejected to receive oral care for pulpectomy and extraction due to limited mouth opening. Prior to the surgery, lateral neck radiography was obtained to exclude any subluxation of fracture of cervical vertebrae. Neck was supported to insure neck stability during surgical forces. In addition, considering consumption of immunosuppressive medications including corticosteroids, procedure was performed with a great care, with attention to higher possibility of infection and fracture. Access to the surgical site was not desirable, though surgery accomplished without any significant event and the patient discharged with routine analgesic and antibiotics recommendation. Sometimes, impaired access to the oral cavity in patients with AS leads to receive suboptimal or minimal orodental care. Long list of dental implications in these patients may be simplified by considering of careful neck and jaw support, applying at least possible forces and great attention to the infection control rules. It is wised to be performed under patient and skilled hands.

  12. Environmental implications and applications of engineered ...

    Science.gov (United States)

    This review focus on environmental implications and applications of engineered magnetite (Fe3O4) nanoparticles (MNPs) as a single phase or a component of a hybrid nanocomposite that take advantages of their superparamagnetism and high surface area. MNPs are synthesized via co-precipitation, thermal decomposition, hydrothermal process, emulsion, and microbial process. Aggregation/sedimentation and transport of MNPs depend on surface charge of MNPs and geochemical parameters such as pH, ionic strength, and organic matter. MNPs generally have low toxicity to humans and ecosystem. MNPs are used for making excellent anode electrode materials in lithium-ion battery, for constructing biosensors, and for catalyzing a variety of chemical reactions. MNPs are used for air cleanup and carbon sequestration. MNP nanocomposites are made as antimicrobial agent for water disinfection and flocculants for water treatment. Conjugated MNPs are widely used for adsorptive/separative removal of organics, dye, oil, arsenic, Cr(VI), heavy metals, radionuclides, and rare earth elements. MNPs can degrade organic/inorganic contaminants via chemical reduction or oxidation in water, sediment, and soil. Future studies should further explore mechanisms of MNP interactions with other nanomaterials and contaminants, economic and green approaches of MNP synthesis, and field scale demonstration of MNP utilization. Submit to Journal of Hazardous Materials.

  13. Microsporogenesis of Cycas and its systematic implications

    Institute of Scientific and Technical Information of China (English)

    Hua-Fen ZHANG; Hai-Bo OUYANG; Jin-Yan DU; Shou-Zhou ZHANG; Yong LI; Hong WU

    2012-01-01

    Taxonomists are divided over the infrageneric classification and species delimitation within the genus Cycas.The division is largely determined by whether a broad or narrow species concept is adopted,the latter approach being based on apparently minor morphological differences.It is well known that cytokinesis in the cells of pollen provides important evidence for plant taxonomy,particularly at the higher taxonomic level.Here we present the first broad comparison of the cytokinesis of male meiosis in five species of Cycas.A comparative analysis of microsporogenesis in Cycas was carried out using conventional microscopy,semi-thin sectioning,histochemistry,and fluorescence microscopy with a focus on the cytokinesis of meiosis in the pollen of dividing cells.Our observations confirmed that,contrary to previous reports,the cytokinesis in male meiosis of five species in Cycas is simultaneous at the end of second meiosis.The basic model of microsporogenesis and its systematic implications in Cycas is discussed based both on previous reports and our new results.

  14. Neutrino masses and mixing: evidence and implications

    International Nuclear Information System (INIS)

    Gonzalez-Garcia, M.C.; Nir, Yosef

    2003-01-01

    Measurements of various features of the fluxes of atmospheric and solar neutrinos have provided evidence for neutrino oscillations and therefore for neutrino masses and mixing. The authors review the phenomenology of neutrino oscillations in vacuum and in matter. They present the existing evidence from solar and atmospheric neutrinos as well as the results from laboratory searches, including the final status of the Liquid Scintillator Neutrino Detector (LSND) experiment. The theoretical inputs that are used to interpret the experimental results are described in terms of neutrino oscillations. The allowed ranges for the mass and mixing parameters are derived in two frameworks: First, each set of observations is analyzed separately in a two-neutrino framework; Second, the data from solar and atmospheric neutrinos are analyzed in a three-active-neutrino framework. The theoretical implications of these results are then discussed, including the existence of new physics, the estimate of the scale of this new physics, and the lessons for grand unified theories, for models of extra dimensions and singlet fermions in the bulk, and for flavor models

  15. Cosmological implications of primordial black holes

    Energy Technology Data Exchange (ETDEWEB)

    Luis Bernal, José; Bellomo, Nicola; Raccanelli, Alvise; Verde, Licia, E-mail: joseluis.bernal@icc.ub.edu, E-mail: nicola.bellomo@icc.ub.edu, E-mail: alvise@icc.ub.edu, E-mail: liciaverde@icc.ub.edu [ICC, University of Barcelona, IEEC-UB, Martí i Franquès, 1, E08028 Barcelona (Spain)

    2017-10-01

    The possibility that a relevant fraction of the dark matter might be comprised of Primordial Black Holes (PBHs) has been seriously reconsidered after LIGO's detection of a ∼ 30 M {sub ⊙} binary black holes merger. Despite the strong interest in the model, there is a lack of studies on possible cosmological implications and effects on cosmological parameters inference. We investigate correlations with the other standard cosmological parameters using cosmic microwave background observations, finding significant degeneracies, especially with the tilt of the primordial power spectrum and the sound horizon at radiation drag. However, these degeneracies can be greatly reduced with the inclusion of small scale polarization data. We also explore if PBHs as dark matter in simple extensions of the standard ΛCDM cosmological model induces extra degeneracies, especially between the additional parameters and the PBH's ones. Finally, we present cosmic microwave background constraints on the fraction of dark matter in PBHs, not only for monochromatic PBH mass distributions but also for popular extended mass distributions. Our results show that extended mass distribution's constraints are tighter, but also that a considerable amount of constraining power comes from the high-ℓ polarization data. Moreover, we constrain the shape of such mass distributions in terms of the correspondent constraints on the PBH mass fraction.

  16. Microbiological implications of the food irradiation process

    International Nuclear Information System (INIS)

    Teufel, P.

    1981-01-01

    The Joint FAO/IAEA/WHO Expert Committee on the wholesomeness of irradiated food which met in 1976 concluded after a detailed and critical review of the available information, that the microbiological aspects of food irradiation were fully comparable to those of conventional processes used in modern food technology. Processing of food by irradiation may be considered from the microbiological point of view as separate procedures: high dose treatment (> 10 kGy), for sterilisation (radappertization) and low dose treatment (< 10 kGy) for pasteurisation (radicidation, radurization), (for definitions see p. 43), disinfestation, or inhibition of sprouting. No public health hazards related to micro-organisms arise from high dose irradiation because this process results in commercially sterile products. On the other hand, it is important to consider the possible microbiological hazards when food is irradiated with a low dose. The microbiological implications relate to the natural radiation resistance of bacteria, yeasts, fungi and viruses or to the mutagenic effects of ionising radiation in micro-organisms. Both areas of concern were reviewed in detail by Ingram and Ingram and Farkas. (orig.)

  17. Comprehensive Map of Molecules Implicated in Obesity.

    Directory of Open Access Journals (Sweden)

    Jaisri Jagannadham

    Full Text Available Obesity is a global epidemic affecting over 1.5 billion people and is one of the risk factors for several diseases such as type 2 diabetes mellitus and hypertension. We have constructed a comprehensive map of the molecules reported to be implicated in obesity. A deep curation strategy was complemented by a novel semi-automated text mining system in order to screen 1,000 full-length research articles and over 90,000 abstracts that are relevant to obesity. We obtain a scale free network of 804 nodes and 971 edges, composed of 510 proteins, 115 genes, 62 complexes, 23 RNA molecules, 83 simple molecules, 3 phenotype and 3 drugs in "bow-tie" architecture. We classify this network into 5 modules and identify new links between the recently discovered fat mass and obesity associated FTO gene with well studied examples such as insulin and leptin. We further built an automated docking pipeline to dock orlistat as well as other drugs against the 24,000 proteins in the human structural proteome to explain the therapeutics and side effects at a network level. Based upon our experiments, we propose that therapeutic effect comes through the binding of one drug with several molecules in target network, and the binding propensity is both statistically significant and different in comparison with any other part of human structural proteome.

  18. Monitoring gaseous exchange: implications for nursing care.

    Science.gov (United States)

    Martin, Susan; Wilson, Michael

    2002-02-01

    The purpose of this study is to examine whether a relationship exists between arterial and end-tidal carbon dioxide tension (PaCO2 and PETCO2 respectively) in patients admitted to intensive care units (ICUs), and what the implications it has for nursing care. PaCO2 and PETCO2 are indicators of ventilatory adequacy which is an important aspect of respiratory function. These measures of carbon dioxide tension are obtained via invasive and non-invasive monitoring tools. Measurement of PETCO2 has only recently been introduced into ICUs and its usefulness in these environments is open to debate. A population of 30 intubated patients had 214 simultaneous measurements of PaCO2 and PETCO2 taken over a period of 10 months. The findings indicate that, despite strong significant correlations, PETCO2 cannot be used safely as a substitute for PaCO2 as the arterial/end-tidal carbon dioxide gradient is not constant, nor does capnography provide a consistently reliable indicator of PaCO2.

  19. Atherosclerosis in epilepsy: its causes and implications.

    Science.gov (United States)

    Hamed, Sherifa A

    2014-12-01

    Evidence from epidemiological, longitudinal, prospective, double-blinded clinical trials as well as case reports documents age-accelerated atherosclerosis with increased carotid artery intima media thickness (CA-IMT) in patients with epilepsy. These findings raise concern regarding their implications for age-accelerated cognitive and behavioral changes in midlife and risk of later age-related cognitive disorders including neurodegenerative processes such as Alzheimer's disease (AD). Chronic epilepsy, cerebral atherosclerosis, and age-related cognitive disorders including AD share many clinical manifestations (e.g. characteristic cognitive deficits), risk factors, and structural and pathological brain abnormalities. These shared risk factors include increased CA-IMT, hyperhomocysteinemia (HHcy), lipid abnormalities, weight gain and obesity, insulin resistance (IR), and high levels of inflammatory and oxidative stresses. The resulting brain structural and pathological abnormalities include decreased volume of the hippocampus, increased cortical thinning of the frontal lobe, ventricular expansion and increased white matter ischemic disease, total brain atrophy, and β-amyloid protein deposition in the brain. The knowledge that age-accelerated atherosclerosis may contribute to age-accelerated cognitive and behavioral abnormalities and structural brain pathologies in patients with chronic epilepsy represents an important research path to pursue future clinical and management considerations. Copyright © 2014 Elsevier Inc. All rights reserved.

  20. Science and religion: implications for science educators

    Science.gov (United States)

    Reiss, Michael J.

    2010-03-01

    A religious perspective on life shapes how and what those with such a perspective learn in science; for some students a religious perspective can hinder learning in science. For such reasons Staver's article is to be welcomed as it proposes a new way of resolving the widely perceived discord between science and religion. Staver notes that Western thinking has traditionally postulated the existence and comprehensibility of a world that is external to and independent of human consciousness. This has led to a conception of truth, truth as correspondence, in which our knowledge corresponds to the facts in this external world. Staver rejects such a conception, preferring the conception of truth as coherence in which the links are between and among independent knowledge claims themselves rather than between a knowledge claim and reality. Staver then proposes constructivism as a vehicle potentially capable of resolving the tension between religion and science. My contention is that the resolution between science and religion that Staver proposes comes at too great a cost—both to science and to religion. Instead I defend a different version of constructivism where humans are seen as capable of generating models of reality that do provide richer and more meaningful understandings of reality, over time and with respect both to science and to religion. I argue that scientific knowledge is a subset of religious knowledge and explore the implications of this for science education in general and when teaching about evolution in particular.

  1. The compression dome concept: the restorative implications.

    Science.gov (United States)

    Milicich, Graeme

    2017-01-01

    Evidence now supports the concept that the enamel on a tooth acts like a compression dome, much like the dome of a cathedral. With an overlying enamel compression dome, the underlying dentin is protected from damaging tensile forces. Disruption of a compression system leads to significant shifts in load pathways. The clinical restorative implications are significant and far-reaching. Cutting the wrong areas of a tooth exposes the underlying dentin to tensile forces that exceed natural design parameters. These forces lead to crack propagation, causing flexural pain and eventual fracture and loss of tooth structure. Improved understanding of the microanatomy of tooth structure and where it is safe to cut teeth has led to a revolution in dentistry that is known by several names, including microdentistry, minimally invasive dentistry, biomimetic dentistry, and bioemulation dentistry. These treatment concepts have developed due to a coalescence of principles of tooth microanatomy, material science, adhesive dentistry, and reinforcing techniques that, when applied together, will allow dentists to repair a compromised compression dome so that it more closely replicates the structure of the healthy tooth.

  2. Implications of recurrent disturbance for genetic diversity.

    Science.gov (United States)

    Davies, Ian D; Cary, Geoffrey J; Landguth, Erin L; Lindenmayer, David B; Banks, Sam C

    2016-02-01

    Exploring interactions between ecological disturbance, species' abundances and community composition provides critical insights for ecological dynamics. While disturbance is also potentially an important driver of landscape genetic patterns, the mechanisms by which these patterns may arise by selective and neutral processes are not well-understood. We used simulation to evaluate the relative importance of disturbance regime components, and their interaction with demographic and dispersal processes, on the distribution of genetic diversity across landscapes. We investigated genetic impacts of variation in key components of disturbance regimes and spatial patterns that are likely to respond to climate change and land management, including disturbance size, frequency, and severity. The influence of disturbance was mediated by dispersal distance and, to a limited extent, by birth rate. Nevertheless, all three disturbance regime components strongly influenced spatial and temporal patterns of genetic diversity within subpopulations, and were associated with changes in genetic structure. Furthermore, disturbance-induced changes in temporal population dynamics and the spatial distribution of populations across the landscape resulted in disrupted isolation by distance patterns among populations. Our results show that forecast changes in disturbance regimes have the potential to cause major changes to the distribution of genetic diversity within and among populations. We highlight likely scenarios under which future changes to disturbance size, severity, or frequency will have the strongest impacts on population genetic patterns. In addition, our results have implications for the inference of biological processes from genetic data, because the effects of dispersal on genetic patterns were strongly mediated by disturbance regimes.

  3. The Greek crisis: Causes and implications

    Directory of Open Access Journals (Sweden)

    Vlamis Prodromos

    2010-01-01

    Full Text Available This paper presents and critically discusses the origins and causes of the Greek fiscal crisis and its implications for the euro currency as well as the SEE economies. In the aftermath of the 2007-2009 financial crisis the enormous increase in sovereign debt has emerged as an important negative outcome, since public debt was dramatically increased in an effort by the US and the European governments to reduce the accumulated growth of private debt in the years preceding the recent financial turmoil. Although Greece is the country member of the eurozone that has been in the middle of this ongoing debt crisis, since November 2009 when it was made clear that its budget deficit and mainly its public debt were not sustainable, Greece’s fiscal crisis is not directly linked to the 2007 US subprime mortgage loan market crisis. As a result of this negative downturn the Greek government happily accepted a rescue plan of 110 billion euros designed and financed by the European Union and the IMF. A lengthy austerity programme and a fiscal consolidation plan have been put forward and are to be implemented in the next three years.

  4. Environmental implications of increased biomass energy use

    Energy Technology Data Exchange (ETDEWEB)

    Miles, T.R. Sr.; Miles, T.R. Jr. (Miles (Thomas R.), Portland, OR (United States))

    1992-03-01

    This study reviews the environmental implications of continued and increased use of biomass for energy to determine what concerns have been and need to be addressed and to establish some guidelines for developing future resources and technologies. Although renewable biomass energy is perceived as environmentally desirable compared with fossil fuels, the environmental impact of increased biomass use needs to be identified and recognized. Industries and utilities evaluating the potential to convert biomass to heat, electricity, and transportation fuels must consider whether the resource is reliable and abundant, and whether biomass production and conversion is environmentally preferred. A broad range of studies and events in the United States were reviewed to assess the inventory of forest, agricultural, and urban biomass fuels; characterize biomass fuel types, their occurrence, and their suitability; describe regulatory and environmental effects on the availability and use of biomass for energy; and identify areas for further study. The following sections address resource, environmental, and policy needs. Several specific actions are recommended for utilities, nonutility power generators, and public agencies.

  5. Statistical implications in Monte Carlo depletions - 051

    International Nuclear Information System (INIS)

    Zhiwen, Xu; Rhodes, J.; Smith, K.

    2010-01-01

    As a result of steady advances of computer power, continuous-energy Monte Carlo depletion analysis is attracting considerable attention for reactor burnup calculations. The typical Monte Carlo analysis is set up as a combination of a Monte Carlo neutron transport solver and a fuel burnup solver. Note that the burnup solver is a deterministic module. The statistical errors in Monte Carlo solutions are introduced into nuclide number densities and propagated along fuel burnup. This paper is towards the understanding of the statistical implications in Monte Carlo depletions, including both statistical bias and statistical variations in depleted fuel number densities. The deterministic Studsvik lattice physics code, CASMO-5, is modified to model the Monte Carlo depletion. The statistical bias in depleted number densities is found to be negligible compared to its statistical variations, which, in turn, demonstrates the correctness of the Monte Carlo depletion method. Meanwhile, the statistical variation in number densities generally increases with burnup. Several possible ways of reducing the statistical errors are discussed: 1) to increase the number of individual Monte Carlo histories; 2) to increase the number of time steps; 3) to run additional independent Monte Carlo depletion cases. Finally, a new Monte Carlo depletion methodology, called the batch depletion method, is proposed, which consists of performing a set of independent Monte Carlo depletions and is thus capable of estimating the overall statistical errors including both the local statistical error and the propagated statistical error. (authors)

  6. Framework and implications of virtual neurorobotics

    Directory of Open Access Journals (Sweden)

    2008-07-01

    Full Text Available Despite decades of societal investment in artificial learning systems, truly “intelligent” systems have yet to be realized. These traditional models are based on input-output pattern optimization and/or cognitive production rule modeling. One response has been social robotics, using the interaction of human and robot to capture important cognitive dynamics such as cooperation and emotion; to date, these systems still incorporate traditional learning algorithms. More recently, investigators are focusing on the core assumptions of the brain “algorithm” itself—trying to replicate uniquely “neuromorphic” dynamics such as action potential spiking and synaptic learning. Only now are large-scale neuromorphic models becoming feasible, due to the availability of powerful supercomputers and an expanding supply of parameters derived from research into the brain’s interdependent electrophysiological, metabolomic and genomic networks. Personal computer technology has also led to the acceptance of computer-generated humanoid images, or “avatars”, to represent intelligent actors in virtual realities. In a recent paper, we proposed a method of virtual neurorobotics (VNR in which the approaches above (social-emotional robotics, neuromorphic brain architectures, and virtual reality projection are hybridized to rapidly forward-engineer and develop increasingly complex, intrinsically intelligent systems. In this paper, we synthesize our research and related work in the field and provide a framework for VNR, with wider implications for research and practical applications.

  7. Relative age effect: implications for effective practice.

    Science.gov (United States)

    Andronikos, Georgios; Elumaro, Adeboye Israel; Westbury, Tony; Martindale, Russell J J

    2016-01-01

    Physical and psychological differences related to birthdate amongst athletes of the same selection year have been characterised as the "relative age effects" (RAEs). RAEs have been identified in a variety of sports, both at youth and adult level, and are linked with dropout of athletes and a reduction of the talent pool. This study examined the existence, mechanisms and possible solutions to RAEs using qualitative methodology. Seven experts in the field of talent identification and development were interviewed. Inductive analysis of the data showed that, while there was mixed evidence for the existence of RAEs across sports, the eradication of RAEs was attributed to controllable features of the development environment. The factors reported included the structure of "categories" used to group athletes within the sport (e.g. age, weight, size, skills), recognition and prioritisation of long-term development over "short term win focus." Education of relevant parties (e.g. coaches, scouts, clubs) about RAEs and the nature of "talent" within a long-term context was suggested, along with careful consideration of the structure of the development environment (e.g. delayed selection, provision for late developers, focus on skills not results, use of challenge). Implications for research and practice are discussed.

  8. Legal implications of genetics and crime research.

    Science.gov (United States)

    Denno, D W

    1996-01-01

    Two controversial topics dominate discussions of the legal implications of genetics and crime research; (1) the viability and politics of such research, which has sparked fervent debate in the USA; and (2) the current status of new or atypical criminal law defences, which would include a genetic-defect defence to criminal behaviour. This chapter begins by examining the scientifically discredited XYY chromosome syndrome defence, the major genetic-defect defence that defendants have attempted, albeit unsuccessfully. It then focuses on attorneys' efforts to test for evidence of genetic abnormality in the recent and highly publicized case involving convicted murderer Stephen Mobley, whose family history reveals four generations of violent, aggressive and behaviourally disordered men and women. Mobley is currently appealing his death sentence before the Georgia Supreme Court on the basis that the trial court denied his request both to have genetic testing performed and to have such testing allowed as evidence into court. This chapter concludes by emphasizing that the question is not whether genetic evidence will ever be admitted into court, but when and under what kinds of circumstances. No doubt, genetic evidence, and comparable kinds of biological evidence, will have a major impact on juries when such evidence is more fully accepted by the legal and scientific communities.

  9. IMPLICATIONS OF ELECTRONIC COMMERCE LAW IN ROMANIA

    Directory of Open Access Journals (Sweden)

    Alice Cîrstea

    2014-11-01

    Full Text Available Abstract We live in an environment in which e-commerce continues to grow and evolve while state legislators attempt to catch up to the ever-changing technology. Today electronic transactions are more and more frequently supplementing or even entirely replacing traditional channels and business models. Even though, in theory, is easy to apply laws to Internet, in practice is harder. This article synthesizes a number of issues on the application of Romanian legislation on ecommerce and offers practical solutions both to managers and to authorities. The article use quantitative and qualitative methods in order to identify the information provided by catering web sites to their consumers in Romania, compared to United Kingdom. The research results raise question marks about how is written and applied Internet law in Romania and also about the limitations of Romanian electronic commerce legislation. Also it shows how companies fail to comply with applicable legislation and to attract their consumers. Managerial implications related to these findings are provided and future studies are encouraged to be investigated.

  10. A neurophysiological approach to tinnitus: clinical implications.

    Science.gov (United States)

    Jastreboff, P J; Hazell, J W

    1993-02-01

    This paper presents a neurophysiological approach to tinnitus and discusses its clinical implications. A hypothesis of discordant damage of inner and outer hair cells systems in tinnitus generation is outlined. A recent animal model has facilitated the investigation of the mechanisms of tinnitus and has been further refined to allow for the measurement of tinnitus pitch and loudness. The analysis of the processes involved in tinnitus detection postulates the involvement of an abnormal increase of gain within the auditory system. Moreover, it provides a basis for treating patients with hyperacusis, which we are considering to be a pre-tinnitus state. Analysis of the process of tinnitus perception allows for the possibility of facilitating the process of tinnitus habituation for the purpose of its alleviation. The combining of theoretical analysis with clinical findings has resulted in the creation of a multidisciplinary Tinnitus Centre. The foundation of the Centre focuses on two goals: the clinical goal is to remove tinnitus perception from the patient's consciousness, while directing research toward finding a mechanism-based method for the suppression of tinnitus generators and processes responsible for enhancement of tinnitus-related neuronal activity.

  11. Biological behaviour and clinical implications of micrometastases.

    LENUS (Irish Health Repository)

    Kell, M R

    2012-02-03

    BACKGROUND: The most important prognostic determinant in cancer is the identification of disseminated tumour burden (metastases). Micrometastases are microscopic (smaller than 2 mm) deposits of malignant cells that are segregated spatially from the primary tumour and depend on neovascular formation (angiogenesis) to propagate. METHODS: The electronic literature (1966 to present) on micrometastases and their implications in malignant melanoma and epithelial cancers was reviewed. RESULTS: Immunohistochemical techniques combined with serial sectioning offer the best accuracy for detection of nodal micrometastases. Molecular techniques should be reserved for blood samples or bone marrow aspirates. Detection of micrometastases in regional lymph nodes and\\/or bone marrow confers a poor prognosis in epithelial cancers. The concept of sentinel node biopsy combined with serial sectioning and dedicated screening for micrometastases may improve staging procedures. Strategies against angiogenesis may provide novel therapies to induce and maintain micrometastatic dormancy. CONCLUSION: The concept of micrometastases has resulted in a paradigm shift in the staging of epithelial tumours and our overall understanding of malignant processes.

  12. Origin and implications of bovine spongiform encephalopathy.

    Science.gov (United States)

    Narang, H

    1996-04-01

    All spongiform encephalopathies in animals, including humans, are slow developing infectious diseases. The current working theory links the origin of bovine spongiform encephalopathy (BSE) to the feeding of cattle with meat and bone meal prepared from scrapie-infected sheep remains. Recycling of cattle meat and bones (MBM) essentially resulted in the selection of a single strain from the "wild type", a mixture of 20 strains. The BSE agent is easily transmitted through ingestion, with some evidence of vertical transmission. Paradoxically, cattle have selected a major new strain which appears to be more virulent than an unselected strain found in scrapie sheep. The same strain of BSE agent is implicated in the occurrence of spongiform encephalopathy in domestic cats, tiger, and some exotic species of ruminants in zoos. The properties of BSE and its spread into cattle are still disputed. Since our understanding of the disease and its transmissibility in humans must await observations that will be made over some years to come, it is important to keep a reasonable perspective and ensure that any speculative comment is consistent with fact. In risk assessment in such circumstances, it is tempting give too much credence to persuasive parallels when direct relevant information is not available. On the other hand, it would also not be wise to assume that the disease will die by itself and will have no effect on humans.

  13. Practical implications of the new risk perspectives

    International Nuclear Information System (INIS)

    Aven, Terje

    2013-01-01

    In recent years several authors have argued for the adoption of certain new types of risk perspectives which highlight uncertainties rather than probabilities in the way risk is understood and measured. The theoretical rationale for these new perspectives is well established, but the practical implications have not been so clearly demonstrated. There is a need to show how the new perspectives change the way risk is described and communicated in real-life situations and in its turn the effects on risk management and decision making. The present paper aims at contributing to this end by considering two cases, related to a national risk level, and a specific analysis concerning an LNG plant. The paper concludes that the new risk perspectives influence the current regime in many ways, in particular the manner in which the knowledge dimension is described and dealt with. Two methods for characterising the strength of knowledge are presented, one of them based on a new concept, the “assumption deviation risk”, reflecting risks related to the deviations from the conditions/states defined by the assumption made

  14. ORF Alignment: NC_002754 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... solfataricus ... Length = 120 ... Query: 117 VKGSVEGISKDAIVVQPFTKISTCIETMLKNNIRHLPIVNGIALGIVSARDIA...YSYDSVT 176 ... VKGSVEGISKDAIVVQPFTKISTCIETMLKNNIRHLPIVNGIALGIVSARDIAYSYDSVT Sbjct: 1 ... VKGSVEGISKDAIVVQPFTKISTCIETMLKNNIRHLPIVNGIALGIVSARDIAYSYDSVT 60 ...

  15. Clinical Ethics Consultation After God: Implications for Advocacy and Neutrality.

    Science.gov (United States)

    Parker, J Clint

    2018-06-01

    In After God: Morality and Bioethics in a Secular Age, H. Tristram Engelhardt, Jr. explores the broad implications for moral reasoning once a culture has lost a God's-eye perspective. In this paper, I focus on the implications of Engelhardt's views for clinical ethics consultation. I begin by examining the question of whether clinical ethics consultants (CECs) should advocate a particular viewpoint and/or process during consultations or adopt a neutral stance. I then examine the implications of Engelhardt's views for this question. Finally, I discuss some of Engelhardt's foundational ontological, metaphysical, meta-ethical, and epistemological commitments and how these commitments connect to his views on clinical ethics consultation.

  16. Knowledge of, beliefs about and attitudes to disability: implications ...

    African Journals Online (AJOL)

    Knowledge of, beliefs about and attitudes to disability: implications for health ... communities often only learnt about disability following the birth of a disabled child. ... to education and the availability of transport, particularly amongst caregivers ...

  17. Technical limitations of African prints and their implications

    African Journals Online (AJOL)

    User

    THEIR IMPLICATIONS ON GARMENT CONSTRUCTION IN. GHANA ... economic growth throughout the world. In. 2001, the sector ... and its exports represent 45 billion Euros, mak- ing it the world's ..... Unpublished BA Thesis,. College of Art ...

  18. Satirical drama, political corruption and development implications for ...

    African Journals Online (AJOL)

    Satirical drama, political corruption and development implications for Nigeria: a reflection on Ola Rotimi's Our husband has gone mad again. ... The corrupt tendencies of this select few, which come in various forms, have ... from 32 Countries:.

  19. Implications of climate change for tourism in Australia

    NARCIS (Netherlands)

    Amelung, B.; Nicholls, S.

    2014-01-01

    This study assesses the impacts of projected climate change on Australia's tourism industry. Based on application of the Tourism Climatic Index, it investigates potential changes in climatic attractiveness for Australia's major destinations, and discusses implications for tourist flows and tourism

  20. Noncommutative black-body radiation: Implications on cosmic microwave background

    International Nuclear Information System (INIS)

    Fatollahi, A.H.; Hajirahimi, M.

    2006-01-01

    Including loop corrections, black-body radiation in noncommutative space is anisotropic. A direct implication of possible space non-commutativity on the cosmic microwave background map is argued. (authors)

  1. Implications of ecological and social characteristics to community ...

    African Journals Online (AJOL)

    Implications of ecological and social characteristics to community livelihoods in the coastal ... African Journal of Environmental Science and Technology ... This will further address conflicts over resource uses that may arise due to livelihood ...

  2. Structuralism: Its Implications for the Performance of Prose Fiction

    Science.gov (United States)

    Hopkins, Mary Francis

    1977-01-01

    Discusses the implications of structuralism by examining "Introduction to The Structural Analysis of Narrative", a contemporary writing by Roland Barthes. Explains Barthes' terms and concepts by using Virginia Woolf's Mrs. Dalloway character for an example. (MH)

  3. Utilization of HIV Testing and Counseling in Ghana: Implications for ...

    African Journals Online (AJOL)

    Utilization of HIV Testing and Counseling in Ghana: Implications for Universal Coverage. ... HIV testing and counselling (HTC) is a gateway to all systems of AIDS-related care. This study examined ... AJOL African Journals Online. HOW TO ...

  4. Micronesian agroforestry: evidence from the past, implications for the future

    Science.gov (United States)

    Marjorie V. C. Falanruw

    1993-01-01

    Traditional agroforest systems exist throughout Micronesia. The system found on one Micronesian group of islands, Yap, is described and evaluated in ecological terms. Implications for future development of agriculture in Micronesia are discussed and some specific recommendations are given.

  5. wax matrix tablets and its implication on dissolution prof

    African Journals Online (AJOL)

    acetaminophen-wax matrix tablet and hence its implication on dissolution profile. Acetaminophen-wax ... inertness, cost effectiveness, non- toxicity and more importantly their ... Liver Poole, England) at constant load (30 arbitrary units on the ...

  6. Dependence on carbonated water: Clinical and policy implications

    Directory of Open Access Journals (Sweden)

    Sumit Kumar Gupta

    2015-01-01

    Full Text Available A case of caffeine dependence syndrome with preference for a specific brand of carbonated water (popularly known as soft drinks or colas is discussed to highlight the clinical and policy implications.

  7. Rethinking Volks V Robinson: The Implications of Applying a ...

    African Journals Online (AJOL)

    Rethinking Volks V Robinson: The Implications of Applying a "Contextaulised Choice Model" to Prospective South African Domestic Partnerships Legislation. ... is enacted. Keywords: Life partnership; domestic partnership; Domestic Partnerships Bill; choice argument; contextualised choice model; reciprocal duty of support.

  8. Development Implications of Liberalization of Trade in Services ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Development Implications of Liberalization of Trade in Services ... disseminated by the United Nations Conference on Trade and Development (UNCTAD). ... The Honourable Chrystia Freeland, Minister of International Trade, announced a ...

  9. Extension Implications of Skill Gaps among Cassava Farmers in the ...

    African Journals Online (AJOL)

    Extension Implications of Skill Gaps among Cassava Farmers in the Niger Delta Region of Nigeria. ... PROMOTING ACCESS TO AFRICAN RESEARCH ... Skill gap analysis indicated 16 areas including packaging of cassava products with ...

  10. Learned-Helplessness Theory: Implications for Research in Learning Disabilities.

    Science.gov (United States)

    Canino, Frank J.

    1981-01-01

    The application of learned helplessness theory to achievement is discussed within the context of implications for research in learning disabilities. Finally, the similarities between helpless children and learning disabled students in terms of problems solving and attention are discussed. (Author)

  11. Concentration and Health Implication of Heavy Metals in Drinking ...

    African Journals Online (AJOL)

    Concentration and Health Implication of Heavy Metals in Drinking Water from Urban ... water is not mentioned by WHO, but all the samples analyzed were found to ... Key words: Drinking water quality, Heavy metals, Maximum admissible limit, ...

  12. Climate Change: Implications for South African Building Systems and Components

    CSIR Research Space (South Africa)

    Gibberd, Jeremy T

    2017-12-01

    Full Text Available to determine the implications of these changes for buildings. Proposals are made on how buildings may be adapted to climate change and recommendations on further research and development are outlined....

  13. changing stm curricula for the information age: implications

    African Journals Online (AJOL)

    TONIA CLARE

    information age, rationale and strategies for changing STM curricular, implications for the teacher and then conclusion. ... learner under the guidance of a school to effect a change in the ..... education international conference. Ofele, C. N. ...

  14. Implications of social judgement theory for persuasive advertising ...

    African Journals Online (AJOL)

    Implications of social judgement theory for persuasive advertising campaigns. ... The way the consumers perceive an advertising campaign will, therefore, determine how they will respond to the advertisement. ... AJOL African Journals Online.

  15. Review of automated vehicle technology : policy and implementation implications.

    Science.gov (United States)

    2016-03-14

    The goals of this project were to undergo a systematic review of automated vehicle technologies with a focus on policy : implications, methods of implementation, regulation by states, and developments occurring on legal fronts, ultimately creating a ...

  16. The use of dexamethasone in animals: implication for fertility ...

    African Journals Online (AJOL)

    Exposure to dexamethasone causes numerous changes in various biological systems including the reproductive system and this has huge implication on fertility and pregnancy. Maternal dexamethasone administration promotes foetal lung maturation and thermoregulation in premature foetuses. This indication makes ...

  17. Philosophy of adult education and the implication for agricultural ...

    African Journals Online (AJOL)

    Philosophy of adult education and the implication for agricultural extension service. ... The paper highlights the relationhip between adult education and extension using the philosophy as a fulcrum between both. The paper further reiterated ...

  18. Software Maintenance and Evolution: The Implication for Software ...

    African Journals Online (AJOL)

    Software Maintenance and Evolution: The Implication for Software Development. ... Software maintenance is the process of modifying existing operational software by correcting errors, ... EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT

  19. Nature of mango anthracnose in Ghana: Implications for the control ...

    African Journals Online (AJOL)

    Nature of mango anthracnose in Ghana: Implications for the control of the disease. ... Mango anthracnose is a major disease hampering the production of quality fruits for export in Ghana. The nature of the disease and ... HOW TO USE AJOL.

  20. Introducing change in organization: implication for human resource ...

    African Journals Online (AJOL)

    Introducing change in organization: implication for human resource ... that one of the most obvious and urgent problems at management level in organizations is ... to change their attitude and behavior as rapidly as their organization requires.

  1. Expertise development in the professions; Implications for teaching and assessment

    NARCIS (Netherlands)

    Boshuizen, Els

    2011-01-01

    Boshuizen, H. P. A. (2011, 30 August - 3 September). Expertise development in the professions; Implications for teaching and assessment. Paper presented at the bi-annual EARLI conferences, Exeter, UK.

  2. The Rational Unconscious: Implications for Mental Illness and Psychotherapy.

    Science.gov (United States)

    Bowins, Brad

    2018-05-15

    Rational and reality-congruent unconscious processes facilitate adaptive functioning and have implications for mental illness and psychotherapy. With this knowledge, psychotherapists can more effectively guide interventions to improve mental health.

  3. implications of decision making process on agricultural employees

    African Journals Online (AJOL)

    This study was designed to determine the implications of decision making process on employees' turnover in the Institute of ... Involvement in Decision Making and Agricultural Employees' Turnover in Ibadan, Nigeria 37 ..... Lack of motivation.

  4. Honeybee colony marketing and its implications for queen rearing ...

    African Journals Online (AJOL)

    Honeybee colony marketing and its implications for queen rearing and beekeeping development in Werieleke ... Thus, colony marketing is an important venture in Werieleke district of Tigray region. ... EMAIL FULL TEXT EMAIL FULL TEXT

  5. Implications for Effective Child Development System in Africa

    African Journals Online (AJOL)

    Nneka Umera-Okeke

    Child Rights Campaign and the Nigerian Family: Implications for Effective Child .... of socialization like: day-care centres, schools, peer groups, video bars, recreational parks and new social media have taken over this role. The outcome is that ...

  6. Keystone Life Orientation (LO) teachers: Implications for educational ...

    African Journals Online (AJOL)

    Keystone Life Orientation (LO) teachers: Implications for educational, social, and ... characteristics and support networks needed by keystone Life Orientation (LO) ... In this study “keystone” refers to LO teachers who make a positive impact in ...

  7. Willingness to pay for rural telephone services: Implications for rural ...

    African Journals Online (AJOL)

    WTP) for rural telephone services and the implications on poverty reduction in Southeast Nigeria. The key research problem was the inability of the telephone providers or regulatory agencies to estimate the amount the people were willing to pay ...

  8. Language practice as games: Implications for sociology of ...

    African Journals Online (AJOL)

    Language practice as games: Implications for sociology of translation in development contexts in Africa. ... Abstract. Drawing from Game Theory, the article conceptualises language practice as games, that is ... AJOL African Journals Online.

  9. Habitat use and implications for avian species in Sambisa game ...

    African Journals Online (AJOL)

    Habitat use and implications for avian species in Sambisa game reserve, Borno state, Nigeria. ... avian species diversity and abundance in Sambisa Game Reserve in Borno State, Sudano-Sahelian vegetation. ... AJOL African Journals Online.

  10. Nuclear debate and its implications in Latin America

    Energy Technology Data Exchange (ETDEWEB)

    Huacuz V, J M

    1977-09-01

    The controversy associated with nuclear power has been grouped into three areas: safety, economics, and availability of uranium. Implications of these factors are discussed in terms of their effects on Third World countries, particularly in Latin America.

  11. attitudes of women to menopause: implications for counselling

    African Journals Online (AJOL)

    Elizabeth

    conforms to society's standards of youth and beauty include low self- esteem, depression and anxiety. .... issue in understanding her attitudes or perception of menopause. Fifty- .... Lippert, L. (1997). Women at midlife: Implications for theories of.

  12. Medicare Part D Roulette, Potential Implications of Random..

    Data.gov (United States)

    U.S. Department of Health & Human Services — Medicare Part D Roulette, Potential Implications of Random Assignment and Plan Restrictions Dual-eligible (Medicare and Medicaid) beneficiaries are randomly assigned...

  13. Child Rearing Practices in Nigeria: Implications for Mental Health ...

    African Journals Online (AJOL)

    Child Rearing Practices in Nigeria: Implications for Mental Health. ... over time are important, especially as this region is undergoing rapid transformation. ... Through policy and aggressive health education, traditional child rearing practices in ...

  14. Implications for environmental health of multiple stressors

    International Nuclear Information System (INIS)

    Mothersill, Carmel; Seymour, Colin

    2009-01-01

    Recent insights into the mechanisms underlying the biological effects of low dose effects of ionising radiation have revealed that similar mechanisms can be induced by chemical stressors in the environment. This means that interactions between radiation and chemicals are likely and that the outcomes following mixed exposures to radiation and chemicals may not be predictable for human health, by consideration of single agent effects. Our understanding of the biological effects of low dose exposure has undergone a major paradigm shift. We now possess technologies which can detect very subtle changes in cells due to small exposures to radiation or other pollutants. We also understand much more now about cell communication, systems biology and the need to consider effects of low dose exposure at different hierarchical levels of organisation from molecules up to and including ecosystems. Furthermore we understand, at least in part, some of the mechanisms which drive low dose effects and which perpetuate these not only in the exposed organism but also in its progeny and in certain cases, its kin. This means that previously held views about safe doses or lack of harmful effects cannot be sustained. The International Commission on Radiological Protection (ICRP) and all national radiation and environmental protection organisations have always accepted a theoretical risk and have applied the precautionary principle and the LNT (linear-non-threshold) model which basically says that there is no safe dose of radiation. Therefore even in the absence of visible effects, exposure of people to radiation is strictly limited. This review will consider the historical context and the new discoveries and will focus on evidence for emergent effects after mixed exposures to combined stressors which include ionising radiation. The implications for regulation of low dose exposures to protect human health and environmental security will be discussed.

  15. The medical implications of space tourism.

    Science.gov (United States)

    Tarzwell, R

    2000-06-01

    Commercial space travel may soon be a reality. If so, microgravity, high acceleration, and radiation exposure, all known hazards, will be accessible to the general public. Therefore, space tourism has medical implications. Even though the first flights will feature space exposure times of only a few minutes, the potential may someday exist for exposure times long enough to warrant careful consideration of the potential hazards to the space-faring public. The effects of acceleration and microgravity exposure are well known on the corps of astronauts and cosmonauts. The effects of space radiation are partially known on astronauts, but much remains to be discovered. However, there are problems using astronaut data to make inferences about the general public. Astronauts are not necessarily representative of the general public, since they are highly fit, highly screened individuals. Astronaut data can tell us very little about the potential hazards of microgravity in pediatric, obstetric and geriatric populations, all of whom are potential space tourists. Key issues in standard setting will be determining acceptable limits of pre-existing disease and inferring medical standards from mission profiles. It will not be a trivial task drafting minimal medical standards for commercial space travel. It will require the collaboration of space medicine physicians, making the best guesses possible, based on limited amounts of data, with limited applicability. A helpful departure point may be the USAF Class 3 medical standard, applicable to NASA payload specialists. It is time to begin preliminary discussions toward defining those standards. acceleration, aerospace medicine, medical standards, microgravity, radiation, space, space tourism, environmental hazards, environmental medicine.

  16. Neurobiology and clinical implications of lucid dreaming.

    Science.gov (United States)

    Mota-Rolim, Sérgio A; Araujo, John F

    2013-11-01

    Several lines of evidence converge to the idea that rapid eye movement sleep (REMS) is a good model to foster our understanding of psychosis. Both REMS and psychosis course with internally generated perceptions and lack of rational judgment, which is attributed to a hyperlimbic activity along with hypofrontality. Interestingly, some individuals can become aware of dreaming during REMS, a particular experience known as lucid dreaming (LD), whose neurobiological basis is still controversial. Since the frontal lobe plays a role in self-consciousness, working memory and attention, here we hypothesize that LD is associated with increased frontal activity during REMS. A possible way to test this hypothesis is to check whether transcranial magnetic or electric stimulation of the frontal region during REMS triggers LD. We further suggest that psychosis and LD are opposite phenomena: LD as a physiological awakening while dreaming due to frontal activity, and psychosis as a pathological intrusion of dream features during wake state due to hypofrontality. We further suggest that LD research may have three main clinical implications. First, LD could be important to the study of consciousness, including its pathologies and other altered states. Second, LD could be used as a therapy for recurrent nightmares, a common symptom of depression and post-traumatic stress disorder. Finally, LD may allow for motor imagery during dreaming with possible improvement of physical rehabilitation. In all, we believe that LD research may clarify multiple aspects of brain functioning in its physiological, altered and pathological states. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

  17. Definitions of fuel poverty: Implications for policy

    International Nuclear Information System (INIS)

    Moore, Richard

    2012-01-01

    This paper outlines why the definition of fuel poverty is important in policy formulation and describes how the Government's current definitions evolved from the original concept. It discusses the determination of income and fuel costs and the possibilities for a relative and common European measure. It examines problems inherent in assessing fuel costs as a percentage of income and puts forward the arguments for a ‘budget standard’ approach. The paper illustrates how the size of the problem depends on the definition and chosen threshold and suggests advantages for a rating scale. It illustrates how the income composition and thresholds also govern the distribution of the target populations and the relative importance of the main causal factors, and examines the consequent policy implications. It explores the definition of vulnerable households and the importance of severity and questions whether the UK fuel poverty strategy is targeted at households least able to afford their fuel costs (as the name implies) or primarily those at risk from excess winter and summer mortality and morbidity. Finally, after examining the role of supplementary indicators, it looks at the opportunities for changing the definition and comments on the Government review of the definition and targets. - Highlights: ► There are major failings in the existing official definitions of fuel poverty. ► expressing fuel costs as a percentage of income is a poor indicator of fuel poverty. ► A budget standard approach provides a more consistent, meaningful and fairer measure. ► The scale and nature of the problem changes dramatically with different definitions. ► The definition is crucial to the mix of policies and allocation of resources required.

  18. BUSINESS OFFSHORING IMPLICATIONS ON THE LABOUR MARKET

    Directory of Open Access Journals (Sweden)

    SERGHEI MARGULESCU

    2012-05-01

    Full Text Available In terms of economic policy, three new aspects are important in the current context of globalization which brings forward new strategies regarding the outsourcing and offshoring of activities and functions of the value chain. These aspects refer to the instant appearance of an offshore transferable function , to the unpredictability of winning and losing functions and to the lowering of competition from the levels of sector, company or professional qualification category to an individual level. Of the three features, the most problematic for policy makers is the unpredictability of the impact of globalization. For example, in Europe we can not reasonably believe that workers in the most competitive sectors will be in a position of winners, nor that these winners will be the most prepared or trained in analytical functions. Many European workers currently work at prices fixed by the local market and not covered by productivity. But when the competition on functions will expand through globalization outside the country or area, their choices will be either a job loss or a reduction in salary. The question that will be raised ever insistently will be the following: what jobs are more exposed to this new competition? On the one hand, offshoring is on balance positive for Western economies, because it makes domestic companies more competitive. At the same time the material outsourcing is, for most developed economies, much more important than the outsourcing of services and the implications for labor market must be objectively differentiated in the two sectors. On the other hand, if we take into account the amplification of the effects that offshoring already has on the structure and distribution of labor, the socio-economic European policy of labor orientation to the coordinates of a "knowledge based" economy and to the jobs of the "information society" could be wrong.

  19. Oceanic implications for climate change policy

    International Nuclear Information System (INIS)

    McNeil, Ben I.

    2006-01-01

    Under the United Nations convention on the law of the sea (1982), each participating country maintains exclusive economic and environmental rights within the oceanic region extending 200 nm from its territorial sea, known as the exclusive economic zone (EEZ). Although the ocean within each EEZ is undoubtedly an anthropogenic CO 2 sink, it has been over-looked within international climate policy. In this paper I use an area-weighted scaling argument to show that the inclusion of the EEZ CO 2 sink within national carbon accounts would have significant implications in tracking national greenhouse commitments to any future climate change policy initiative. The advantages and disadvantages for inclusion of the EEZ CO 2 sink into global climate change policy are also explored. The most compelling argument for including the EEZ CO 2 sink is that it would enhance the equity and resources among coastal nations to combat and adapt against future climate change that will inherently impact coastal nations more so than land locked nations. If included, the funds raised could be used for either monitoring or adaptive coastal infrastructure among the most vulnerable nations. On the other hand, the EEZ anthropogenic CO 2 sink cannot be directly controlled by human activities and could be used as a disincentive for some developed nations to reduce fossil-fuel related greenhouse gas emissions. This may therefore dampen efforts to ultimately reduce atmospheric greenhouse gas concentrations. In consideration of these arguments it is therefore suggested that an 'EEZ clause' be added to Kyoto and any future international climate policy that explicitly excludes its use within national carbon accounts under these international climate frameworks

  20. Brain microbleeds: Epidemiology and clinical implications.

    Science.gov (United States)

    Boyano, I; Bravo, N; Miranda, J; Gil-Gregorio, P; Olazarán, J

    2016-06-22

    Brain microbleeds (BMB) are haemosiderin deposits contained within macrophages, which are displayed as hypointense images in some T2-weighted magnetic resonance imaging sequences. There are still many questions to be answered about the pathophysiology and clinical relevance of BMB. We conducted a literature review of the main epidemiological, clinical, and anatomical pathology studies of BMB performed in the general population, in patients at risk of or already suffering from a vascular disease, and in patients with cognitive impairment. We analysed the prevalence of BMB, risk factors, and potential pathophysiological mechanisms and clinical implications. The prevalence of BMB is highly variable (3%-27% in the general population, 6%-80% in patients with vascular risk factors or vascular disease, and 16%-45% in patients with cognitive impairment). BMB are associated with ageing, Alzheimer disease (AD), and in particular haemorrhagic or ischaemic cerebrovascular disease. The pathological substrate of BMB is either lipohyalinosis (subcortical BMB) or cerebral amyloid angiopathy (lobar BMB). BMB exacerbate cognitive impairment, possibly through cortical-subcortical and intracortical disconnection, and increase the risk of death, mostly due to vascular causes. BMB also increase the risk of cerebral haemorrhage, particularly in patients with multiple lobar BMB (probable erebral amyloid angiopathy). Therefore, anticoagulant treatment may be contraindicated in these patients. In patients with lower risk of bleeding, the new oral anticoagulants and the combination of clinical and magnetic resonance imaging follow-up could be helpful in the decision-making process. Copyright © 2016 Sociedad Española de Neurología. Published by Elsevier España, S.L.U. All rights reserved.

  1. Volatility of fragrance chemicals: patch testing implications.

    Science.gov (United States)

    Gilpin, Sarah J; Hui, Xiaoying; Maibach, Howard I

    2009-01-01

    Diagnostic and predictive patch testing to determine contact allergy due to fragrance materials requires applying a fixed dose of material to the skin. This dose can be affected by the volatile nature of fragrances; little data exist on how the loss of fragrance dose due to volatility affects patch testing. (1) To evaluate pH dependence and evaporation rates of two fragrance chemicals, geraniol, citronellol, and a common fragrance solvent, diethyl phthalate (DEP) and (2) Assess implications for predictive patch-testing methods for fragrances. pH analysis of each material at 1% for three values (4.0, 5.0, 7.0) was done over 40 hours. Volatility experiments for each material, nonradiolabeled and radiolabeled, were conducted over a 24-hour period, taking readings at six time points (5 minutes, 15 minutes, 40 minutes, 1 hour, 3 hours, and 24 hours). Evaporation rates were not sensitive to pH shifts from 4.0 to 7.0. Evaporation rates for nonradiolabeled materials were low: after 24 hours, geraniol lost 8.9%, citronellol 27.0% and DEP 14.5%. The volatility data for radiolabeled materials demonstrated that geraniol loses up to 39% of its dose, citronellol loses up to 26%, and DEP up to 14% within 40 minutes. The tendency of fragrance materials to evaporate can impact the dose being applied to the patch and therefore the result of the patch and ultimately the decision-making process regarding that fragrance material's safety. These data, developed with DEP, utilized in a predictive sensitization assay cannot be generalized.

  2. CHO Quasispecies—Implications for Manufacturing Processes

    Directory of Open Access Journals (Sweden)

    Florian M. Wurm

    2013-10-01

    Full Text Available Chinese hamster ovary (CHO cells are a source of multi-ton quantities of protein pharmaceuticals. They are, however, immortalized cells, characterized by a high degree of genetic and phenotypic diversity. As is known for any biological system, this diversity is enhanced by selective forces when laboratories (no sharing of gene pools grow cells under (diverse conditions that are practical and useful. CHO cells have been used in culture for more than 50 years, and various lines of cells are available and have been used in manufacturing. This article tries to represent, in a cursory way, the history of CHO cells, particularly the origin and subsequent fate of key cell lines. It is proposed that the name CHO represents many different cell types, based on their inherent genetic diversity and their dynamic rate of genetic change. The continuing remodeling of genomic structure in clonal or non-clonal cell populations, particularly due to the non-standardized culture conditions in hundreds of different labs renders CHO cells a typical case for “quasispecies”. This term was coined for families of related (genomic sequences exposed to high mutation rate environments where a large fraction of offspring is expected to carry one or more mutations. The implications of the quasispecies concept for CHO cells used in protein manufacturing processes are significant. CHO genomics/transcriptomics may provide only limited insights when done on one or two “old” and poorly characterized CHO strains. In contrast, screening of clonal cell lines, derived from a well-defined starting material, possibly within a given academic or industrial environment, may reveal a more narrow diversity of phenotypes with respect to physiological/metabolic activities and, thus, allow more precise and reliable predictions of the potential of a clone for high-yielding manufacturing processes.

  3. Implications of Fast Reactor Transuranic Conversion Ratio

    International Nuclear Information System (INIS)

    Piet, Steven J.; Hoffman, Edward A.; Bays, Samuel E.

    2010-01-01

    Theoretically, the transuranic conversion ratio (CR), i.e. the transuranic production divided by transuranic destruction, in a fast reactor can range from near zero to about 1.9, which is the average neutron yield from Pu239 minus 1. In practice, the possible range will be somewhat less. We have studied the implications of transuranic conversion ratio of 0.0 to 1.7 using the fresh and discharge fuel compositions calculated elsewhere. The corresponding fissile breeding ratio ranges from 0.2 to 1.6. The cases below CR=1 ('burners') do not have blankets; the cases above CR=1 ('breeders') have breeding blankets. The burnup was allowed to float while holding the maximum fluence to the cladding constant. We graph the fuel burnup and composition change. As a function of transuranic conversion ratio, we calculate and graph the heat, gamma, and neutron emission of fresh fuel; whether the material is 'attractive' for direct weapon use using published criteria; the uranium utilization and rate of consumption of natural uranium; and the long-term radiotoxicity after fuel discharge. For context, other cases and analyses are included, primarily once-through light water reactor (LWR) uranium oxide fuel at 51 MWth-day/kg-iHM burnup (UOX-51). For CR 1, heat, gamma, and neutron emission decrease with recycling. The uranium utilization exceeds 1%, especially as all the transuranic elements are recycled. exceeds 1%, especially as all the transuranic elements are recycled. At the system equilibrium, heat and gamma vary by somewhat over an order of magnitude as a function of CR. Isotopes that dominate heat and gamma emission are scattered throughout the actinide chain, so the modest impact of CR is unsurprising. Neutron emitters are preferentially found among the higher actinides, so the neutron emission varies much stronger with CR, about three orders of magnitude.

  4. Biomechanical implications of walking with indigenous footwear.

    Science.gov (United States)

    Willems, Catherine; Stassijns, Gaetane; Cornelis, Wim; D'Août, Kristiaan

    2017-04-01

    This study investigates biomechanical implications of walking with indigenous "Kolhapuri" footwear compared to barefoot walking among a population of South Indians. Ten healthy adults from South India walked barefoot and indigenously shod at voluntary speed on an artificial substrate. The experiment was repeated outside, on a natural substrate. Data were collected from (1) a heel-mounted 3D-accelerometer recording peak impact at heel contact, (2) an ankle-mounted 3D-goniometer (plantar/dorsiflexion and inversion/eversion), and (3) sEMG electrodes at the m. tibialis anterior and the m. gastrocnemius medialis. Data show that the effect of indigenous footwear on the measured variables, compared to barefoot walking, is relatively small and consistent between substrates (even though subjects walked faster on the natural substrate). Walking barefoot, compared to shod walking yields higher impact accelerations, but the differences are small and only significant for the artificial substrate. The main rotations of the ankle joint are mostly similar between conditions. Only the shod condition shows a faster ankle rotation over the rapid eversion motion on the natural substrate. Maximal dorsiflexion in late stance differs between the footwear conditions on an artificial substrate, with the shod condition involving a less dorsiflexed ankle, and the plantar flexion at toe-off is more extreme when shod. Overall the activity pattern of the external foot muscles is similar. The indigenous footwear studied (Kolhapuri) seems to alter foot biomechanics only in a subtle way. While offering some degree of protection, walking in this type of footwear resembles barefoot gait and this type of indigenous footwear might be considered "minimal". © 2017 The Authors American Journal of Physical Anthropology Published by Wiley Periodicals, Inc.

  5. The public health implications of asthma.

    Science.gov (United States)

    Bousquet, Jean; Bousquet, Philippe J; Godard, Philippe; Daures, Jean-Pierre

    2005-07-01

    Asthma is a very common chronic disease that occurs in all age groups and is the focus of various clinical and public health interventions. Both morbidity and mortality from asthma are significant. The number of disability-adjusted life years (DALYs) lost due to asthma worldwide is similar to that for diabetes, liver cirrhosis and schizophrenia. Asthma management plans have, however, reduced mortality and severity in countries where they have been applied. Several barriers reduce the availability, affordability, dissemination and efficacy of optimal asthma management plans in both developed and developing countries. The workplace environment contributes significantly to the general burden of asthma. Patients with occupational asthma have higher rates of hospitalization and mortality than healthy workers. The surveillance of asthma as part of a global WHO programme is essential. The economic cost of asthma is considerable both in terms of direct medical costs (such as hospital admissions and the cost of pharmaceuticals) and indirect medical costs (such as time lost from work and premature death). Direct costs are significant in most countries. In order to reduce costs and improve quality of care, employers and health plans are exploring more precisely targeted ways of controlling rapidly rising health costs. Poor control of asthma symptoms is a major issue that can result in adverse clinical and economic outcomes. A model of asthma costs is needed to aid attempts to reduce them while permitting optimal management of the disease. This paper presents a discussion of the burden of asthma and its socioeconomic implications and proposes a model to predict the costs incurred by the disease.

  6. Declining world fertility: trends, causes, implications.

    Science.gov (United States)

    Tsui, A O; Bogue, D J

    1978-10-01

    This Bulletin examines the evidence that the world's fertility has declined in recent years, the factors that appear to have accounted for the decline, and the implications for fertility and population growth rates to the end of the century. On the basis of a compilation of estimates available for all nations of the world, the authors derive estimates which indicate that the world's total fertility rate dropped from 4.6 to 4.1 births per woman between 1968 and 1975, thanks largely to an earlier and more rapid and universal decline in the fertility of less developed countries (LDCs) than had been anticipated. Statistical analysis of available data suggests that the socioeconomic progress made by LDCs in this period was not great enough to account for more than a proportion of the fertility decline and that organized family planning programs were a major contributing factor. The authors' projections, which are compared to similar projections from the World Bank, the United Nations, and the U.S. Bureau of the Census, indicate that, by the year 2000, less than 1/5 of the world's population will be in the "red danger" circle of explosive population growth (2.1% or more annually); most LDCs will be in a phase of fertility decline; and many of them -- along with most now developed countries -- will be at or near replacement level of fertility. The authors warn that "our optimistic prediction is premised upon a big IF -- if (organized) family planning (in LDCs) continues. It remains imperative that all of the developed nations of the world continue their contribution to this program undiminished."

  7. Diabetes Management and Hypoglycemia in Safety Sensitive Jobs

    Directory of Open Access Journals (Sweden)

    See-Muah Lee

    2011-03-01

    Full Text Available The majority of people diagnosed with diabetes mellitus are in the working age group in developing countries. The interrelationship of diabetes and work, that is, diabetes affecting work and work affecting diabetes, becomes an important issue for these people. Therapeutic options for the diabetic worker have been developed, and currently include various insulins, insulin sensitizers and secretagogues, incretin mimetics and enhancers, and alpha glucosidase inhibitors. Hypoglycemia and hypoglycaemic unawareness are important and unwanted treatment side effects. The risk they pose with respect to cognitive impairment can have safety implications. The understanding of the therapeutic options in the management of diabetic workers, blood glucose awareness training, and self-monitoring blood glucose will help to mitigate this risk. Employment decisions must also take into account the extent to which the jobs performed by the worker are safety sensitive. A risk assessment matrix, based on the extent to which a job is considered safety sensitive and based on the severity of the hypoglycaemia, may assist in determining one's fitness to work. Support at the workplace, such as a provision of healthy food options and arrangements for affected workers will be helpful for such workers. Arrangements include permission to carry and consume emergency sugar, flexible meal times, self-monitoring blood glucose when required, storage/disposal facilities for medicine such as insulin and needles, time off for medical appointments, and structured self-help rogams.

  8. Diabetes management and hypoglycemia in safety sensitive jobs.

    Science.gov (United States)

    Lee, See-Muah; Koh, David; Chui, Winnie Kl; Sum, Chee-Fang

    2011-03-01

    The majority of people diagnosed with diabetes mellitus are in the working age group in developing countries. The interrelationship of diabetes and work, that is, diabetes affecting work and work affecting diabetes, becomes an important issue for these people. Therapeutic options for the diabetic worker have been developed, and currently include various insulins, insulin sensitizers and secretagogues, incretin mimetics and enhancers, and alpha glucosidase inhibitors. Hypoglycemia and hypoglycaemic unawareness are important and unwanted treatment side effects. The risk they pose with respect to cognitive impairment can have safety implications. The understanding of the therapeutic options in the management of diabetic workers, blood glucose awareness training, and self-monitoring blood glucose will help to mitigate this risk. Employment decisions must also take into account the extent to which the jobs performed by the worker are safety sensitive. A risk assessment matrix, based on the extent to which a job is considered safety sensitive and based on the severity of the hypoglycaemia, may assist in determining one's fitness to work. Support at the workplace, such as a provision of healthy food options and arrangements for affected workers will be helpful for such workers. Arrangements include permission to carry and consume emergency sugar, flexible meal times, self-monitoring blood glucose when required, storage/disposal facilities for medicine such as insulin and needles, time off for medical appointments, and structured self-help programs.

  9. Stem cell terminology: practical, theological and ethical implications.

    Science.gov (United States)

    Shanner, Laura

    2002-01-01

    Stem cell policy discussions frequently confuse embryonic and fetal sources of stem cells, and label untested, non-reproductive cloning as "therapeutic." Such misnomers distract attention from significant practical and ethical implications: accelerated research agendas tend to be supported at the expense of physical risks to women, theological implications in a multi-faith community, informed consent for participation in research, and treatment decisions altered by unrealistic expectations.

  10. Shopper marketing implications on communication strategies and actions

    OpenAIRE

    Silveira, Paulo Duarte; Marreiros, Cristina

    2013-01-01

    Comunicação apresentada em 15th IAMB Conference, Lisboa Shopper marketing is an international recent concept and approach to marketing. Since shopper marketing is in the early stages of development, it is also an emerging research field, and consequently questions and challenges acrossall the marketing-mix variables are emerging. This paper addressesshopper marketing implications on one of those variables – communication.Specifically, the purpose of this paper is to study the implications ...

  11. The Military Coup and its Implications for the Thai Economy

    DEFF Research Database (Denmark)

    Schmidt, Johannes Dragsbæk

    The paper analyses the regional and international implications of the Thai military coup in September 2006. Focus is furthermore  attached to the economic consequences and the geo-political and geo-economic aspects related to the coup.......The paper analyses the regional and international implications of the Thai military coup in September 2006. Focus is furthermore  attached to the economic consequences and the geo-political and geo-economic aspects related to the coup....

  12. Exploring ethical implications of personal relationships in dyadic business exchanges

    OpenAIRE

    Davidrajuh, Reggie

    2007-01-01

    This paper explores the ethical implications of the existence of personal relationships in business exchanges. Firstly, this paper introduces personal relationship in business exchanges. Secondly, three normative theories of business ethics that are related to the issue of personal relationship are presented. Finally, this paper explores the ethical implications on personal relationships according to the three theories. The main recommendation of this paper is that an analysis of ...

  13. GEMAS - Soil geochemistry and health implications

    Science.gov (United States)

    Ernstsen, Vibeke; Ladenberger, Anna; Wragg, Joanna; Gulan, Aleksandra

    2014-05-01

    The GEMAS Project resulted in a large coherent data set displaying baseline levels of elements in agricultural and grazing land soil, which has a wide variety of applications. Medical geology is an emerging new discipline providing a link between geoscience and medicine by interpreting natural geological factors in relation to human and animal health and their geographical distribution. Medical geology shows not only problems related to harmful health effects of natural geological materials and processes, but also deals with their beneficial aspects. Since the GEMAS project demonstrates the importance of geological factors in geochemical patterns in European soil, this data set can be used in improving our understanding of how the geological processes may affect human health in Europe. The main potential health problems are related to deficiency of nutrients in soil and toxic effects of potentially harmful elements. Deficiency in macro- (e.g., K, Fe, Mg, P) and micro-nutrients (e.g., Se, Zn, Cl) can be responsible for a reduction in crop productivity and certain health issues for livestock and humans. On the other hand, bioavailability of crucial elements depends on soil parameters, e.g., pH; namely, low pH in soil (in northern Europe) makes more micronutrients bioavailable, with the exception of Mo, P and Ca. Rocks underlying the soil layer have a major impact on soil composition, and soil parent material can be a main source of toxic metals, for instance, soil developed on black shale (e.g., Oslo region) shows potentially toxic levels of metals, such as As, Cd, U, Zn and Pb. High content of organic matter is another factor amplifying the toxic levels of metals in soil. Several important topics with health implications can be then addressed using the GEMAS data set, namely, soil properties and element bioavailability, arsenic toxicity, selenium deficiency, potential health effects of liming, uranium in European soil, influence of recent and historical volcanic

  14. Space climate implications from substorm frequency

    Science.gov (United States)

    Newell, P. T.; Gjerloev, J. W.; Mitchell, E. J.

    2013-10-01

    solar wind impacting the Earth varies over a wide range of time scales, driving a corresponding range of geomagnetic activity. Past work has strongly indicated that the rate of merging on the frontside magnetosphere is the most important predictor for magnetospheric activity, especially over a few hours. However, the magnetosphere exhibits variations on other time scales, including UT, seasonal, and solar cycle variations. Much of this geomagnetic variation cannot be reasonably attributed to changes in the solar wind driving—that is, it is not created by the original Russell-McPherron effect or any generalization thereof. In this paper we examine the solar cycle, seasonal, and diurnal effects based upon the frequency of substorm onsets, using a data set of 53,000 substorm onsets. These were identified through the SuperMAG collaboration and span three decades with continuous coverage. Solar cycle variations include a profound minimum in 2009 (448 substorms) and peak in 2003 (3727). The magnitude of this variation (a factor of 8.3) is not explained through variations in estimators of the frontside merging rate (such as dΦMP/dt), even when the more detailed probability distribution functions are examined. Instead, v, or better, n1/2v2 seems to be implicated in the dramatic difference between active and quiet years, even beyond the role of velocity in modulating merging. Moreover, we find that although most substorms are preceded by flux loading (78.5% are above the mean and 83.8% above median solar wind driving), a high solar wind v is almost as important (68.3% above mean, 74.8% above median). This and other evidence suggest that either v or n1/2v2 (but probably not p) plays a strong secondary role in substorm onset. As for the seasonal and diurnal effects, the elliptical nature of the Earth's orbit, which is closest to the Sun in January, leads to a larger solar wind driving (measured by Bs, vBs, or dΦMP/dt) in November, as is confirmed by 22 years of solar wind

  15. Chrysotile dissolution rates: Implications for carbon sequestration

    International Nuclear Information System (INIS)

    Thom, James G.M.; Dipple, Gregory M.; Power, Ian M.; Harrison, Anna L.

    2013-01-01

    important implications for constraining potential rates of sequestration in serpentinite-hosted aquifers and under accelerated sequestration scenarios in mine tailings

  16. Generic implications of ATWS events at the Salem Nuclear Power Plant: generic implications. Vol. 1

    International Nuclear Information System (INIS)

    1983-04-01

    This report is the first of two volumes. It documents the work of an interoffice, interdisciplinary NRC Task Force established to determine the generic implications of two anticipated transients without scram (ATWS) at the Salem Nuclear Power Plant, Unit 1 on February 22 and 25, 1983. A second report will document the NRC actions to be taken based on the work of the Task Force. The Task Force was established to address three questions: (1) Is there a need for prompt action for similar equipment in other facilities. (2) Are NRC and its licensees learning the sefety-management lessons, and, (3) How should the priority and content of the ATWS rule be adjusted. A number of short-term actions were taken through Bulletins and an Information Notice. Intermediate-term actions to address the generic issues will be addressed in the separate report and implemented through appropriate regulatory mechanisms

  17. Implications for global energy markets: implications for non-fossil energy sources

    International Nuclear Information System (INIS)

    Grubb, Michael

    1998-01-01

    This paper highlights the recent developments concerning non-fossil energy and examines the impact of the Kyoto Protocol on non-fossil energy sources, and the implications for non-fossil sources in the implementation of the Kyoto Protocol. The current contributions of fossil and non-fossil fuels to electricity production, prospects for expansion of the established non-fossil sources, new renewables in Europe to date, renewables in Europe to 2010, and policy integration in the EU are discussed. Charts illustrating the generating capacity of renewable energy plant in Britain (1992-1966), wind energy capacity in Europe (1990-2000), and projected renewable energy contributions in the EU (wind, small hydro, photovoltaic, biomass and geothermal) are provided. (UK)

  18. Drug treatment of type 2 diabetes mellitus in patients for whom metformin is contraindicated [Corrigendum

    Directory of Open Access Journals (Sweden)

    Irons BK

    2017-10-01

    Full Text Available Irons BK, Minze MG. Drug treatment of type 2 diabetes mellitus in patients for whom metformin is contraindicated. Diabetes Metab Syndr Obes. 2014;7:15–24.There is an error in the text on page 19:“Alpha-glucosidase inhibitors are infrequently used in the treatment of T2DM.3 These agents competitively inhibit the absorption of alpha-glucosidase along the brush border of the small intestine, which slows gut absorption of carbohydrates and ultimately reduces post-prandial blood glucose.34–36” should read as “Alpha-glucosidase inhibitors are infrequently used in the treatment of T2DM.3 These agents competitively inhibit the degradation of complex carbohydrates along the brush border of the small intestine, which slows gut absorption of metabolized carbohydrates and ultimately reduces post-prandial blood glucose.34–36”Read the original article

  19. Antidiabetic potential of Conocarpus lancifolius

    Directory of Open Access Journals (Sweden)

    Malik Saadullah

    2014-06-01

    Full Text Available The antidiabetic activity of Conocarpus lancifolius extract was investigated in vitro, as alpha glucosidase inhibition and in vivo as alloxan induced diabetic rabbits with other biochemical parameters (LDL, HDL, SGPT, SGOT, cretinine, urea and triglyceride. Alpha-glucosidase inhibition activity was performed by using acorbose as standred. Methanolic extract show alpha-glucosidase inhibition activity. The dose of 200 mg/kg body weight significantly (p<0.05 decreases the blood glucose level, plasma total cholesterol, triglycerides and LDL in treated rabbits as compared to diabetic rabbits. This dose significantly increased the level of HDL in treated group. The activity of SGOT and SGPT also significantly (p<0.05 decreased in treated diabetic rabbits. Phytochemical studies show the presence of glycosides, tannins, saponins and terpenoids. The antidiabetic potential is may be due to its saponin contents.

  20. L'analyse implicative bayésienne multivariée d'un questionnaire binaire : quasi-implications et treillis de Galois simplifié

    OpenAIRE

    Bernard, Jean-Marc; Poitrenaud, Sébastien

    2006-01-01

    We propose a new method for simplifying the Galois lattice associated to a binary questionnaire (n units classified according to q binary questions). The method consists in weakening the implications borne by the lattice into quasi-implications. At the descriptive level, the method involves a new measure for quasi-implications (the "multivariate implicative index") which satisfies some requirements of invariance by logical equivalence. At the inductive level, uncertainty about the patterns' t...

  1. Deforming Etna's Basement: Implications for Edifice stability.

    Science.gov (United States)

    Bakker, Richard; Benson, Philip; Vinciguerra, Sergio

    2013-04-01

    active (>500 ˚C). As shown by Gudmundsson [2011] a large contrast in mechanical properties between two formations could cause dyke arrest or deflection. Contacts between the Comiso Limestone (overall ductile at depth) and extruded basalt flows (overall brittle) could very well facilitate such a locality, and such 'layering' will form part of future laboratory investigations. References: Chiodini, G., S. Caliro, A. Aiuppa, R. Avino, D. Granieri, R. Moretti, and F. Parello (2011), First 13C/12C isotopic characterisation of volcanic plume CO2, Bulletin of Volcanology, 73(5), 531-542. Gudmundsson, A. (2011), Deflection of dykes into sills at discontinuities and magma-chamber formation, Tectonophysics, 500(1-4), 50-64. Heap, M. J., S. Mollo, S. Vinciguerra, Y. Lavallée, K. U. Hess, D. B. Dingwell, P. Baud, and G. Iezzi (2013), Thermal weakening of the carbonate basement under Mt. Etna volcano (Italy): Implications for volcano instability, Journal of Volcanology and Geothermal Research, 250(0), 42-60. Mollo, S., S. Vinciguerra, G. Iezzi, A. Iarocci, P. Scarlato, M. J. Heap, and D. B. Dingwell (2011), Volcanic edifice weakening via devolatilization reactions, Geophysical Journal International, 186(3), 1073-1077. Tibaldi, A., and G. Groppelli (2002), Volcano-tectonic activity along structures of the unstable NE flank of Mt. Etna (Italy) and their possible origin, Journal of Volcanology and Geothermal Research, 115(3-4), 277-302.

  2. Gastrointestinal Motility Disorders and Their Clinical Implications in Cirrhosis

    Directory of Open Access Journals (Sweden)

    Eleni Theocharidou

    2017-01-01

    Full Text Available Gastrointestinal motility is impaired in a substantial proportion of patients with cirrhosis. Cirrhosis-related autonomic neuropathy, increased nitric oxide production, and gut hormonal changes have been implicated. Oesophageal dysmotility has been associated with increased frequency of abnormal gastro-oesophageal reflux. Impaired gastric emptying and accommodation may result in early satiety and may have an impact on the nutritional status of these patients. Small intestinal dysmotility might be implicated in small intestinal bacterial overgrowth and increased bacterial translocation. The latter has been implicated in the pathophysiology of hepatic encephalopathy and spontaneous bacterial peritonitis. Enhanced colonic motility is usually associated with the use of lactulose. Pharmacological interventions aiming to alter gastrointestinal motility in cirrhosis could potentially have a beneficial effect reducing the risk of hepatic decompensation and improving prognosis.

  3. Theoretical analyses of the refractive implications of transepithelial PRK ablations.

    Science.gov (United States)

    Arba Mosquera, Samuel; Awwad, Shady T

    2013-07-01

    To analyse the refractive implications of single-step, transepithelial photorefractive keratectomy (TransPRK) ablations. A simulation for quantifying the refractive implications of TransPRK ablations has been developed. The simulation includes a simple modelling of corneal epithelial profiles, epithelial ablation profiles as well as refractive ablation profiles, and allows the analytical quantification of the refractive implications of TransPRK in terms of wasted tissue, achieved optical zone (OZ) and induced refractive error. Wasted tissue occurs whenever the actual corneal epithelial profile is thinner than the applied epithelial ablation profile, achieved OZ is reduced whenever the actual corneal epithelial profile is thicker than the applied epithelial ablation profile and additional refractive errors are induced whenever the actual difference centre-to-periphery in the corneal epithelial profile deviates from the difference in the applied epithelial ablation profile. The refractive implications of TransPRK ablations can be quantified using simple theoretical simulations. These implications can be wasted tissue (∼14 µm, if the corneal epithelial profile is thinner than the ablated one), reduced OZ (if the corneal epithelial profile is thicker than ablated one, very severe for low corrections) and additional refractive errors (∼0.66 D, if the centre-to-periphery progression of the corneal epithelial profile deviates from the progression of the ablated one). When TransPRK profiles are applied to normal, not previously treated, non-pathologic corneas, no specific refractive implications associated to the transepithelial profile can be anticipated; TransPRK would provide refractive outcomes equal to those of standard PRK. Adjustments for the planned OZ and, in the event of retreatments, for the target sphere can be easily derived.

  4. SYMPOSIUM - MACRONUTRIENT UTILIZATION DURING EXERCISE: IMPLICATIONS FOR PERFORMANCE AND SUPPLEMENTATION

    Directory of Open Access Journals (Sweden)

    Darryn S. Willoughby

    2004-09-01

    Full Text Available The review articles constitute a mini-symposium entitled "Macronutrient Utilization During Exercise: Implications for Performance and Supplementation" that were recently presented at the 2004 annual conference of the International Society of Sports Nutrition in Las Vegas, NV. Much controversy often surrounds macronutrient intake, utilization, and subsequent metabolism regarding exercise and athletic performance. Furthermore, the role of macronutrient supplementation with the specificintent of improving body composition and exercise performance by way of nutrient timing is also an important issue. As such, the articles provide a comprehensive overview of metabolic and performance-enhancing implications regarding carbohydrate, fat, and protein.

  5. Federalism and social justice: implications for social work.

    Science.gov (United States)

    Linhorst, Donald M

    2002-07-01

    Federalism is a system of government that divides power between two or more levels of government. During the current conservative political climate in the United States, power has shifted increasingly from the federal government to states, a move that has implications for the achievement of social justice. Consequently, it is now necessary for social workers to engage in political activity at the state and local levels, in addition to the federal level, to promote social justice. Implications for social work policy practice, research, and education for advancing social justice within the federal system of government are explored.

  6. The CH/π hydrogen bond: Implication in chemistry

    Science.gov (United States)

    Nishio, M.

    2012-06-01

    The CH/π hydrogen bond is the weakest extreme of hydrogen bonds that occurs between a soft acid CH and a soft base π-system. Implication in chemistry of the CH/π hydrogen bond includes issues of conformation, crystal packing, and specificity in host/guest complexes. The result obtained by analyzing the Cambridge Structural Database is reviewed. The peculiar axial preference of isopropyl group in α-phellandrene and folded conformation of levopimaric acid have been explained in terms of the CH/π hydrogen bond, by high-level ab initio MO calculations. Implication of the CH/π hydrogen bond in structural biology is also discussed, briefly.

  7. Business development - the function, research propositions, and managerial implications

    DEFF Research Database (Denmark)

    Sørensen, Hans Eibe

    and executives from high-tech firms and venture capitalists in North America, Asia, and Europe to provide a foundation for future research. Business development is an emerging staff function providing an added level of sophistication to the firms' overall strategic management with interesting performance...... implications. The business development function is typically found in progressive firms especially within high-tech industries, but is argued to become critical for all types of firms across industries wishing to grow and accumulate wealth. Research propositions and managerial implications are discussed....

  8. Energy policy in China: implications for global climate change

    Energy Technology Data Exchange (ETDEWEB)

    ZhongXiang Zhang [University of Groningen, Groningen (Netherlands)

    1998-12-31

    This is the first systematic and comprehensive analysis of the economic implications of carbon abatement for the Chinese economy. It evaluates the economics of climate change and provides national, cost-effective policies for climate change. The book consists of three main parts, firstly, an analysis of the Chinese energy system to increase awareness of the implications of this sector for China`s future carbon dioxide emissions, secondly, a macroeconomic analysis of carbon dioxide emissions limits using a newly-developed computable general equilibrium model of the Chinese economy; and finally, a cost-effective analysis of carbon abatement options by means of a technology-oriented dynamic optimization model.

  9. Neoliberalism and its implications for mental health in the UK.

    Science.gov (United States)

    Ramon, Shulamit

    2008-01-01

    This article sets out to outline the tenets of neoliberalism and globalization, prior to the identification of the implications of neoliberalism for the British health system since 1979. The article then focuses on the applications and implications of neoliberalism for the British mental health system in terms of service organization and management, and the impact these changes in direction had on the three existing service sectors: users, carers and professionals. The discussion and the conclusion highlight the significance of these developments in the mental health system in the rather hybrid context of health, mental health, and social care policy and practice in the United Kingdom.

  10. Marital Conflict Behaviors and Implications for Divorce over 16 Years

    Science.gov (United States)

    Birditt, Kira S.; Brown, Edna; Orbuch, Terri L.; McIlvane, Jessica M.

    2010-01-01

    This study examined self-reported marital conflict behaviors and their implications for divorce. Husbands and wives (N = 373 couples; 47% White American, 53% Black American) reported conflict behaviors in Years 1, 3, 7, and 16 of their marriages. Individual behaviors (e.g., destructive behaviors) and patterns of behaviors between partners (e.g.,…

  11. Xenophobia and its implications for social order in Africa | Lanre ...

    African Journals Online (AJOL)

    The paper also highlights the philosophical implications of this societal bifurcation, particularly to the human community. Seeking a plausible way of addressing this challenge, the paper concludes by emphasizing the relevance of the value of tolerance in curbing xenophobia. Keywords: Xenophobia, Social discrimination, ...

  12. The implications of nonauthentic questions in Galatians | Verster ...

    African Journals Online (AJOL)

    A new classification of non-authentic questions is helpful in understanding the way in which Paul uses persuasion in Galatians. Paul uses many non-authentic questions, and the implications thereof are evident in the type of question used. The way in which he violates the maxims identified by Grice also entails certain ...

  13. Evaluation of toxicological implications of ingestion exposure to ...

    African Journals Online (AJOL)

    Because increased LDL cholesterol, decreased HDL cholesterol and alteration in the level of total serum cholesterol have all been implicated as risk factors for atherosclerosis, this present study was designed to determine whether very low percentages of gasoline per kilogramme body weight could cause toxicity in rats.

  14. Tablets in K-12 Education: Integrated Experiences and Implications

    Science.gov (United States)

    An, Heejung, Ed.; Alon, Sandra, Ed.; Fuentes, David, Ed.

    2015-01-01

    The inclusion of new and emerging technologies in the education sector has been a topic of interest to researchers, educators, and software developers alike in recent years. Utilizing the proper tools in a classroom setting is a critical factor in student success. "Tablets in K-12 Education: Integrated Experiences and Implications"…

  15. Gani Odutoku ' Dialogu with Mona Lisa: Interrogating Implications of ...

    African Journals Online (AJOL)

    ... exists in the interface that Africa and Europe shares, African nationalist efforts must combine concepts of Negritude and Tigritude to reinvent a new African consciousness that rises beyond the ashes of past debilitating conditions. Key words- Euro-African Interface, Negritude, Tigritude, Implication, Pan-Africanism ...

  16. Resource implications of adopting a restrictive neonatal blood ...

    African Journals Online (AJOL)

    Resource implications of adopting a restrictive neonatal blood transfusion policy. ... Objective. To determine whether adopting a restrictive BTF policy results in fewer transfusions. Methods. Data were retrospectively collected on all infants who received BTFs in the GSH nursery over a 6-month period following adoption of a ...

  17. K-12 Implications Seen in Some Cases before High Court

    Science.gov (United States)

    Walsh, Mark

    2010-01-01

    Arizona's variation on government vouchers for religious schools and California's prohibition on the sale of violent video games to minors present the top two cases with implications for education in the U.S. Supreme Court term that formally begins Oct. 4. New Justice Elena Kagan brings to the court extensive education policy experience as a…

  18. Implications of material selection on the design of packaging machinery.

    Science.gov (United States)

    Merritt, J P

    2009-01-01

    Material selection has significant implications on the design and cost of horizontal-form-fill-seal packaging machinery. To avoid excessive costs, machine redesigns and project delays, material selection must be reconciled early in the project and revisited throughout the construction of the machine.

  19. Risk factors analysis and implications for public health of bovine ...

    African Journals Online (AJOL)

    Bovine tuberculosis (TB) is a neglected zoonosis of cattle that is prevalent but under-investigated in Cameroon. Based on epidemiological data of the disease, this study was designed to assess the risks and public health implications for zoonotic M. bovis infection in cattle and humans in the highlands of Cameroon.

  20. Hiroshima and Nagasaki: New doses, risks, and their implications

    International Nuclear Information System (INIS)

    Schull, W.J.; Shimizu, Y.; Kato, H.

    1990-01-01

    This presentation summarizes the recent re-evaluations of the dose and risk of cancer among survivors of the atomic bombing of Hiroshima and Nagasaki. It addresses briefly their limitations, and describes some of their implications for the lifetime projection of the risk of a fatal cancer following exposure to ionizing radiation

  1. Constructivism: Its Theoretical Underpinnings, Variations, and Implications for Classroom Instruction

    Science.gov (United States)

    Yilmaz, Kaya

    2008-01-01

    This article provides an overview of constructivism and its implications for classroom practices. To that end, it first describes the basic features of constructivism along with its major forms or variations. It then elucidates the constructivist view of knowledge, learning, teaching, and the relationship among these constructs. More specifically,…

  2. The Applications of Phonemic Contrasts and Their Implications for ...

    African Journals Online (AJOL)

    final-year Yoruba-English bilingual University undergraduates and the implications of their applications on pedagogic practices especially in English as a second language (ESL) environment. This subject is rarely studied in Nigeria, yet, it might be significant for shaping the effective teaching of oral English.

  3. Hydrodynamic processes in sharp meander bends and their morphological implications

    NARCIS (Netherlands)

    Blanckaert, K.

    2011-01-01

    The migration rate of sharp meander bends exhibits large variance and indicates that some sharply curved bends tend to stabilize. These observations remain unexplained. This paper examines three hydrodynamic processes in sharp bends with fixed banks and discusses their morphological implications:

  4. Influence of Spousal Communication on Marital Stability: Implication ...

    African Journals Online (AJOL)

    It is often said that the home is the basic unit of the larger society. Thus when the home is settled, the society is at peace. The main focus of this study was to find out the influence of spousal communication on marital stability: Implications for Conducive Home Environment. A researcher-designed questionnaire titled ...

  5. Latitudinal shifts of introduced species: possible causes and implications

    Science.gov (United States)

    Qinfeng Guo; Dov F. Sax; Hong Qian; Regan Early

    2012-01-01

    This study aims to document shifts in the latitudinal distributions of non-native species relative to their own native distributions and to discuss possible causes and implications of these shifts. We used published and newly compiled data on intercontinentally introduced birds, mammals and plants. We found strong correlations between the latitudinal distributions...

  6. Financial Frictions and Real Implications of Macroprudential Policies

    Czech Academy of Sciences Publication Activity Database

    Derviz, Alexis

    2012-01-01

    Roč. 3, č. 26 (2012), s. 333-368 ISSN 1555-4961 Institutional support: RVO:67985556 Keywords : Debt * Equity * Bank * Default * Macroprudential policy Subject RIV: AH - Economics http://library.utia.cas.cz/separaty/2012/E/Derviz-financial frictions and real implications of macroprudential policies.pdf

  7. Communication and conflict management in the family: Implications ...

    African Journals Online (AJOL)

    This paper assesses communication and conflict management in the family within the framework of implications for national development using a simple random sample of 400 respondents. Findings show that conflict is an inevitable characteristic of the family. However, it has been noted that effective communication would ...

  8. Implications of middlemen in the supply chain of agricultural products

    African Journals Online (AJOL)

    This paper appraised the roles of middlemen in the distribution of agricultural products and the inherent implications to food security. The results showed that climate and weather are known limiting factors of production in agriculture. Also, middlemen intervention raise price for consumers. The result showed that farmers ...

  9. Winston Churchill's "Iron Curtain" Address: Implications for the Present.

    Science.gov (United States)

    Bush, George

    1988-01-01

    Evaluates the "Iron Curtain" speech made by Winston Churchill in 1946, discussing its relevance and implications for the present. Examines Churchill's predictions for the future and his assessment of the USSR. Reviews world developments since the speech and proposes foreign policy goals for the next 40 years. (GEA)

  10. Big data's implications for transportation operations : an exploration.

    Science.gov (United States)

    The purpose of this white paper is to expand the understanding of big data for transportation operations, the value it could provide, and the implications for the : future direction of the U.S. Department of Transportation (USDOT) Connected Vehicle R...

  11. Radiation induced changes in the airway - anaesthetic implications ...

    African Journals Online (AJOL)

    Radiation induced changes in the airway - anaesthetic implications: case report. Mallika Balakrishnan, Renju Kuriakose, Rachel Cherian Koshy. Abstract. Radiation induces a variety of changes in the airway that can potentially lead to difficult intubation. Osteoradionecrosis (ORN) of the mandible, a severe consequence of ...

  12. L'implication Des Puissances Occidentales Dans Les Processus De ...

    African Journals Online (AJOL)

    L'implication Des Puissances Occidentales Dans Les Processus De Démocratisation En Afrique: Analyse Des Actions Américaine Et Française Au Cameroun (1989-1997). Martin Dieudonné Ebolo. Abstract. No Abstract African Journal of Political Science Vol.4(2) 1999: 46-88. Full Text: EMAIL FULL TEXT EMAIL FULL ...

  13. The Computer as Rorschach: Implications for Management and User Acceptance

    OpenAIRE

    Kaplan, Bonnie

    1983-01-01

    Different views of the computer held by different participants in a medical computing project make it difficult to gain wide acceptance of an application. Researchers', programmers', and clinicians' views illustrate how users project their views onto the computer. Effects of these different views on user acceptance and implications for the management of computer projects are presented.

  14. Mental Illness in Offender Populations: Prevalence, Duty and Implications

    Science.gov (United States)

    Soderstrom, Irina R.

    2007-01-01

    Prisons are increasingly being filled with inmates who suffer from mental illness. This paper examines the prevalence of mental illness in American jails and prisons, the duty government and society has to provide appropriate mental health treatment, and the implications for inmate safety, costs, recidivism, and community reintegration if…

  15. School Transportation Issues, Laws and Concerns: Implications for Future Administrators

    Science.gov (United States)

    Durick, Jody M.

    2010-01-01

    Nearly all building administrators are confronted with a variety of transportation issues. Challenges, concerns and questions can arise from various aspects, including student misbehaviors, transportation laws and its implications at the school level, to importance and implementation of a school bus safety program. As new and upcoming future…

  16. Ancient Athenian Democratic Knowledge and Citizenship: Connectivity and Intercultural Implications

    Science.gov (United States)

    Gundara, Jagdish S.

    2011-01-01

    This paper explores the implications that ancient Athens had for modern representative democracies and the links that can be made to the philosophical principles that form the essence of intercultural education. Such an exploration shows that modern democratic societies have ignored many key aspects of the important legacy left to us by these…

  17. Safeguarding and Protecting Children in Maternity Services: Implications for Practice

    Science.gov (United States)

    Lazenbatt, Anne; Greer, Jean

    2009-01-01

    This article debates the issues involved in safeguarding and protecting children in maternity services and offers implications for professional practice. Midwives and other staff who work as members of the maternity team have a safeguarding role to play in the identification of babies and children who have been abused, or are at risk of abuse, and…

  18. The Risk Premium for Equity : Explanations and Implications

    NARCIS (Netherlands)

    Grant, S.; Quiggin, J.

    2001-01-01

    The equity premium puzzle shows that using standard parameters and setup, the Consumption-based Capital Asset Pricing Model's (CCAPM's) prediction of the premium associated with systematic risk is out by an order of magnitude.The object of this paper is to consider the implications of each of the

  19. Eye mechanics and their implications for eye movement control

    NARCIS (Netherlands)

    Koene, Ansgar Roald

    2002-01-01

    The topic of this thesis is the investigation of the mechanical properties of the oculomotor system and the implications of these properties for eye movement control. The investigation was conducted by means of computer models and simulations. This allowed us to combine data from anatomy, physiology

  20. Rethinking the Concept of Acculturation: Implications for Theory and Research

    Science.gov (United States)

    Schwartz, Seth J.; Unger, Jennifer B.; Zamboanga, Byron L.; Szapocznik, Jose

    2010-01-01

    This article presents an expanded model of acculturation among international migrants and their immediate descendants. Acculturation is proposed as a multidimensional process consisting of the confluence among heritage-cultural and receiving-cultural practices, values, and identifications. The implications of this reconceptualization for the…

  1. Implications of bride price on domestic violence and reproductive ...

    African Journals Online (AJOL)

    Objective: Bride price payment is a gender issue with implications on gender relations in different socio-cultural contexts. It also impacts Sexual and Reproductive Health and Rights. In a qualitative study on the perceptions of domestic violence in Wakiso district, payment of bride price emerged as one of the key factors ...

  2. Adult sex ratio variation : Implications for breeding system evolution

    NARCIS (Netherlands)

    Szekely, T.; Weissing, F. J.; Komdeur, J.

    Adult sex ratio (ASR) exhibits immense variation in nature, although neither the causes nor the implications of this variation are fully understood. According to theory, the ASR is expected to influence sex roles and breeding systems, as the rarer sex in the population has more potential partners to

  3. Nutritional implications of food allergies | Steinman | South African ...

    African Journals Online (AJOL)

    8% of children affected at some point in their childhood. It is important to recognise that the nutritional implications encompass not only the elimination of essential food(s) from the diet (and the consequent attendant lack of energy, protein or ...

  4. Teacher Job Dissatisfaction: Implications for Teacher Sustainability and Social Transformation

    Science.gov (United States)

    Okeke, Chinedu I.; Mtyuda, Pamela N.

    2017-01-01

    Teachers play a key role in the social transformation agenda. This agentic position of the teacher implicates an agenda for sustainability programmes that position them for this complex responsibility. A qualitative case study research design was employed to obtain the perspectives of teachers on job dissatisfaction. The researchers followed a…

  5. Vitamin D Status of College Students: Implications for Health Leaders

    Science.gov (United States)

    Cress, Eileen McKenna

    2014-01-01

    Vitamin D deficiency is considered to be a pandemic with implications for compromised bone health and other chronic diseases. Few studies have examined vitamin D status in college-aged individuals where prevention of future health consequences is still possible. Serum vitamin D 25(OH)D status and vitamin D intake were examined in 98 college…

  6. Implications of Continuous Quality Improvement for Program Evaluation and Evaluators.

    Science.gov (United States)

    Mark, Melvin M.; Pines, Edward

    1995-01-01

    Explores the implications that continuous quality improvement (CQI) programs are likely to have for evaluation. CQI, often known as total quality management, offers a structured approach to the analysis of an organization's processes and improvement that should provide advantages to evaluators once they have gained experience with the approach.…

  7. Assets for Children: Experiences in Asia and Implications for China

    Science.gov (United States)

    Zou, Li; Sherraden, Michael

    2010-01-01

    A growing number of national and local governments view child development accounts (CDAs) as an innovative policy tool for social and economic development. This article reviews the global landscape of CDAs, presents three CDA policy cases from Asia, analyzes main themes and discusses potential implications for China. (Contains 1 table.)

  8. Quality of Antenatal care services in eastern Uganda: implications ...

    African Journals Online (AJOL)

    Good quality Antenatal Care (ANC) provides opportunity to detect and respond to risky maternal conditions. This study assessed quality of ANC services in eastern Uganda with a goal of benchmarking implications for interventions. Methods Data was collected from 15 health facilities in Eastern Uganda to establish capacity ...

  9. Livelihood impacts of forest carbon project and its implications for ...

    African Journals Online (AJOL)

    This study examines the impacts of forest carbon project on the livelihoods of rural households and its implications for the sustainability of forest by focusing on a regenerated forest in Humbo district of Southwestern Ethiopia. The methods through which primary data were gathered are a triangulation of household survey, ...

  10. Environment, Biology, and Culture: Implications for Adolescent Development.

    Science.gov (United States)

    Zahn-Waxler, Carolyn

    1996-01-01

    Introduces this special theme issue examining the roles of socialization, biology, and culture as they affect adaptive and maladaptive developmental outcomes. Problems of adolescence addressed include antisocial behavior, depressive symptoms, substance abuse, low achievement, and eating problems. Considers factors implicated in successful…

  11. Human Nature and its Implications for the Legal System | Obioha ...

    African Journals Online (AJOL)

    This paper examines the implications the various conceptions of human nature hold for the legal system. No doubt, there are various and conflicting theories of human nature such that the concept of human nature seems to have remained elusive and pervasive. Some conceive man as nothing but matter pure and simple; ...

  12. The precision of higgs boson measurements and their implications

    International Nuclear Information System (INIS)

    J. Conway et al. email = crathbun@fnal.gov

    2002-01-01

    The prospects for a precise exploration of the properties of a single or many observed Higgs bosons at future accelerators are summarized, with particular emphasis on the abilities of a Linear Collider (LC). Some implications of these measurements for discerning new physics beyond the Standard Model (SM) are also discussed

  13. Current Research on Adolescence and its Program Implications.

    Science.gov (United States)

    Cvetkovich, George; Grote, Barbara

    This paper discusses program implications of research on adolescents. A brief historical review of teenage sexuality is presented in order to put current information in perspective. The present increase in teenage fertility is seen as part of a larger epidemic failure of socialization. A number of recent studies are reviewed and synthesized,…

  14. The potential implication of eosinophil activation in the pathogenesis ...

    African Journals Online (AJOL)

    Ehab

    The potential implication of eosinophil activation in the pathogenesis of childhood asthma. INTRODUCTION. Asthma is recognized as an eosinophil mediated inflammation of the airways1. Eosinophils are major contributors to the damage in the airways of asthmatic patients which when activated, degranulate and release ...

  15. Household-food market relations and its implications for food ...

    African Journals Online (AJOL)

    Household-food market relations and its implications for food security of farm ... of this relationship and how it affects the dietary supply of the household needs to be ... the rural areas of Imo state using a multi-stage random sampling technique. ... and transportation facilities will in the long run improve market efficiency and ...

  16. Prognostic implications of plasma fibrinogen and serum Creactive ...

    African Journals Online (AJOL)

    Purpose: To investigate the prognostic implications of plasma fibrinogen and serum C-reactive protein (CRP) levels in tumour resection and survival following successful tumour resection in patients with nonsmall cell lung cancer (NSCLC). Methods: One hundred and fifty-three NSCLC patients who underwent surgical ...

  17. Recent Concepts in Dyslexia: Implications for Diagnosis and Remediation.

    Science.gov (United States)

    Forness, Steven R.

    The report briefly reviews research on the concepts of attention, memory, and linguistic deficits, as well as maturational lag and interactive factors; and considers possible implications for assessment and instruction of reading disabled/dyslexic children. Early theories relating to dyslexia or specific reading disability are traced from S.…

  18. Cisplatin carbonato complexes. Implications for uptake, antitumor properties, and toxicity.

    Science.gov (United States)

    Centerwall, Corey R; Goodisman, Jerry; Kerwood, Deborah J; Dabrowiak, James C

    2005-09-21

    The reaction of aquated cisplatin with carbonate which is present in culture media and blood is described. The first formed complex is a monochloro monocarbonato species, which upon continued exposure to carbonate slowly forms a biscarbonato complex. The formation of carbonato species under conditions that simulate therapy may have important implications for uptake, antitumor properties, and toxicity of cisplatin.

  19. Local Citation Analysis of Graduate Biology Theses: Collection Development Implications

    Science.gov (United States)

    Miller, Laura Newton

    2011-01-01

    This paper will focus on the citation analysis of graduate masters theses from Carleton University's Biology Department with implications for library collection management decisions. Twenty-five masters theses were studied to determine citation types and percentages, ranking of journals by frequency of citation and by number of authors citing, and…

  20. Nutrition Advertisements in Consumer Magazines: Health Implications for African Americans.

    Science.gov (United States)

    Pratt, Charlotte A.; Pratt, Cornelius B.

    1996-01-01

    Examines the "Ladies' Home Journal" and two popular consumer magazines that target blacks to determine the proportions of food and beverage advertisements, nutrition advertisements and their promotional messages, and the health implications they reveal. Findings reveal these magazines had a significantly higher number of alcohol ads,…

  1. Implications for Child Bilingual Acquisition, Optionality and Transfer

    Science.gov (United States)

    Serratrice, Ludovica

    2014-01-01

    Amaral & Roeper's Multiple Grammars (MG) proposal offers an appealingly simple way of thinking about the linguistic representations of bilingual speakers. This article presents a commentary on the MG language acquisition theory proposed by Luiz Amaral and Tom Roeper in this issue, focusing on the theory's implications for child…

  2. Multiple Intelligence Theory for Gifted Education: Criticisms and Implications

    Science.gov (United States)

    Calik, Basak; Birgili, Bengi

    2013-01-01

    This paper scrutinizes giftedness and gifted learners under the implications of multiple intelligence theory with regard to coaching young scientists. It is one of the pluralistic theories toward intelligence while supporting to view individuals as active participants during teaching and learning processes which correspond with the applications of…

  3. Changing Knowledge, Changing Technology: Implications for Teacher Education Futures

    Science.gov (United States)

    Burden, Kevin; Aubusson, Peter; Brindley, Sue; Schuck, Sandy

    2016-01-01

    Recent research in teacher education futures has identified two themes that require further study: the changing nature of knowledge and the changing capabilities of technologies. This article examines the intersection of these two themes and their implications for teacher education. The research employed futures methodologies based on scenario…

  4. Irradiation of the red bone marrow and the health implications ...

    African Journals Online (AJOL)

    The physiology and function of the bone is looked at as to the role in housing bone marrow. The bone marrow and particularly the red bone marrow is discussed. Sources of radiation are discussed and the health implications highlighted for caution and for study or evaluation. Key Words: Bone marrow, Irradiation, Radiation, ...

  5. The Professional-Bureaucratic Conflict: Origins, Implications, Resolution.

    Science.gov (United States)

    Angona, Judith; Williams, Leonard B.

    1981-01-01

    Examines the literature on the inevitable conflict in modern organizations between the professional's training for self-administration and bureaucratic denial of individual initiative and draws implications for administrative techniques that can help win the loyalty of a professional staff. (Author/WD)

  6. The Current Global Economic Crisis: Implication for Best Teacher ...

    African Journals Online (AJOL)

    The main thrust of the paper is the causes of the present recession, solutions and its implications for university graduate capacity building in Nigeria. The paper identifies the plummeting of the prices of real estate in the USA as the remote cause of the recession and the drying up of loanable funds in the money market as the ...

  7. Relational Aggression, Victimization, and Language Development: Implications for Practice

    Science.gov (United States)

    Ostrov, Jamie M.; Godleski, Stephanie A.

    2007-01-01

    This review explores the development of relational aggression and relational victimization among peers, with specific emphasis on clinical implications for speech-language pathologists. Developmental manifestations of relational aggression and victimization are reviewed from early childhood through emerging adulthood. The concurrent and…

  8. The Implications of Relational Aggression toward Females Pursuing Educational Administration

    Science.gov (United States)

    Dryier, Kimberly J.

    2009-01-01

    The purpose of this study was to examine the existence and implications of relational aggression toward female educational administrators. This qualitative study examined the impacts of relational aggression toward ten female superintendents, their observations of relational aggression in the workplace, strategies to overcome relational…

  9. the implications of non- authentic questions in galatians

    African Journals Online (AJOL)

    tegies in the form of non-authentic questions in Paul's letters may thus be scru- tinised, and their ... A similar approach will be followed in this paper by ... and to describe their implications in order to better understand their function .... They are not addressed to the receiver, and can be primarily rational or emotional.

  10. Democratic Schooling in Norway: Implications for Leadership in Practice

    Science.gov (United States)

    Moller, Jorunn

    2006-01-01

    This article explores the meaning of an education based on democratic values and the implications for school leadership in practice. Based on findings from a case study in a Norwegian upper secondary school, the study describes democratic school leadership in practice, with particular attention to the distribution of power and leadership in the…

  11. Implications of the Bakassi conflict resolution for Cameroon | Baye ...

    African Journals Online (AJOL)

    This paper sketches a conceptual framework of international conflict dynamics and resolution, examines the geopolitics of the Bakassi dispute between Nigeria and Cameroon, and outlines socio-economic implications of its peaceful settlement. Neglect and subsequent discovery of oil deposits subjected the Bakassi ...

  12. Implications of Capital Punishment in the Nigerian Society | Uche ...

    African Journals Online (AJOL)

    Although, opinion pool seems high on ways of moving Nigeria forward, however, mute indifference and cold passivity have characterized the cherished dreams of most Nigerians. The over emphasis on material gains have compounded and increased criminal tendencies in Nigerians. A systematic look at the implications of ...

  13. The Institutional Implications of the Unfair Terms Directive in Poland

    NARCIS (Netherlands)

    Mańko, R.

    2012-01-01

    In this paper I focus on the institutional implications of the EU Unfair Terms Directive (93/13) in Poland in the broader context of the welfare state model prevalent in that post-socialist EU Member State. I depart from the assumption that there is, in principle, a link between the intensity of the

  14. Determinants of premarital sex in Maiduguri, Nigeria: Implications for ...

    African Journals Online (AJOL)

    McRoy

    of the strategies to reduce the impact of. HIV/AIDS is ... endorsing the use of an STI vaccine, the introduction of HPV vaccine is ..... implications for HIV and drug abuse ... reproduction in any medium, provided the original work is properly cited.

  15. Racial Microaggressions against Black Americans: Implications for Counseling

    Science.gov (United States)

    Sue, Derald Wing; Nadal, Kevin L.; Capodilupo, Christina M.; Lin, Annie I.; Torino, Gina C.; Rivera, David P.

    2008-01-01

    Racial microaggression themes were identified using a focus-group analysis of self-identified Black participants. Six categories of demeaning and invalidating messages reflected beliefs of White supremacy that were unintentionally conveyed by perpetrators. Implications for counselors and the counseling process are discussed.

  16. Some Instructional Implications from a Mathematical Model of Cognitive Development.

    Science.gov (United States)

    Mierkiewicz, Diane B.

    Cognitive development and various educational implications are discussed in terms of Donald Saari's model of the interaction of a learner and the enviroment and the constraints imposed by the inefficiency of the learner's cognitive system. Saari proposed a hierarchical system of cognitive structures such that the relationships between structures…

  17. Computer Vision Syndrome: Implications for the Occupational Health Nurse.

    Science.gov (United States)

    Lurati, Ann Regina

    2018-02-01

    Computers and other digital devices are commonly used both in the workplace and during leisure time. Computer vision syndrome (CVS) is a new health-related condition that negatively affects workers. This article reviews the pathology of and interventions for CVS with implications for the occupational health nurse.

  18. Health Benefits of Outdoor Recreation: Implications for Health Education.

    Science.gov (United States)

    Breitenstein, Donna; Ewert, Alan

    1990-01-01

    This article reviews literature related to the positive effects of outdoor education. The following dimensions of health, and the benefits associated with each, are discussed: emotional, social, physical, intellectual, and spiritual. A model of health benefits derived from outdoor recreation is presented, and implications for health education are…

  19. The Male Role in Contraception: Implications for Health Education.

    Science.gov (United States)

    Chng, Chwee Lye

    1983-01-01

    Many males still perceive contraception as a woman's responsibility. This paper describes male contraceptives and their effectiveness and draws implications for school and community health education professionals. More equitable sharing of the responsibility for contraception might result in more effective contraception. (PP)

  20. On the implications of development for moral education | Udokang ...

    African Journals Online (AJOL)

    This paper examines the concept of development and the implication it has for moral education. While using the word “development” in its general understanding as change from one stage to the other, it went beyond this to the psychological. It alludes that in terms of moral education, development is not just any behaviour ...