WorldWideScience

Sample records for solar wind sa31b-04

  1. Evolution of the Sunspot Number and Solar Wind B Time Series

    Science.gov (United States)

    Cliver, Edward W.; Herbst, Konstantin

    2018-03-01

    The past two decades have witnessed significant changes in our knowledge of long-term solar and solar wind activity. The sunspot number time series (1700-present) developed by Rudolf Wolf during the second half of the 19th century was revised and extended by the group sunspot number series (1610-1995) of Hoyt and Schatten during the 1990s. The group sunspot number is significantly lower than the Wolf series before ˜1885. An effort from 2011-2015 to understand and remove differences between these two series via a series of workshops had the unintended consequence of prompting several alternative constructions of the sunspot number. Thus it has been necessary to expand and extend the sunspot number reconciliation process. On the solar wind side, after a decade of controversy, an ISSI International Team used geomagnetic and sunspot data to obtain a high-confidence time series of the solar wind magnetic field strength (B) from 1750-present that can be compared with two independent long-term (> ˜600 year) series of annual B-values based on cosmogenic nuclides. In this paper, we trace the twists and turns leading to our current understanding of long-term solar and solar wind activity.

  2. Signatures of Slow Solar Wind Streams from Active Regions in the Inner Corona

    Science.gov (United States)

    Slemzin, V.; Harra, L.; Urnov, A.; Kuzin, S.; Goryaev, F.; Berghmans, D.

    2013-08-01

    The identification of solar-wind sources is an important question in solar physics. The existing solar-wind models ( e.g., the Wang-Sheeley-Arge model) provide the approximate locations of the solar wind sources based on magnetic field extrapolations. It has been suggested recently that plasma outflows observed at the edges of active regions may be a source of the slow solar wind. To explore this we analyze an isolated active region (AR) adjacent to small coronal hole (CH) in July/August 2009. On 1 August, Hinode/EUV Imaging Spectrometer observations showed two compact outflow regions in the corona. Coronal rays were observed above the active-region coronal hole (ARCH) region on the eastern limb on 31 July by STEREO-A/EUVI and at the western limb on 7 August by CORONAS- Photon/TESIS telescopes. In both cases the coronal rays were co-aligned with open magnetic-field lines given by the potential field source surface model, which expanded into the streamer. The solar-wind parameters measured by STEREO-B, ACE, Wind, and STEREO-A confirmed the identification of the ARCH as a source region of the slow solar wind. The results of the study support the suggestion that coronal rays can represent signatures of outflows from ARs propagating in the inner corona along open field lines into the heliosphere.

  3. Solar wind controlled pulsations: A review

    International Nuclear Information System (INIS)

    Odera, T.J.

    1986-01-01

    Studies of the solar wind controlled Pc 3, 4 pulsations by early and recent researchers are highlighted. The review focuses on the recent observations, which cover the time during the International Magnetospheric Study (IMS). Results from early and recent observations agree on one point, that is, that the Pc 3, 4 pulsations are influenced by three main solar wind parameters, namely, the solar wind velocity V/sub 5w/, the IMF orientation theta/sub x/B, and magnitude B. The results can be interpreted, preferably, in terms of an external origin for Pc 3, 4 pulsations. This implies, essentially, the signal model, which means that the pulsations originate in the upstream waves (in the interplanetary medium) and are transported by convection to the magnetopause, where they couple to oscillations of the magnetospheric field lines

  4. Spectroscopic Measurements of the Ion Velocity Distribution at the Base of the Fast Solar Wind

    Science.gov (United States)

    Jeffrey, Natasha L. S.; Hahn, Michael; Savin, Daniel W.; Fletcher, Lyndsay

    2018-03-01

    In situ measurements of the fast solar wind reveal non-thermal distributions of electrons, protons, and minor ions extending from 0.3 au to the heliopause. The physical mechanisms responsible for these non-thermal properties and the location where these properties originate remain open questions. Here, we present spectroscopic evidence, from extreme ultraviolet spectroscopy, that the velocity distribution functions (VDFs) of minor ions are already non-Gaussian at the base of the fast solar wind in a coronal hole, at altitudes of thermal equilibrium, (b) fluid motions such as non-Gaussian turbulent fluctuations or non-uniform wave motions, or (c) some combination of both. These observations provide important empirical constraints for the source region of the fast solar wind and for the theoretical models of the different acceleration, heating, and energy deposition processes therein. To the best of our knowledge, this is the first time that the ion VDF in the fast solar wind has been probed so close to its source region. The findings are also a timely precursor to the upcoming 2018 launch of the Parker Solar Probe, which will provide the closest in situ measurements of the solar wind at approximately 0.04 au (8.5 solar radii).

  5. Solar wind conditions for a quiet magnetosphere

    International Nuclear Information System (INIS)

    Kerns, K.J.; Gussenhoven, M.S.

    1990-01-01

    The conditions of the solar wind that lead to a quiet magnetosphere are determined under the assumption that the quiet or baseline magnetosphere can be identified by prolonged periods of low values of the am index. The authors analyzed solar wind data from 1978 to 1984 (7 years) during periods in which am ≤ 3 nT to identify those solar wind parameters that deviate significantly from average values. Parallel studies were also performed for prolonged periods of Kp = 0, 0+ and AE z ) show distinctive variations from average values. They independently varied these solar wind parameters and the length of time the conditions must persist to minimize am. This was done with the additional requirement that the conditions yield a reasonable number of occurrences (5% of the data set). The resulting baseline conditions are V ≤ 390 km/s; 180 degree - arctan |B y /B z | ≤ 101 degree, when b z ≤ 0 (no restriction on B z positive); B ≤ 6.5 nT; and persistence of these conditions for at least 5 hours. Minimizing the am index does not require a clear upper limit on the value of B z as might be anticipated from the work of Gussenhoven (1988) and Berthelier (1980). Apparently, this is a result of the requirement that the conditions must occur 5% of the time. When the requirement is lowered to 1% occurrence, an upper limit to B z emerges

  6. Wave-trains in the solar wind. III

    International Nuclear Information System (INIS)

    Richter, A.K.

    1975-01-01

    Applying an Alfven-Wave-Extended-QRH-approximation and the method of characteristics, the equations of motion for outwardly propagating Alfven waves are solved analytically for three different cases of an azimuthal dependence of the background solar wind, (a) for a pure fast-slow stream configuration, (b) for the situation where the high-speed stream originates from a diverging magnetic field, and (c) for the case of (b) and an initially decreasing density configuration ('coronal hole'). The reaction of these waves on the background state as well as mode-mode coupling effects are neglected. These three solar wind models are discussed shortly. For the superimposed Alfven waves it is found, on an average, that there is a strong azimuthal dependence of all relevant parameters which, correlated with the azimuthal distributions of the solar wind variables, leads to good agreements with observations. The signature of high-speed streams and these correlations could clearly indicate solar wind streams originating from 'coronal holes'. Contrary to the purely radial solar wind, where outwardly propagating Alfven waves are exclusively refracted towards the radial direction, a refraction nearly perpendicular to the direction of the interplanetary magnetic field in the compression region and closely towards the magnetic field direction down the trailing edge and in the low-speed regime is found. (Auth.)

  7. Verification of high-speed solar wind stream forecasts using operational solar wind models

    DEFF Research Database (Denmark)

    Reiss, Martin A.; Temmer, Manuela; Veronig, Astrid M.

    2016-01-01

    and the background solar wind conditions. We found that both solar wind models are capable of predicting the large-scale features of the observed solar wind speed (root-mean-square error, RMSE ≈100 km/s) but tend to either overestimate (ESWF) or underestimate (WSA) the number of high-speed solar wind streams (threat......High-speed solar wind streams emanating from coronal holes are frequently impinging on the Earth's magnetosphere causing recurrent, medium-level geomagnetic storm activity. Modeling high-speed solar wind streams is thus an essential element of successful space weather forecasting. Here we evaluate...... high-speed stream forecasts made by the empirical solar wind forecast (ESWF) and the semiempirical Wang-Sheeley-Arge (WSA) model based on the in situ plasma measurements from the Advanced Composition Explorer (ACE) spacecraft for the years 2011 to 2014. While the ESWF makes use of an empirical relation...

  8. 26 CFR 31.3306(b)-1 - Wages.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Wages. 31.3306(b)-1 Section 31.3306(b)-1... Unemployment Tax Act (Chapter 23, Internal Revenue Code of 1954) § 31.3306(b)-1 Wages. (a) Applicable law and... after 1938 constitutes wages is determined under section 3306(b). Accordingly, only remuneration paid...

  9. Solar Wind Charge Exchange During Geomagnetic Storms

    Science.gov (United States)

    Robertson, Ina P.; Cravens, Thomas E.; Sibeck, David G.; Collier, Michael R.; Kuntz, K. D.

    2012-01-01

    On March 31st. 2001, a coronal mass ejection pushed the subsolar magnetopause to the vicinity of geosynchronous orbit at 6.6 RE. The NASA/GSFC Community Coordinated Modeling Center (CCMe) employed a global magnetohydrodynamic (MHD) model to simulate the solar wind-magnetosphere interaction during the peak of this geomagnetic storm. Robertson et aL then modeled the expected 50ft X-ray emission due to solar wind charge exchange with geocoronal neutrals in the dayside cusp and magnetosheath. The locations of the bow shock, magnetopause and cusps were clearly evident in their simulations. Another geomagnetic storm took place on July 14, 2000 (Bastille Day). We again modeled X-ray emission due to solar wind charge exchange, but this time as observed from a moving spacecraft. This paper discusses the impact of spacecraft location on observed X-ray emission and the degree to which the locations of the bow shock and magnetopause can be detected in images.

  10. DETAILED FIT OF 'CRITICAL BALANCE' THEORY TO SOLAR WIND TURBULENCE MEASUREMENTS

    International Nuclear Information System (INIS)

    Forman, Miriam A.; Wicks, Robert T.; Horbury, Timothy S.

    2011-01-01

    We derive the reduced spectrum of turbulent magnetic fluctuations at different frequencies f which would be observed by a single spacecraft in the solar wind when the magnetic field was at an angle θ B to the solar wind flow, if the wavevector spectrum in the solar wind frame were in anisotropic 'critical balance' (CB) as proposed by Goldreich and Sridhar in 1995 (GS95). The anisotropic power spectrum in the inertial range, P(f, θ B ), is scaled onto one curve with f- 5/3 behavior at θ B near 90 0 and f -2 behavior at small θ B . The transition between the two limiting spectra depends on the form of the GS95 wavevector spectrum and the CB scaling parameter L. Using wavelet analysis of Ulysses magnetic field data in three 30-day periods in the high-latitude solar wind in 1995, we verify that the scaling of power with angle and frequency is qualitatively consistent with GS95 theory. However, the scale length L required to fit the observed P(f, θ B ) to the original CB theory is rather less than the scale predicted by that theory for the solar wind. Part, possibly all, of this discrepancy is removed when the GS95 theory modified for imbalanced turbulence is used.

  11. Weakest solar wind of the space age and the current 'MINI' solar maximum

    International Nuclear Information System (INIS)

    McComas, D. J.; Angold, N.; Elliott, H. A.; Livadiotis, G.; Schwadron, N. A.; Smith, C. W.; Skoug, R. M.

    2013-01-01

    The last solar minimum, which extended into 2009, was especially deep and prolonged. Since then, sunspot activity has gone through a very small peak while the heliospheric current sheet achieved large tilt angles similar to prior solar maxima. The solar wind fluid properties and interplanetary magnetic field (IMF) have declined through the prolonged solar minimum and continued to be low through the current mini solar maximum. Compared to values typically observed from the mid-1970s through the mid-1990s, the following proton parameters are lower on average from 2009 through day 79 of 2013: solar wind speed and beta (∼11%), temperature (∼40%), thermal pressure (∼55%), mass flux (∼34%), momentum flux or dynamic pressure (∼41%), energy flux (∼48%), IMF magnitude (∼31%), and radial component of the IMF (∼38%). These results have important implications for the solar wind's interaction with planetary magnetospheres and the heliosphere's interaction with the local interstellar medium, with the proton dynamic pressure remaining near the lowest values observed in the space age: ∼1.4 nPa, compared to ∼2.4 nPa typically observed from the mid-1970s through the mid-1990s. The combination of lower magnetic flux emergence from the Sun (carried out in the solar wind as the IMF) and associated low power in the solar wind points to the causal relationship between them. Our results indicate that the low solar wind output is driven by an internal trend in the Sun that is longer than the ∼11 yr solar cycle, and they suggest that this current weak solar maximum is driven by the same trend.

  12. Geometry of solar corona expansion and solar wind parameters

    International Nuclear Information System (INIS)

    Krajnev, M.B.

    1980-01-01

    The character of the parameter chanqe of solar wind plasma in the region of the Earth orbit is studied. The main regularities in the parametep behaviour of solar wind (plasma velocity and density) are qualitatively explained in the framework of a model according to which solar corona expansion stronqly differs from radial expansion, that is: the solar wind current lines are focused towards helioequator during the period of low solar activity with gradual transfer to radial expansion during the years of high solar activity. It is shown that the geometry of the solar wind current tubes and its change with the solar activity cycle can not serve an explanation of the observed change of the solar wind parameters

  13. 77 FR 61597 - Avalon Wind, LLC; Avalon Wind 2, LLC; Catalina Solar, LLC; Catalina Solar 2, LLC; Pacific Wind...

    Science.gov (United States)

    2012-10-10

    ... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. EL12-109-000] Avalon Wind, LLC; Avalon Wind 2, LLC; Catalina Solar, LLC; Catalina Solar 2, LLC; Pacific Wind Lessee, LLC; Pacific Wind 2, LLC; Valentine Solar, LLC; EDF Renewable Development, Inc.; Notice of Petition for Declaratory...

  14. Variation of the solar wind velocity following solar flares

    International Nuclear Information System (INIS)

    Huang, Y.; Lee, Y.

    1975-01-01

    By use of the superposed epoch method, changes in the solar wind velocity following solar flares have been investigated by using the solar wind velocity data obtained by Pioneer 6 and 7 and Vela 3, 4, and 5 satellites. A significant increase of the solar wind velocity has been found on the second day following importance 3 solar flares and on the third day following importance 2 solar flares. No significant increase of the solar wind velocity has been found for limb flares. (auth)

  15. A comparison of solar wind streams and coronal structure near solar minimum

    Science.gov (United States)

    Nolte, J. T.; Davis, J. M.; Gerassimenko, M.; Lazarus, A. J.; Sullivan, J. D.

    1977-01-01

    Solar wind data from the MIT detectors on the IMP 7 and 8 satellites and the SOLRAD 11B satellite for the solar-minimum period September-December, 1976, were compared with X-ray images of the solar corona taken by rocket-borne telescopes on September 16 and November 17, 1976. There was no compelling evidence that a coronal hole was the source of any high speed stream. Thus it is possible that either coronal holes were not the sources of all recurrent high-speed solar wind streams during the declining phase of the solar cycle, as might be inferred from the Skylab period, or there was a change in the appearance of some magnetic field regions near the time of solar minimum.

  16. Wind and solar resource data sets: Wind and solar resource data sets

    Energy Technology Data Exchange (ETDEWEB)

    Clifton, Andrew [National Renewable Energy Laboratory, Golden CO USA; Hodge, Bri-Mathias [National Renewable Energy Laboratory, Golden CO USA; Power Systems Engineering Center, National Renewable Energy Laboratory, Golden CO USA; Draxl, Caroline [National Renewable Energy Laboratory, Golden CO USA; National Wind Technology Center, National Renewable Energy Laboratory, Golden CO USA; Badger, Jake [Department of Wind Energy, Danish Technical University, Copenhagen Denmark; Habte, Aron [National Renewable Energy Laboratory, Golden CO USA; Power Systems Engineering Center, National Renewable Energy Laboratory, Golden CO USA

    2017-12-05

    The range of resource data sets spans from static cartography showing the mean annual wind speed or solar irradiance across a region to high temporal and high spatial resolution products that provide detailed information at a potential wind or solar energy facility. These data sets are used to support continental-scale, national, or regional renewable energy development; facilitate prospecting by developers; and enable grid integration studies. This review first provides an introduction to the wind and solar resource data sets, then provides an overview of the common methods used for their creation and validation. A brief history of wind and solar resource data sets is then presented, followed by areas for future research.

  17. Does the magnetic expansion factor (fs) play a role in solar wind acceleration?

    Science.gov (United States)

    Wallace, Samantha; Arge, Charles N.; Pihlstrom, Ylva

    2017-08-01

    For the past 25 years, magnetic expansion factor (fs) has been a key parameter used in the calculation of terminal solar wind speed (vsw) in both the Wang-Sheeley-Arge (WSA) model and its predecessor the Wang-Sheeley (WS) model. Since the discovery of an inverse relationship between fs and vsw, the physical role that magnetic expansion factor plays in the acceleration of the solar wind has been explored and debated. In this study, we investigate whether magnetic expansion factor plays a causal role in determining the terminal speed of the solar wind or merely serves as proxy. To do so, we explore how fs, as determined by WSA, relates to vsw for two different scenarios: 1) extended periods where the fast solar wind emerges from the centers of large coronal holes, and 2) periods where the solar wind emerges from pseudostreamers. For these same scenarios, we will also consider an alternative empirical relationship between solar wind speed and the minimum angular distance at the photosphere of a solar wind source to the nearest coronal hole boundary (i.e., DCHB, θb). We then compare these two different prediction techniques directly with heliospheric observations (i.e., ACE, STEREO-A & B, Ulysses) of solar wind speed to determine whether one clearly out performs the other.

  18. Solar wind radiation damage in lunar dust grains and the characteristics of the ancient solar wind

    International Nuclear Information System (INIS)

    Borg, J.; Chaumont, J.

    1980-01-01

    Current understanding of the exposure history of lunar dust grains to the ancient solar wind is reviewed, the work being based mostly on a Monte Carlo statistical code, describing the 'gardening' effects of the meteorite bombardment in the lunar regolith, and on analytical models, yielding the lifetimes of the grains against various types of destruction processes. Families of lunar dust grains are identified, and evidence is presented showing that lunar dust grains were not partially shielded from solar wind ions. Results of solar wind simulation experiments are used to interpret the thickness distribution of the amorphous coatings of solar wind radiation-damaged material observed on 1-micron lunar dust grains. It is argued that such distributions reflect the speed distribution of the ancient solar wind as averaged over periods of approximately 5000 years in duration, and that the ancient solar wind is less energetic than the present day solar wind

  19. 26 CFR 31.3401(b)-1 - Payroll period.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Payroll period. 31.3401(b)-1 Section 31.3401(b... Collection of Income Tax at Source § 31.3401(b)-1 Payroll period. (a) The term payroll period means the... elapsed and receives the remainder at the end of the week, the payroll period is still the calendar week...

  20. Solar wind classification from a machine learning perspective

    Science.gov (United States)

    Heidrich-Meisner, V.; Wimmer-Schweingruber, R. F.

    2017-12-01

    It is a very well known fact that the ubiquitous solar wind comes in at least two varieties, the slow solar wind and the coronal hole wind. The simplified view of two solar wind types has been frequently challenged. Existing solar wind categorization schemes rely mainly on different combinations of the solar wind proton speed, the O and C charge state ratios, the Alfvén speed, the expected proton temperature and the specific proton entropy. In available solar wind classification schemes, solar wind from stream interaction regimes is often considered either as coronal hole wind or slow solar wind, although their plasma properties are different compared to "pure" coronal hole or slow solar wind. As shown in Neugebauer et al. (2016), even if only two solar wind types are assumed, available solar wind categorization schemes differ considerably for intermediate solar wind speeds. Thus, the decision boundary between the coronal hole and the slow solar wind is so far not well defined.In this situation, a machine learning approach to solar wind classification can provide an additional perspective.We apply a well-known machine learning method, k-means, to the task of solar wind classification in order to answer the following questions: (1) How many solar wind types can reliably be identified in our data set comprised of ten years of solar wind observations from the Advanced Composition Explorer (ACE)? (2) Which combinations of solar wind parameters are particularly useful for solar wind classification?Potential subtypes of slow solar wind are of particular interest because they can provide hints of respective different source regions or release mechanisms of slow solar wind.

  1. Solar wind structure out of the ecliptic plane over solar cycles

    Science.gov (United States)

    Sokol, J. M.; Bzowski, M.; Tokumaru, M.

    2017-12-01

    Sun constantly emits a stream of plasma known as solar wind. Ground-based observations of the solar wind speed through the interplanetary scintillations (IPS) of radio flux from distant point sources and in-situ measurements by Ulysses mission revealed that the solar wind flow has different characteristics depending on the latitude. This latitudinal structure evolves with the cycle of solar activity. The knowledge on the evolution of solar wind structure is important for understanding the interaction between the interstellar medium surrounding the Sun and the solar wind, which is responsible for creation of the heliosphere. The solar wind structure must be taken into account in interpretation of most of the observations of heliospheric energetic neutral atoms, interstellar neutral atoms, pickup ions, and heliospheric backscatter glow. The information on the solar wind structure is not any longer available from direct measurements after the termination of Ulysses mission and the only source of the solar wind out of the ecliptic plane is the IPS observations. However, the solar wind structure obtained from this method contains inevitable gaps in the time- and heliolatitude coverage. Sokół et al 2015 used the solar wind speed data out of the ecliptic plane retrieved from the IPS observations performed by Institute for Space-Earth Environmental Research (Nagoya University, Japan) and developed a methodology to construct a model of evolution of solar wind speed and density from 1985 to 2013 that fills the data gaps. In this paper we will present a refined model of the solar wind speed and density structure as a function of heliographic latitude updated by the most recent data from IPS observations. And we will discuss methods of extrapolation of the solar wind structure out of the ecliptic plane for the past solar cycles, when the data were not available, as well as forecasting for few years upward.

  2. ISOTOPIC MASS FRACTIONATION OF SOLAR WIND: EVIDENCE FROM FAST AND SLOW SOLAR WIND COLLECTED BY THE GENESIS MISSION

    International Nuclear Information System (INIS)

    Heber, Veronika S.; Baur, Heinrich; Wieler, Rainer; Bochsler, Peter; McKeegan, Kevin D.; Neugebauer, Marcia; Reisenfeld, Daniel B.; Wiens, Roger C.

    2012-01-01

    NASA's Genesis space mission returned samples of solar wind collected over ∼2.3 years. We present elemental and isotopic compositions of He, Ne, and Ar analyzed in diamond-like carbon targets from the slow and fast solar wind collectors to investigate isotopic fractionation processes during solar wind formation. The solar wind provides information on the isotopic composition for most volatile elements for the solar atmosphere, the bulk Sun and hence, on the solar nebula from which it formed 4.6 Ga ago. Our data reveal a heavy isotope depletion in the slow solar wind compared to the fast wind composition by 63.1 ± 2.1 per mille for He, 4.2 ± 0.5 per mille amu –1 for Ne and 2.6 ± 0.5 per mille amu –1 for Ar. The three Ne isotopes suggest that isotopic fractionation processes between fast and slow solar wind are mass dependent. The He/H ratios of the collected slow and fast solar wind samples are 0.0344 and 0.0406, respectively. The inefficient Coulomb drag model reproduces the measured isotopic fractionation between fast and slow wind. Therefore, we apply this model to infer the photospheric isotopic composition of He, Ne, and Ar from our solar wind data. We also compare the isotopic composition of oxygen and nitrogen measured in the solar wind with values of early solar system condensates, probably representing solar nebula composition. We interpret the differences between these samples as being due to isotopic fractionation during solar wind formation. For both elements, the magnitude and sign of the observed differences are in good agreement with the values predicted by the inefficient Coulomb drag model.

  3. ISOTOPIC MASS FRACTIONATION OF SOLAR WIND: EVIDENCE FROM FAST AND SLOW SOLAR WIND COLLECTED BY THE GENESIS MISSION

    Energy Technology Data Exchange (ETDEWEB)

    Heber, Veronika S.; Baur, Heinrich; Wieler, Rainer [Institute for Geochemistry and Petrology, ETH Zurich, Clausiusstrasse 25, CH-8092 Zurich (Switzerland); Bochsler, Peter [Physikalisches Institut, Universitaet Bern, Sidlerstasse 5, CH-3012 Bern (Switzerland); McKeegan, Kevin D. [Department of Earth and Space Sciences, University of California Los Angeles, 595 Charles Young Drive East, Box 951567, Los Angeles, CA 90095-1567 (United States); Neugebauer, Marcia [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721-0092 (United States); Reisenfeld, Daniel B. [Department of Physics and Astronomy, University of Montana, Missoula, MT 59812 (United States); Wiens, Roger C., E-mail: heber@ess.ucla.edu [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States)

    2012-11-10

    NASA's Genesis space mission returned samples of solar wind collected over {approx}2.3 years. We present elemental and isotopic compositions of He, Ne, and Ar analyzed in diamond-like carbon targets from the slow and fast solar wind collectors to investigate isotopic fractionation processes during solar wind formation. The solar wind provides information on the isotopic composition for most volatile elements for the solar atmosphere, the bulk Sun and hence, on the solar nebula from which it formed 4.6 Ga ago. Our data reveal a heavy isotope depletion in the slow solar wind compared to the fast wind composition by 63.1 {+-} 2.1 per mille for He, 4.2 {+-} 0.5 per mille amu{sup -1} for Ne and 2.6 {+-} 0.5 per mille amu{sup -1} for Ar. The three Ne isotopes suggest that isotopic fractionation processes between fast and slow solar wind are mass dependent. The He/H ratios of the collected slow and fast solar wind samples are 0.0344 and 0.0406, respectively. The inefficient Coulomb drag model reproduces the measured isotopic fractionation between fast and slow wind. Therefore, we apply this model to infer the photospheric isotopic composition of He, Ne, and Ar from our solar wind data. We also compare the isotopic composition of oxygen and nitrogen measured in the solar wind with values of early solar system condensates, probably representing solar nebula composition. We interpret the differences between these samples as being due to isotopic fractionation during solar wind formation. For both elements, the magnitude and sign of the observed differences are in good agreement with the values predicted by the inefficient Coulomb drag model.

  4. Solar wind structure suggested by bimodal correlations of solar wind speed and density between the spacecraft SOHO and Wind

    Science.gov (United States)

    Ogilvie, K. W.; Coplan, M. A.; Roberts, D. A.; Ipavich, F.

    2007-08-01

    We calculate the cross-spacecraft maximum lagged-cross-correlation coefficients for 2-hour intervals of solar wind speed and density measurements made by the plasma instruments on the Solar and Heliospheric Observatory (SOHO) and Wind spacecraft over the period from 1996, the minimum of solar cycle 23, through the end of 2005. During this period, SOHO was located at L1, about 200 R E upstream from the Earth, while Wind spent most of the time in the interplanetary medium at distances of more than 100 R E from the Earth. Yearly histograms of the maximum, time-lagged correlation coefficients for both the speed and density are bimodal in shape, suggesting the existence of two distinct solar wind regimes. The larger correlation coefficients we suggest are due to structured solar wind, including discontinuities and shocks, while the smaller are likely due to Alfvénic turbulence. While further work will be required to firmly establish the physical nature of the two populations, the results of the analysis are consistent with a solar wind that consists of turbulence from quiet regions of the Sun interspersed with highly filamentary structures largely convected from regions in the inner solar corona. The bimodal appearance of the distributions is less evident in the solar wind speed than in the density correlations, consistent with the observation that the filamentary structures are convected with nearly constant speed by the time they reach 1 AU. We also find that at solar minimum the fits for the density correlations have smaller high-correlation components than at solar maximum. We interpret this as due to the presence of more relatively uniform Alfvénic regions at solar minimum than at solar maximum.

  5. Electrostatic Solitary Waves in the Solar Wind: Evidence for Instability at Solar Wind Current Sheets

    Science.gov (United States)

    Malaspina, David M.; Newman, David L.; Wilson, Lynn Bruce; Goetz, Keith; Kellogg, Paul J.; Kerstin, Kris

    2013-01-01

    A strong spatial association between bipolar electrostatic solitary waves (ESWs) and magnetic current sheets (CSs) in the solar wind is reported here for the first time. This association requires that the plasma instabilities (e.g., Buneman, electron two stream) which generate ESWs are preferentially localized to solar wind CSs. Distributions of CS properties (including shear angle, thickness, solar wind speed, and vector magnetic field change) are examined for differences between CSs associated with ESWs and randomly chosen CSs. Possible mechanisms for producing ESW-generating instabilities at solar wind CSs are considered, including magnetic reconnection.

  6. THE CONTRIBUTION OF CORONAL JETS TO THE SOLAR WIND

    Energy Technology Data Exchange (ETDEWEB)

    Lionello, R.; Török, T.; Titov, V. S.; Mikić, Z.; Linker, J. A. [Predictive Science Inc., 9990 Mesa Rim Road, Suite 170, San Diego, CA 92121 (United States); Leake, J. E.; Linton, M. G., E-mail: lionel@predsci.com [US Naval Research Laboratory 4555 Overlook Avenue, SW Washington, DC 20375 (United States)

    2016-11-01

    Transient collimated plasma eruptions in the solar corona, commonly known as coronal (or X-ray) jets, are among the most interesting manifestations of solar activity. It has been suggested that these events contribute to the mass and energy content of the corona and solar wind, but the extent of these contributions remains uncertain. We have recently modeled the formation and evolution of coronal jets using a three-dimensional (3D) magnetohydrodynamic (MHD) code with thermodynamics in a large spherical domain that includes the solar wind. Our model is coupled to 3D MHD flux-emergence simulations, i.e., we use boundary conditions provided by such simulations to drive a time-dependent coronal evolution. The model includes parametric coronal heating, radiative losses, and thermal conduction, which enables us to simulate the dynamics and plasma properties of coronal jets in a more realistic manner than done so far. Here, we employ these simulations to calculate the amount of mass and energy transported by coronal jets into the outer corona and inner heliosphere. Based on observed jet-occurrence rates, we then estimate the total contribution of coronal jets to the mass and energy content of the solar wind to (0.4–3.0)% and (0.3–1.0)%, respectively. Our results are largely consistent with the few previous rough estimates obtained from observations, supporting the conjecture that coronal jets provide only a small amount of mass and energy to the solar wind. We emphasize, however, that more advanced observations and simulations (including parametric studies) are needed to substantiate this conjecture.

  7. Characteristics of Solar Wind Density Depletions During Solar Cycles 23 and 24

    Directory of Open Access Journals (Sweden)

    Keunchan Park

    2017-06-01

    Full Text Available Solar wind density depletions are phenomena that solar wind density is rapidly decreased and keep the state. They are generally believed to be caused by the interplanetary (IP shocks. However, there are other cases that are hardly associated with IP shocks. We set up a hypothesis for this phenomenon and analyze this study. We have collected the solar wind parameters such as density, speed and interplanetary magnetic field (IMF data related to the solar wind density depletion events during the period from 1996 to 2013 that are obtained with the advanced composition explorer (ACE and the Wind satellite. We also calculate two pressures (magnetic, dynamic and analyze the relation with density depletion. As a result, we found total 53 events and the most these phenomena’s sources caused by IP shock are interplanetary coronal mass ejection (ICME. We also found that solar wind density depletions are scarcely related with IP shock’s parameters. The solar wind density is correlated with solar wind dynamic pressure within density depletion. However, the solar wind density has an little anti-correlation with IMF strength during all events of solar wind density depletion, regardless of the presence of IP shocks. Additionally, In 47 events of IP shocks, we find 6 events that show a feature of blast wave. The quantities of IP shocks are weaker than blast wave from the Sun, they are declined in a short time after increasing rapidly. We thus argue that IMF strength or dynamic pressure are an important factor in understanding the nature of solar wind density depletion. Since IMF strength and solar wind speed varies with solar cycle, we will also investigate the characteristics of solar wind density depletion events in different phases of solar cycle as an additional clue to their physical nature.

  8. Solar Panel Buffeted by Wind at Phoenix Site

    Science.gov (United States)

    2008-01-01

    Winds were strong enough to cause about a half a centimeter (.19 inch) of motion of a solar panel on NASA's Phoenix Mars lander when the lander's Surface Stereo Imager took this picture on Aug. 31, 2008, during the 96th Martian day since landing. The lander's telltale wind gauge has been indicating wind speeds of about 4 meters per second (9 miles per hour) during late mornings at the site. These conditions were anticipated and the wind is not expected to do any harm to the lander. The Phoenix Mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is by NASA's Jet Propulsion Laboratory, Pasadena, Calif. Spacecraft development is by Lockheed Martin Space Systems, Denver.

  9. A Generalized Equatorial Model for the Accelerating Solar Wind

    Science.gov (United States)

    Tasnim, S.; Cairns, Iver H.; Wheatland, M. S.

    2018-02-01

    A new theoretical model for the solar wind is developed that includes the wind's acceleration, conservation of angular momentum, deviations from corotation, and nonradial velocity and magnetic field components from an inner boundary (corresponding to the onset of the solar wind) to beyond 1 AU. The model uses a solution of the time-steady isothermal equation of motion to describe the acceleration and analytically predicts the Alfvénic critical radius. We fit the model to near-Earth observations of the Wind spacecraft during the solar rotation period of 1-27 August 2010. The resulting data-driven model demonstrates the existence of noncorotating, nonradial flows and fields from the inner boundary (r = rs) outward and predicts the magnetic field B = (Br,Bϕ), velocity v = (vr,vϕ), and density n(r,ϕ,t), which vary with heliocentric distance r, heliolatitude ϕ, and time t in a Sun-centered standard inertial plane. The description applies formally only in the equatorial plane. In a frame corotating with the Sun, the transformed velocity v' and a field B' are not parallel, resulting in an electric field with a component Ez' along the z axis. The resulting E'×B'=E'×B drift lies in the equatorial plane, while the ∇B and curvature drifts are out of the plane. Together these may lead to enhanced scattering/heating of sufficiently energetic particles. The model predicts that deviations δvϕ from corotation at the inner boundary are common, with δvϕ(rs,ϕs,ts) comparable to the transverse velocities due to granulation and supergranulation motions. Abrupt changes in δvϕ(rs,ϕs,ts) are interpreted in terms of converging and diverging flows at the cell boundaries and centers, respectively. Large-scale variations in the predicted angular momentum demonstrate that the solar wind can drive vorticity and turbulence from near the Sun to 1 AU and beyond.

  10. The solar wind plasma density control of night-time auroral particle precipitation

    Directory of Open Access Journals (Sweden)

    V. G. Vorobjev

    2004-03-01

    Full Text Available DMSP F6 and F7 spacecraft observations of the average electron and ion energy, and energy fluxes in different night-time precipitation regions for the whole of 1986 were used to examine the precipitation features associated with solar wind density changes. It was found that during magnetic quietness |AL|<100nT, the enhancement of average ion fluxes was observed at least two times, along with the solar wind plasma density increase from 2 to 24cm–3. More pronounced was the ion flux enhancement that occurred in the b2i–b4s and b4s–b5 regions, which are approximately corresponding to the statistical auroral oval and map to the magnetospheric plasma sheet tailward of the isotropy boundary. The average ion energy decrease of about 2–4kev was registered simultaneously with this ion flux enhancement. The results verify the occurrence of effective penetration of the solar wind plasma into the magnetospheric tail plasma sheet. Key words. Ionosphere (auroral ionosphere, particle precipitation – Magnetospheric physics (solar windmagnetosphere interaction

  11. Solar cycle variation of cosmic ray intensity along with interplanetary and solar wind plasma parameters

    International Nuclear Information System (INIS)

    Mishra, R.K.; Tiwari, S.; Agarwal, R.

    2008-01-01

    Galactic cosmic rays are modulated at their propagation in the heliosphere by the effect of the large-scale structure of the interplanetary medium. A comparison of the variations in the cosmic ray intensity data obtained by neutron monitoring stations with those in geomagnetic disturbance, solar wind velocity (V), interplanetary magnetic field (B), and their product (V , B) near the Earth for the period 1964-2004 has been presented so as to establish a possible correlation between them. We used the hourly averaged cosmic ray counts observed with the neutron monitor in Moscow. It is noteworthy that a significant negative correlation has been observed between the interplanetary magnetic field, product (V , B) and cosmic ray intensity during the solar cycles 21 and 22. The solar wind velocity has a good positive correlation with cosmic ray intensity during solar cycle 21, whereas it shows a weak correlation during cycles 20, 22 and 23. The interplanetary magnetic field shows a weak negative correlation with cosmic rays for solar cycle 20, and a good anti-correlation for solar cycles 21-23 with the cosmic ray intensity, which, in turn, shows a good positive correlation with disturbance time index (Dst) during solar cycles 21 and 22, and a weak correlation for cycles 20 and 23. (Authors)

  12. Inhibition of solar wind impingement on Mercury by planetary induction currents

    International Nuclear Information System (INIS)

    Hood, L.L.; Schubert, G.

    1979-01-01

    The simple compression of a planetary magnetosphere by varying solar wind stagnation pressure is limited by currents induced in the electrically conducting parts of the planet. This inhibition is especially important for Mercury, since the radius of the electrically conducting iron core is a large fraction of the planetary radius, which in turn is a significant fraction of the subsolar magnetospheric radius b. Previous treatments of solar wind standoff distance variations at Mercury using the terrestrial analogue b 6 assumption have neglected this phenomenon. Using the lowest suggested value of the planetary dipole moment, 2.4 x 10 22 G cm 3 , we estimate that a minimum pressure of approx.38P 0 where P 0 is the external stagnation pressure in the steady state, is required to force the standoff distance down to the subsolar surface of Mercury if the pressure change persists for at least 1 day. This value is 4.3 times that which would be predicted if Mercury had no core, and it is larger than the maximum pressure predicted at Mercury's orbit (approx.25P 0 ) on the basis of hourly averaged solar wind statistics at 1 AU. Thus a direct interaction at any time of solar wind plasma with the surface of Mercury due to external compression effects alone is unlikely for solar wind conditions similar to those at present

  13. Solar wind stagnation near comets

    International Nuclear Information System (INIS)

    Galeev, A.A.; Cravens, T.E.; Gombosi, T.I.

    1983-03-01

    The nature of the solar wind flow near comets is examined analytically. In particular, the typical values for the stagnation pressure and magnetic barrier strength are estimated, taking into account the magnetic field line tension and the charge exchange cooling of the mass loaded solar wind. Knowledge of the strength of the magnetic barrier is required in order to determine the location of the contact discontinuity which separates the contaminated solar wind plasma and the outflowing plasma of the cometary ionosphere. (author)

  14. Astrospheres and Solar-like Stellar Winds

    Directory of Open Access Journals (Sweden)

    Wood Brian E.

    2004-07-01

    Full Text Available Stellar analogs for the solar wind have proven to be frustratingly difficult to detect directly. However, these stellar winds can be studied indirectly by observing the interaction regions carved out by the collisions between these winds and the interstellar medium (ISM. These interaction regions are called "astrospheres", analogous to the "heliosphere" surrounding the Sun. The heliosphere and astrospheres contain a population of hydrogen heated by charge exchange processes that can produce enough H I Ly alpha absorption to be detectable in UV spectra of nearby stars from the Hubble Space Telescope (HST. The amount of astrospheric absorption is a diagnostic for the strength of the stellar wind, so these observations have provided the first measurements of solar-like stellar winds. Results from these stellar wind studies and their implications for our understanding of the solar wind are reviewed here. Of particular interest are results concerning the past history of the solar wind and its impact on planetary atmospheres.

  15. KINETIC PLASMA TURBULENCE IN THE FAST SOLAR WIND MEASURED BY CLUSTER

    International Nuclear Information System (INIS)

    Roberts, O. W.; Li, X.; Li, B.

    2013-01-01

    The k-filtering technique and wave polarization analysis are applied to Cluster magnetic field data to study plasma turbulence at the scale of the ion gyroradius in the fast solar wind. Waves are found propagating in directions nearly perpendicular to the background magnetic field at such scales. The frequencies of these waves in the solar wind frame are much smaller than the proton gyrofrequency. After the wavevector k is determined at each spacecraft frequency f sc , wave polarization property is analyzed in the plane perpendicular to k. Magnetic fluctuations have δB > δB ∥ (here the ∥ and refer to the background magnetic field B 0 ). The wave magnetic field has right-handed polarization at propagation angles θ kB 90°. The magnetic field in the plane perpendicular to B 0 , however, has no clear sense of a dominant polarization but local rotations. We discuss the merits and limitations of linear kinetic Alfvén waves (KAWs) and coherent Alfvén vortices in the interpretation of the data. We suggest that the fast solar wind turbulence may be populated with KAWs, small-scale current sheets, and Alfvén vortices at ion kinetic scales.

  16. OBSERVATIONS OF THE HELIOSHEATH AND SOLAR WIND NEAR THE TERMINATION SHOCK BY VOYAGER 2

    International Nuclear Information System (INIS)

    Burlaga, L. F.; Ness, N. F.; Acuna, M. H.; Richardson, J. D.; Stone, E.; McDonald, F. B.

    2009-01-01

    This paper describes the principal features of 24 hr averages of the magnetic field strength variations B(t) and their relationships to the plasma and energetic particles observed prior to and after the crossing of the termination shock (TS) by Voyager 2 (V2). The solar wind (pre-TS crossing) and heliosheath (post-TS crossing) data extend from day of year (DOY) 1 through 241, 2007 and from 2007 DOY 245 through 2008 DOY 80, respectively. In the solar wind, two merged interaction regions (MIRs) were observed in which the ratio of plasma pressure to magnetic pressure in the solar wind was relatively low. Strong magnetic fields and low values of beta were also observed just prior to its crossing of the TS. The predicted correlation between peaks in the intensity of energetic particles in the solar wind when V2 crossed the heliospheric current sheet from positive to negative magnetic polarity in the solar wind was not observed. In the heliosheath, V2 observed a feature characterized by large enhancements of the density N and the proton temperature T, a small increase in speed V, and a depression in B. The distributions of 24 hr averages of B and beta were approximately log-normal in both the solar wind and the heliosheath. A unipolar region was observed for 73 days in the heliosheath, as the heliospheric current sheet moved toward the equatorial plane to latitudes lower than V2.

  17. Analysis of the solar/wind resources in Southern Spain for optimal sizing of hybrid solar-wind power generation systems

    Science.gov (United States)

    Quesada-Ruiz, S.; Pozo-Vazquez, D.; Santos-Alamillos, F. J.; Lara-Fanego, V.; Ruiz-Arias, J. A.; Tovar-Pescador, J.

    2010-09-01

    A drawback common to the solar and wind energy systems is their unpredictable nature and dependence on weather and climate on a wide range of time scales. In addition, the variation of the energy output may not match with the time distribution of the load demand. This can partially be solved by the use of batteries for energy storage in stand-alone systems. The problem caused by the variable nature of the solar and wind resources can be partially overcome by the use of energy systems that uses both renewable resources in a combined manner, that is, hybrid wind-solar systems. Since both resources can show complementary characteristics in certain location, the independent use of solar or wind systems results in considerable over sizing of the batteries system compared to the use of hybrid solar-wind systems. Nevertheless, to the day, there is no single recognized method for properly sizing these hybrid wind-solar systems. In this work, we present a method for sizing wind-solar hybrid systems in southern Spain. The method is based on the analysis of the wind and solar resources on daily scale, particularly, its temporal complementary characteristics. The method aims to minimize the size of the energy storage systems, trying to provide the most reliable supply.

  18. PHOTOIONIZATION IN THE SOLAR WIND

    Energy Technology Data Exchange (ETDEWEB)

    Landi, E.; Lepri, S. T., E-mail: elandi@umich.edu [Department of Climate and Space Sciences and Engineering, University of Michigan, Ann Arbor, MI 48109 (United States)

    2015-10-20

    In this work we investigate the effects of photoionization on the charge state composition of the solar wind. Using measured solar EUV and X-ray irradiance, the Michigan Ionization Code and a model for the fast and slow solar wind, we calculate the evolution of the charge state distribution of He, C, N, O, Ne, Mg, Si, S, and Fe with and without including photoionization for both types of wind. We find that the solar radiation has significant effects on the charge state distribution of C, N, and O, causing the ionization levels of these elements to be higher than without photoionization; differences are largest for oxygen. The ions commonly observed for elements heavier than O are much less affected, except in ICMEs where Fe ions more ionized than 16+ can also be affected by the solar radiation. We also show that the commonly used O{sup 7+}/O{sup 6+} density ratio is the most sensitive to photoionization; this sensitivity also causes the value of this ratio to depend on the phase of the solar cycle. We show that the O{sup 7+}/O{sup 6+} ratio needs to be used with caution for solar wind classification and coronal temperature estimates, and recommend the C{sup 6+}/C{sup 4+} ratio for these purposes.

  19. Solar Wind Earth Exchange Project (SWEEP)

    Science.gov (United States)

    2016-10-28

    highly charged ions of the solar wind. The main challenge in predicting the resultant photon flux in the X-ray energy bands is due to the...Newton, an X-ray astronomical observatory. We use OMNI solar wind conditions, heavy ion composition data from ACE, the Hodges neutral hydrogen model...of SWEEP was to compare theoretical models of X-ray emission in the terrestrial magnetosphere caused by the Solar Wind Charge Exchange

  20. Electricity generation comparison of food waste-based bioenergy with wind and solar powers: A mini review

    Directory of Open Access Journals (Sweden)

    Ngoc Bao Dung Thi

    2016-09-01

    Full Text Available The food waste treatment-based anaerobic digestion has been proven to play a primary role in electricity industry with high potentially economic benefits, which could reduce electricity prices in comparison with other renewable energy resources such as wind and solar power. The levelized costs of electricity were reported to be 65, 190, 130 and 204 US$ MWh−1 for food waste treatment in anaerobic landfill, anaerobic digestion biogas, solar power, and wind power, respectively. As examples, the approaches of food waste treatment via anaerobic digestion to provide a partial energy supply for many countries in future were estimated as 42.9 TWh yr−1 in China (sharing 0.87% of total electricity generation, 7.04 TWh yr−1 in Japan (0.64% of total electricity generation and 13.3 TWh yr−1 in the US (0.31% of total electricity generation. Electricity generation by treating food waste is promised to play an important role in renewable energy management. Comparing with wind and solar powers, converting food waste to bioenergy provides the lowest investment costs (500 US$ kW−1 and low operation cost (0.1 US$ kWh−1. With some limits in geography and season of other renewable powers, using food waste for electricity generation is supposedly to be a suitable solution for balancing energy demand in many countries.

  1. SOLAR WIND HEAVY IONS OVER SOLAR CYCLE 23: ACE/SWICS MEASUREMENTS

    International Nuclear Information System (INIS)

    Lepri, S. T.; Landi, E.; Zurbuchen, T. H.

    2013-01-01

    Solar wind plasma and compositional properties reflect the physical properties of the corona and its evolution over time. Studies comparing the previous solar minimum with the most recent, unusual solar minimum indicate that significant environmental changes are occurring globally on the Sun. For example, the magnetic field decreased 30% between the last two solar minima, and the ionic charge states of O have been reported to change toward lower values in the fast wind. In this work, we systematically and comprehensively analyze the compositional changes of the solar wind during cycle 23 from 2000 to 2010 while the Sun moved from solar maximum to solar minimum. We find a systematic change of C, O, Si, and Fe ionic charge states toward lower ionization distributions. We also discuss long-term changes in elemental abundances and show that there is a ∼50% decrease of heavy ion abundances (He, C, O, Si, and Fe) relative to H as the Sun went from solar maximum to solar minimum. During this time, the relative abundances in the slow wind remain organized by their first ionization potential. We discuss these results and their implications for models of the evolution of the solar atmosphere, and for the identification of the fast and slow wind themselves.

  2. Statistical study of waves distribution in the inner magnetosphere using geomagnetic indices and solar wind parameters

    Science.gov (United States)

    Aryan, H.; Yearby, K.; Balikhin, M. A.; Krasnoselskikh, V.; Agapitov, O. V.

    2013-12-01

    The interaction of gyroresonant wave particles with chorus waves largely determine the dynamics of the Earth's radiation belts that effects the acceleration and loss of radiation belt electrons. The common approach is to present model waves distribution in the inner magnetosphere under different values of geomagnetic activity as expressed by the geomagnetic indices. However it is known that solar wind parameters such as bulk velocity (V) and density (n) are more effective in the control of high energy fluxes at the geostationary orbit. Therefore in the present study the set of parameters of the wave distribution is expanded to include the solar wind parameters in addition to the geomagnetic indices. The present study examines almost four years (01, January, 2004 to 29, September, 2007) of Cluster STAFF-SA, Double Star TC1 and OMNI data in order to present a combined model of wave magnetic field intensities for the chorus waves as a function of magnetic local time (MLT), L-shell (L*), geomagnetic activity, and solar wind velocity and density. Generally, the largest wave intensities are observed during average solar wind velocities (3006cm-3. On the other hand the wave intensity is lower and limited between 06:00 to 18:00 MLT for V700kms-1.

  3. The Solar Wind Environment in Time

    Science.gov (United States)

    Pognan, Quentin; Garraffo, Cecilia; Cohen, Ofer; Drake, Jeremy J.

    2018-03-01

    We use magnetograms of eight solar analogs of ages 30 Myr–3.6 Gyr obtained from Zeeman Doppler Imaging and taken from the literature, together with two solar magnetograms, to drive magnetohydrodynamical wind simulations and construct an evolutionary scenario of the solar wind environment and its angular momentum loss rate. With observed magnetograms of the radial field strength as the only variant in the wind model, we find that a power-law model fitted to the derived angular momentum loss rate against time, t, results in a spin-down relation Ω ∝ t ‑0.51, for angular speed Ω, which is remarkably consistent with the well-established Skumanich law Ω ∝ t ‑0.5. We use the model wind conditions to estimate the magnetospheric standoff distances for an Earth-like test planet situated at 1 au for each of the stellar cases, and to obtain trends of minimum and maximum wind ram pressure and average ram pressure in the solar system through time. The wind ram pressure declines with time as \\overline{{P}ram}}\\propto {t}2/3, amounting to a factor of 50 or so over the present lifetime of the solar system.

  4. Solar-wind predictions for the Parker Solar Probe orbit. Near-Sun extrapolations derived from an empirical solar-wind model based on Helios and OMNI observations

    Science.gov (United States)

    Venzmer, M. S.; Bothmer, V.

    2018-03-01

    Context. The Parker Solar Probe (PSP; formerly Solar Probe Plus) mission will be humanitys first in situ exploration of the solar corona with closest perihelia at 9.86 solar radii (R⊙) distance to the Sun. It will help answer hitherto unresolved questions on the heating of the solar corona and the source and acceleration of the solar wind and solar energetic particles. The scope of this study is to model the solar-wind environment for PSPs unprecedented distances in its prime mission phase during the years 2018 to 2025. The study is performed within the Coronagraphic German And US SolarProbePlus Survey (CGAUSS) which is the German contribution to the PSP mission as part of the Wide-field Imager for Solar PRobe. Aim. We present an empirical solar-wind model for the inner heliosphere which is derived from OMNI and Helios data. The German-US space probes Helios 1 and Helios 2 flew in the 1970s and observed solar wind in the ecliptic within heliocentric distances of 0.29 au to 0.98 au. The OMNI database consists of multi-spacecraft intercalibrated in situ data obtained near 1 au over more than five solar cycles. The international sunspot number (SSN) and its predictions are used to derive dependencies of the major solar-wind parameters on solar activity and to forecast their properties for the PSP mission. Methods: The frequency distributions for the solar-wind key parameters, magnetic field strength, proton velocity, density, and temperature, are represented by lognormal functions. In addition, we consider the velocity distributions bi-componental shape, consisting of a slower and a faster part. Functional relations to solar activity are compiled with use of the OMNI data by correlating and fitting the frequency distributions with the SSN. Further, based on the combined data set from both Helios probes, the parameters frequency distributions are fitted with respect to solar distance to obtain power law dependencies. Thus an empirical solar-wind model for the inner

  5. Numerical simulation of wind loads on solar panels

    Science.gov (United States)

    Su, Kao-Chun; Chung, Kung-Ming; Hsu, Shu-Tsung

    2018-05-01

    Solar panels mounted on the roof of a building or ground are often vulnerable to strong wind loads. This study aims to investigate wind loads on solar panels using computational fluid dynamic (CFD). The results show good agreement with wind tunnel data, e.g. the streamwise distribution of mean surface pressure coefficient of a solar panel. Wind uplift for solar panels with four aspect ratios is evaluated. The effect of inclined angle and clearance (or height) of a solar panel is addressed. It is found that wind uplift of a solar panel increases when there is an increase in inclined angle and the clearance above ground shows an opposite effect.

  6. Wind and solar resource data sets

    DEFF Research Database (Denmark)

    Clifton, Andrew; Hodge, Bri-Mathias; Draxl, Caroline

    2017-01-01

    The range of resource data sets spans from static cartography showing the mean annual wind speed or solar irradiance across a region to high temporal and high spatial resolution products that provide detailed information at a potential wind or solar energy facility. These data sets are used...... to support continental-scale, national, or regional renewable energy development; facilitate prospecting by developers; and enable grid integration studies. This review first provides an introduction to the wind and solar resource data sets, then provides an overview of the common methods used...... for their creation and validation. A brief history of wind and solar resource data sets is then presented, followed by areas for future research. For further resources related to this article, please visit the WIREs website....

  7. Manifestation of solar activity in solar wind particle flux density

    International Nuclear Information System (INIS)

    Kovalenko, V.A.

    1988-01-01

    An analysis has been made of the origin of long-term variations in flux density of solar wind particles (nv) for different velocity regimes. The study revealed a relationship of these variations to the area of the polar coronal holes (CH). It is shown that within the framework of the model under development, the main longterm variations of nv are a result of the latitude redistribution of the solar wind mass flux in the heliosphere and are due to changes in the large-scale geometry of the solar plasma flow in the corona. A study has been made of the variations of nv for high speed solar wind streams. It is found that nv in high speed streams which are formed in CH, decreases from minimum to maximum solar activity. The analysis indicates that this decrease is attributable to the magnetic field strength increase in coronal holes. It has been found that periods of rapid global changes of background magnetic fields on the Sun are accompanied by a reconfiguration of coronal magnetic fields, rapid changes in the length of quiescent filaments, and by an increase in the density of the particle flux of a high speed solar wind. It has been established that these periods precede the formation of CH, corresponding to the increase in solar wind velocity near the Earth and to enhancement of the level of geomagnetic disturbance. (author)

  8. A survey of solar wind conditions at 5 AU: a tool for interpreting solar wind-magnetosphere interactions at Jupiter

    Energy Technology Data Exchange (ETDEWEB)

    Ebert, Robert W. [Space Science and Engineering Division, Southwest Research Institute, San Antonio, TX (United States); Bagenal, Fran [Laboratory for Atmospheric and Space Physics, University of Colorado, Boulder, CO (United States); McComas, David J. [Space Science and Engineering Division, Southwest Research Institute, San Antonio, TX (United States); Department of Physics and Astronomy, University of Texas at San Antonio, San Antonio, TX (United States); Fowler, Christopher M., E-mail: rebert@swri.edu [Laboratory for Atmospheric and Space Physics, University of Colorado, Boulder, CO (United States)

    2014-09-19

    We examine Ulysses solar wind and interplanetary magnetic field (IMF) observations at 5 AU for two ~13 month intervals during the rising and declining phases of solar cycle 23 and the predicted response of the Jovian magnetosphere during these times. The declining phase solar wind, composed primarily of corotating interaction regions and high-speed streams, was, on average, faster, hotter, less dense, and more Alfvénic relative to the rising phase solar wind, composed mainly of slow wind and interplanetary coronal mass ejections. Interestingly, none of solar wind and IMF distributions reported here were bimodal, a feature used to explain the bimodal distribution of bow shock and magnetopause standoff distances observed at Jupiter. Instead, many of these distributions had extended, non-Gaussian tails that resulted in large standard deviations and much larger mean over median values. The distribution of predicted Jupiter bow shock and magnetopause standoff distances during these intervals were also not bimodal, the mean/median values being larger during the declining phase by ~1–4%. These results provide data-derived solar wind and IMF boundary conditions at 5 AU for models aimed at studying solar wind-magnetosphere interactions at Jupiter and can support the science investigations of upcoming Jupiter system missions. Here, we provide expectations for Juno, which is scheduled to arrive at Jupiter in July 2016. Accounting for the long-term decline in solar wind dynamic pressure reported by McComas et al. (2013a), Jupiter's bow shock and magnetopause is expected to be at least 8–12% further from Jupiter, if these trends continue.

  9. Were chondrites magnetized by the early solar wind?

    Science.gov (United States)

    Oran, Rona; Weiss, Benjamin P.; Cohen, Ofer

    2018-06-01

    Chondritic meteorites have been traditionally thought to be samples of undifferentiated bodies that never experienced large-scale melting. This view has been challenged by the existence of post-accretional, unidirectional natural remanent magnetization (NRM) in CV carbonaceous chondrites. The relatively young inferred NRM age [∼10 million years (My) after solar system formation] and long duration of NRM acquisition (1-106 y) have been interpreted as evidence that the magnetizing field was that of a core dynamo within the CV parent body. This would imply that CV chondrites represent the primitive crust of a partially differentiated body. However, an alternative hypothesis is that the NRM was imparted by the early solar wind. Here we demonstrate that the solar wind scenario is unlikely due to three main factors: 1) the magnitude of the early solar wind magnetic field is estimated to be limits field amplification due to pile-up of the solar wind to less than a factor of 3.5 times that of the instantaneous solar wind field, and 3) the solar wind field likely changed over timescales orders of magnitude shorter than the timescale of NRM acquisition. Using analytical arguments, numerical simulations and astronomical observations of the present-day solar wind and magnetic fields of young stars, we show that the maximum mean field the ancient solar wind could have imparted on an undifferentiated CV parent body is <3.5 nT, which is 3-4 and 3 orders of magnitude weaker than the paleointensities recorded by the CV chondrites Allende and Kaba, respectively. Therefore, the solar wind is highly unlikely to be the source of the NRM in CV chondrites. Nevertheless, future high sensitivity paleomagnetic studies of rapidly-cooled meteorites with high magnetic recording fidelity could potentially trace the evolution of the solar wind field in time.

  10. Solar wind electron densities from Viking dual-frequency radio measurements

    International Nuclear Information System (INIS)

    Muhleman, D.O.; Anderson, J.D.

    1981-01-01

    Simultaneous phase coherent, two-frequency measurements of the time delay between the Earth station and the Viking spacecraft have been analyzed in terms of the electron density profiles from 4 solar radii (R/sub sun/) to 200 R/sub sun/. The measurements were made during a period of solar activity minimum (1976--1977) and show a strong solar latitude effect. The data were analyzed with both a model independent, direct numerical inversion technique and with model fitting, yielding essentially the same results. It is shown that the solar wind density can be represented by two power laws near the solar equator proportional to r/sup -2.7/ and r/sup -2.04/. However, the more rapidly falling term quickly disappears at moderate latitudes (approx.20 0 ), leaving only the inverse-square behavior

  11. Turbulent Transport in a Three-dimensional Solar Wind

    Energy Technology Data Exchange (ETDEWEB)

    Shiota, D. [Institute for Space-Earth Environmental Research, Nagoya University, Nagoya, Aichi 464-8601 (Japan); Zank, G. P.; Adhikari, L.; Hunana, P. [Center for Space Plasma and Aeronomic Research (CSPAR), Department of Space Science, University of Alabama in Huntsville, Huntsville, AL 35805 (United States); Telloni, D. [INAF—Astrophysical Observatory of Torino, Via Osservatorio 20, I-10025 Pino Torinese (Italy); Bruno, R., E-mail: shiota@isee.nagoya-u.ac.jp [INAF-IAPS Istituto di Astrofisica e Planetologia Spaziali, Via del Fosso del Cavaliere 100, I-00133 Roma (Italy)

    2017-03-01

    Turbulence in the solar wind can play essential roles in the heating of coronal and solar wind plasma and the acceleration of the solar wind and energetic particles. Turbulence sources are not well understood and thought to be partly enhanced by interaction with the large-scale inhomogeneity of the solar wind and the interplanetary magnetic field and/or transported from the solar corona. To investigate the interaction with background inhomogeneity and the turbulence sources, we have developed a new 3D MHD model that includes the transport and dissipation of turbulence using the theoretical model of Zank et al. We solve for the temporal and spatial evolution of three moments or variables, the energy in the forward and backward fluctuating modes and the residual energy and their three corresponding correlation lengths. The transport model is coupled to our 3D model of the inhomogeneous solar wind. We present results of the coupled solar wind-turbulence model assuming a simple tilted dipole magnetic configuration that mimics solar minimum conditions, together with several comparative intermediate cases. By considering eight possible solar wind and turbulence source configurations, we show that the large-scale solar wind and IMF inhomogeneity and the strength of the turbulence sources significantly affect the distribution of turbulence in the heliosphere within 6 au. We compare the predicted turbulence distribution results from a complete solar minimum model with in situ measurements made by the Helios and Ulysses spacecraft, finding that the synthetic profiles of the turbulence intensities show reasonable agreement with observations.

  12. On the Origins of the Intercorrelations Between Solar Wind Variables

    Science.gov (United States)

    Borovsky, Joseph E.

    2018-01-01

    It is well known that the time variations of the diverse solar wind variables at 1 AU (e.g., solar wind speed, density, proton temperature, electron temperature, magnetic field strength, specific entropy, heavy-ion charge-state densities, and electron strahl intensity) are highly intercorrelated with each other. In correlation studies of the driving of the Earth's magnetosphere-ionosphere-thermosphere system by the solar wind, these solar wind intercorrelations make determining cause and effect very difficult. In this report analyses of solar wind spacecraft measurements and compressible-fluid computer simulations are used to study the origins of the solar wind intercorrelations. Two causes are found: (1) synchronized changes in the values of the solar wind variables as the plasma types of the solar wind are switched by solar rotation and (2) dynamic interactions (compressions and rarefactions) in the solar wind between the Sun and the Earth. These findings provide an incremental increase in the understanding of how the Sun-Earth system operates.

  13. A survey of solar wind conditions at 5 AU: A tool for interpreting solar wind-magnetosphere interactions at Jupiter

    Directory of Open Access Journals (Sweden)

    Robert Wilkes Ebert

    2014-09-01

    Full Text Available We examine Ulysses solar wind and interplanetary magnetic field (IMF observations at 5 AU for two ~13 month intervals during the rising and declining phases of solar cycle 23 and the predicted response of the Jovian magnetosphere during these times. The declining phase solar wind, composed primarily of corotating interaction regions and high-speed streams, was, on average, faster, hotter, less dense, and more Alfvénic relative to the rising phase solar wind, composed mainly of slow wind and interplanetary coronal mass ejections. Interestingly, none of solar wind and IMF distributions reported here were bimodal, a feature used to explain the bimodal distribution of bow shock and magnetopause standoff distances observed at Jupiter. Instead, many of these distributions had extended, non-Gaussian tails that resulted in large standard deviations and much larger mean over median values. The distribution of predicted Jupiter bow shock and magnetopause standoff distances during these intervals were also not bimodal, the mean/median values being larger during the declining phase by ~1 – 4%. These results provide data-derived solar wind and IMF boundary conditions at 5 AU for models aimed at studying solar wind-magnetosphere interactions at Jupiter and can support the science investigations of upcoming Jupiter system missions. Here, we provide expectations for Juno, which is scheduled to arrive at Jupiter in July 2016. Accounting for the long-term decline in solar wind dynamic pressure reported by McComas et al. (2013, Jupiter’s bow shock and magnetopause is expected to be at least 8 – 12% further from Jupiter, if these trends continue.

  14. Western Wind and Solar Integration Study Phase 3 – Frequency Response and Transient Stability

    Energy Technology Data Exchange (ETDEWEB)

    Miller, N. W. [GE Energy Management, Schenectady, NY (United States); Shao, M. [GE Energy Management, Schenectady, NY (United States); Pajic, S. [GE Energy Management, Schenectady, NY (United States); D' Aquila, R. [GE Energy Management, Schenectady, NY (United States)

    2014-12-01

    Power system operators and utilities worldwide have concerns about the impact of high-penetration wind and solar generation on electric grid reliability (EirGrid 2011b, Hydro-Quebec 2006, ERCOT 2010). The stability of North American grids under these conditions is a particular concern and possible impediment to reaching future renewable energy goals. Phase 3 of the Western Wind and Solar Integration Study (WWSIS-3) considers a 33% wind and solar annual energy penetration level that results in substantial changes to the characteristics of the bulk power system, including different power flow patterns, different commitment and dispatch of existing synchronous generation, and different dynamic behavior of wind and solar generation. WWSIS-3 evaluates two specific aspects of fundamental frequency system stability: frequency response and transient stability.

  15. Simulation study of solar wind push on a charged wire: basis of solar wind electric sail propulsion

    Directory of Open Access Journals (Sweden)

    P. Janhunen

    2007-03-01

    Full Text Available One possibility for propellantless propulsion in space is to use the momentum flux of the solar wind. A way to set up a solar wind sail is to have a set of thin long wires which are kept at high positive potential by an onboard electron gun so that the wires repel and deflect incident solar wind protons. The efficiency of this so-called electric sail depends on how large force a given solar wind exerts on a wire segment and how large electron current the wire segment draws from the solar wind plasma when kept at a given potential. We use 1-D and 2-D electrostatic plasma simulations to calculate the force and present a semitheoretical formula which captures the simulation results. We find that under average solar wind conditions at 1 AU the force per unit length is (5±1×10−8 N/m for 15 kV potential and that the electron current is accurately given by the well-known orbital motion limited (OML theory cylindrical Langmuir probe formula. Although the force may appear small, an analysis shows that because of the very low weight of a thin wire per unit length, quite high final speeds (over 50 km/s could be achieved by an electric sailing spacecraft using today's flight-proved components. It is possible that artificial electron heating of the plasma in the interaction region could increase the propulsive effect even further.

  16. Study on Pyroelectric Harvesters Integrating Solar Radiation with Wind Power

    Directory of Open Access Journals (Sweden)

    Chun-Ching Hsiao

    2015-07-01

    Full Text Available Pyroelectric harvesters use temperature fluctuations to generate electrical outputs. Solar radiation and waste heat are rich energy sources that can be harvested. Pyroelectric energy converters offer a novel and direct energy-conversion technology by transforming time-dependent temperatures directly into electricity. Moreover, the great challenge for pyroelectric energy harvesting lies in finding promising temperature variations or an alternating thermal loading in real situations. Hence, in this article, a novel pyroelectric harvester integrating solar radiation with wind power by the pyroelectric effect is proposed. Solar radiation is a thermal source, and wind is a dynamic potential. A disk generator is used for harvesting wind power. A mechanism is considered to convert the rotary energy of the disk generator to drive a shutter for generating temperature variations in pyroelectric cells using a planetary gear system. The optimal period of the pyroelectric cells is 35 s to harvest the stored energy, about 70 μJ, while the rotary velocity of the disk generator is about 31 RPM and the wind speed is about 1 m/s. In this state, the stored energy acquired from the pyroelectric harvester is about 75% more than that from the disk generator. Although the generated energy of the proposed pyroelectric harvester is less than that of the disk generator, the pyroelectric harvester plays a complementary role when the disk generator is inactive in situations of low wind speed.

  17. Statistical analysis of dispersion relations in turbulent solar wind fluctuations using Cluster data

    Science.gov (United States)

    Perschke, C.; Narita, Y.

    2012-12-01

    Multi-spacecraft measurements enable us to resolve three-dimensional spatial structures without assuming Taylor's frozen-in-flow hypothesis. This is very useful to study frequency-wave vector diagram in solar wind turbulence through direct determination of three-dimensional wave vectors. The existence and evolution of dispersion relation and its role in fully-developed plasma turbulence have been drawing attention of physicists, in particular, if solar wind turbulence represents kinetic Alfvén or whistler mode as the carrier of spectral energy among different scales through wave-wave interactions. We investigate solar wind intervals of Cluster data for various flow velocities with a high-resolution wave vector analysis method, Multi-point Signal Resonator technique, at the tetrahedral separation about 100 km. Magnetic field data and ion data are used to determine the frequency- wave vector diagrams in the co-moving frame of the solar wind. We find primarily perpendicular wave vectors in solar wind turbulence which justify the earlier discussions about kinetic Alfvén or whistler wave. The frequency- wave vector diagrams confirm (a) wave vector anisotropy and (b) scattering in frequencies.

  18. Transport of transient solar wind particles in Earth's cusps

    International Nuclear Information System (INIS)

    Parks, G. K.; Lee, E.; Teste, A.; Wilber, M.; Lin, N.; Canu, P.; Dandouras, I.; Reme, H.; Fu, S. Y.; Goldstein, M. L.

    2008-01-01

    An important problem in space physics still not understood well is how the solar wind enters the Earth's magnetosphere. Evidence is presented that transient solar wind particles produced by solar disturbances can appear in the Earth's mid-altitude (∼5 R E geocentric) cusps with densities nearly equal to those in the magnetosheath. That these are magnetosheath particles is established by showing they have the same ''flattop'' electron distributions as magnetosheath electrons behind the bow shock. The transient ions are moving parallel to the magnetic field (B) toward Earth and often coexist with ionospheric particles that are flowing out. The accompanying waves include electromagnetic and broadband electrostatic noise emissions and Bernstein mode waves. Phase-space distributions show a mixture of hot and cold electrons and multiple ion species including field-aligned ionospheric O + beams

  19. Distribution and solar wind control of compressional solar wind-magnetic anomaly interactions observed at the Moon by ARTEMIS

    Science.gov (United States)

    Halekas, J. S.; Poppe, A. R.; Lue, C.; Farrell, W. M.; McFadden, J. P.

    2017-06-01

    A statistical investigation of 5 years of observations from the two-probe Acceleration, Reconnection, Turbulence, and Electrodynamics of Moon's Interaction with the Sun (ARTEMIS) mission reveals that strong compressional interactions occur infrequently at high altitudes near the ecliptic but can form in a wide range of solar wind conditions and can occur up to two lunar radii downstream from the lunar limb. The compressional events, some of which may represent small-scale collisionless shocks ("limb shocks"), occur in both steady and variable interplanetary magnetic field (IMF) conditions, with those forming in steady IMF well organized by the location of lunar remanent crustal magnetization. The events observed by ARTEMIS have similarities to ion foreshock phenomena, and those observed in variable IMF conditions may result from either local lunar interactions or distant terrestrial foreshock interactions. Observed velocity deflections associated with compressional events are always outward from the lunar wake, regardless of location and solar wind conditions. However, events for which the observed velocity deflection is parallel to the upstream motional electric field form in distinctly different solar wind conditions and locations than events with antiparallel deflections. Consideration of the momentum transfer between incoming and reflected solar wind populations helps explain the observed characteristics of the different groups of events.Plain Language SummaryWe survey the environment around the Moon to determine when and where strong amplifications in the charged particle density and magnetic field strength occur. These structures may be some of the smallest shock waves in the solar system, and learning about their formation informs us about the interaction of charged particles with small-scale magnetic fields throughout the solar system and beyond. We find that these compressions occur in an extended region downstream from the lunar dawn and dusk regions and

  20. Two-Step Forecast of Geomagnetic Storm Using Coronal Mass Ejection and Solar Wind Condition

    Science.gov (United States)

    Kim, R.-S.; Moon, Y.-J.; Gopalswamy, N.; Park, Y.-D.; Kim, Y.-H.

    2014-01-01

    To forecast geomagnetic storms, we had examined initially observed parameters of coronal mass ejections (CMEs) and introduced an empirical storm forecast model in a previous study. Now we suggest a two-step forecast considering not only CME parameters observed in the solar vicinity but also solar wind conditions near Earth to improve the forecast capability. We consider the empirical solar wind criteria derived in this study (Bz = -5 nT or Ey = 3 mV/m for t = 2 h for moderate storms with minimum Dst less than -50 nT) (i.e. Magnetic Field Magnitude, B (sub z) less than or equal to -5 nanoTeslas or duskward Electrical Field, E (sub y) greater than or equal to 3 millivolts per meter for time greater than or equal to 2 hours for moderate storms with Minimum Disturbance Storm Time, Dst less than -50 nanoTeslas) and a Dst model developed by Temerin and Li (2002, 2006) (TL [i.e. Temerin Li] model). Using 55 CME-Dst pairs during 1997 to 2003, our solar wind criteria produce slightly better forecasts for 31 storm events (90 percent) than the forecasts based on the TL model (87 percent). However, the latter produces better forecasts for 24 nonstorm events (88 percent), while the former correctly forecasts only 71 percent of them. We then performed the two-step forecast. The results are as follows: (i) for 15 events that are incorrectly forecasted using CME parameters, 12 cases (80 percent) can be properly predicted based on solar wind conditions; (ii) if we forecast a storm when both CME and solar wind conditions are satisfied (n, i.e. cap operator - the intersection set that is comprised of all the elements that are common to both), the critical success index becomes higher than that from the forecast using CME parameters alone, however, only 25 storm events (81 percent) are correctly forecasted; and (iii) if we forecast a storm when either set of these conditions is satisfied (?, i.e. cup operator - the union set that is comprised of all the elements of either or both

  1. Role of the Coronal Alfvén Speed in Modulating the Solar-wind Helium Abundance

    Science.gov (United States)

    Wang, Y.-M.

    2016-12-01

    The helium abundance He/H in the solar wind is relatively constant at ˜0.04 in high-speed streams, but varies in phase with the sunspot number in slow wind, from ˜0.01 at solar minimum to ˜0.04 at maximum. Suggested mechanisms for helium fractionation have included frictional coupling to protons and resonant interactions with high-frequency Alfvénic fluctuations. We compare He/H measurements during 1995-2015 with coronal parameters derived from source-surface extrapolations of photospheric field maps. We find that the near-Earth helium abundance is an increasing function of the magnetic field strength and Alfvén speed v A in the outer corona, while being only weakly correlated with the proton flux density. Throughout the solar cycle, fast wind is associated with short-term increases in v A near the source surface; resonance with Alfvén waves, with v A and the relative speed of α-particles and protons decreasing with increasing heliocentric distance, may then lead to enhanced He/H at 1 au. The modulation of helium in slow wind reflects the tendency for the associated coronal Alfvén speeds to rise steeply from sunspot minimum, when this wind is concentrated around the source-surface neutral line, to sunspot maximum, when the source-surface field attains its peak strengths. The helium abundance near the source surface may represent a balance between collisional decoupling from protons and Alfvén wave acceleration.

  2. ROLE OF THE CORONAL ALFVÉN SPEED IN MODULATING THE SOLAR-WIND HELIUM ABUNDANCE

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Y.-M., E-mail: yi.wang@nrl.navy.mil [Space Science Division, Naval Research Laboratory, Washington, DC 20375 (United States)

    2016-12-20

    The helium abundance He/H in the solar wind is relatively constant at ∼0.04 in high-speed streams, but varies in phase with the sunspot number in slow wind, from ∼0.01 at solar minimum to ∼0.04 at maximum. Suggested mechanisms for helium fractionation have included frictional coupling to protons and resonant interactions with high-frequency Alfvénic fluctuations. We compare He/H measurements during 1995–2015 with coronal parameters derived from source-surface extrapolations of photospheric field maps. We find that the near-Earth helium abundance is an increasing function of the magnetic field strength and Alfvén speed v {sub A} in the outer corona, while being only weakly correlated with the proton flux density. Throughout the solar cycle, fast wind is associated with short-term increases in v {sub A} near the source surface; resonance with Alfvén waves, with v {sub A} and the relative speed of α -particles and protons decreasing with increasing heliocentric distance, may then lead to enhanced He/H at 1 au. The modulation of helium in slow wind reflects the tendency for the associated coronal Alfvén speeds to rise steeply from sunspot minimum, when this wind is concentrated around the source-surface neutral line, to sunspot maximum, when the source-surface field attains its peak strengths. The helium abundance near the source surface may represent a balance between collisional decoupling from protons and Alfvén wave acceleration.

  3. Limitation of solar energy and wind energy

    International Nuclear Information System (INIS)

    White, R. S.

    2008-01-01

    Wind turbines, solar energy collectors and photovoltaic cells have been popular sources of electricity since the oil crisis in the late seventies, and they are increasingly favored by many scientists and much of the public as methods for reducing global warming. The older wind farms in California are outdated. New wind turbines have not followed, primarily because of competition from lower-cost natural gas. The Times urges increased federal and state subsidies for the wind and solar industries. The primary reason that wind and solar energies have not made inroads in the past, and will never supply more than a few percentage points of the world's electrical energy, is their unpredictable variations in time and their constant need for back-ups. The only non-carbon-dioxide-emitting generator capable of backing up wind and solar energy and replacing coal and gas generators is nuclear fission. Nuclear power may be the practical solution to global warming, after all.

  4. Solar energy system with wind vane

    Science.gov (United States)

    Grip, Robert E

    2015-11-03

    A solar energy system including a pedestal defining a longitudinal axis, a frame that is supported by the pedestal and that is rotateable relative to the pedestal about the longitudinal axis, the frame including at least one solar device, and a wind vane operatively connected to the frame to urge the frame relative to the pedestal about the longitudinal axis in response to wind acting on the wind vane.

  5. Simulation study of solar wind push on a charged wire: basis of solar wind electric sail propulsion

    Directory of Open Access Journals (Sweden)

    P. Janhunen

    2007-03-01

    Full Text Available One possibility for propellantless propulsion in space is to use the momentum flux of the solar wind. A way to set up a solar wind sail is to have a set of thin long wires which are kept at high positive potential by an onboard electron gun so that the wires repel and deflect incident solar wind protons. The efficiency of this so-called electric sail depends on how large force a given solar wind exerts on a wire segment and how large electron current the wire segment draws from the solar wind plasma when kept at a given potential. We use 1-D and 2-D electrostatic plasma simulations to calculate the force and present a semitheoretical formula which captures the simulation results. We find that under average solar wind conditions at 1 AU the force per unit length is (5±1×10−8 N/m for 15 kV potential and that the electron current is accurately given by the well-known orbital motion limited (OML theory cylindrical Langmuir probe formula. Although the force may appear small, an analysis shows that because of the very low weight of a thin wire per unit length, quite high final speeds (over 50 km/s could be achieved by an electric sailing spacecraft using today's flight-proved components. It is possible that artificial electron heating of the plasma in the interaction region could increase the propulsive effect even further.

  6. Solar Illumination Control of the Polar Wind

    Science.gov (United States)

    Maes, L.; Maggiolo, R.; De Keyser, J.; André, M.; Eriksson, A. I.; Haaland, S.; Li, K.; Poedts, S.

    2017-11-01

    Polar wind outflow is an important process through which the ionosphere supplies plasma to the magnetosphere. The main source of energy driving the polar wind is solar illumination of the ionosphere. As a result, many studies have found a relation between polar wind flux densities and solar EUV intensity, but less is known about their relation to the solar zenith angle at the ionospheric origin, certainly at higher altitudes. The low energy of the outflowing particles and spacecraft charging means it is very difficult to measure the polar wind at high altitudes. We take advantage of an alternative method that allows estimations of the polar wind flux densities far in the lobes. We analyze measurements made by the Cluster spacecraft at altitudes from 4 up to 20 RE. We observe a strong dependence on the solar zenith angle in the ion flux density and see that both the ion velocity and density exhibit a solar zenith angle dependence as well. We also find a seasonal variation of the flux density.

  7. THE NEW HORIZONS SOLAR WIND AROUND PLUTO (SWAP) OBSERVATIONS OF THE SOLAR WIND FROM 11–33 au

    Energy Technology Data Exchange (ETDEWEB)

    Elliott, H. A.; McComas, D. J.; Valek, P.; Weidner, S.; Livadiotis, G. [Southwest Research Institute, 6220 Culebra Road, San Antonio, TX 78238 (United States); Nicolaou, G., E-mail: helliott@swri.edu [Swedish Institute of Space Physics, Box 812, SE-98128, Kiruna (Sweden)

    2016-04-15

    The Solar Wind Around Pluto (SWAP) instrument on National Aeronautics and Space Administration's New Horizons Pluto mission has collected solar wind observations en route from Earth to Pluto, and these observations continue beyond Pluto. Few missions have explored the solar wind in the outer heliosphere making this dataset a critical addition to the field. We created a forward model of SWAP count rates, which includes a comprehensive instrument response function based on laboratory and flight calibrations. By fitting the count rates with this model, the proton density (n), speed (V), and temperature (T) parameters are determined. Comparisons between SWAP parameters and both propagated 1 au observations and prior Voyager 2 observations indicate consistency in both the range and mean wind values. These comparisons as well as our additional findings confirm that small and midsized solar wind structures are worn down with increasing distance due to dynamic interaction of parcels of wind with different speed. For instance, the T–V relationship steepens, as the range in V is limited more than the range in T with distance. At times the T–V correlation clearly breaks down beyond 20 au, which may indicate wind currently expanding and cooling may have an elevated T reflecting prior heating and compression in the inner heliosphere. The power of wind parameters at shorter periodicities decreases with distance as the longer periodicities strengthen. The solar rotation periodicity is present in temperature beyond 20 au indicating the observed parcel temperature may reflect not only current heating or cooling, but also heating occurring closer to the Sun.

  8. THE NEW HORIZONS SOLAR WIND AROUND PLUTO (SWAP) OBSERVATIONS OF THE SOLAR WIND FROM 11–33 au

    International Nuclear Information System (INIS)

    Elliott, H. A.; McComas, D. J.; Valek, P.; Weidner, S.; Livadiotis, G.; Nicolaou, G.

    2016-01-01

    The Solar Wind Around Pluto (SWAP) instrument on National Aeronautics and Space Administration's New Horizons Pluto mission has collected solar wind observations en route from Earth to Pluto, and these observations continue beyond Pluto. Few missions have explored the solar wind in the outer heliosphere making this dataset a critical addition to the field. We created a forward model of SWAP count rates, which includes a comprehensive instrument response function based on laboratory and flight calibrations. By fitting the count rates with this model, the proton density (n), speed (V), and temperature (T) parameters are determined. Comparisons between SWAP parameters and both propagated 1 au observations and prior Voyager 2 observations indicate consistency in both the range and mean wind values. These comparisons as well as our additional findings confirm that small and midsized solar wind structures are worn down with increasing distance due to dynamic interaction of parcels of wind with different speed. For instance, the T–V relationship steepens, as the range in V is limited more than the range in T with distance. At times the T–V correlation clearly breaks down beyond 20 au, which may indicate wind currently expanding and cooling may have an elevated T reflecting prior heating and compression in the inner heliosphere. The power of wind parameters at shorter periodicities decreases with distance as the longer periodicities strengthen. The solar rotation periodicity is present in temperature beyond 20 au indicating the observed parcel temperature may reflect not only current heating or cooling, but also heating occurring closer to the Sun

  9. WIND observations of coherent electrostatic waves in the solar wind

    Directory of Open Access Journals (Sweden)

    A. Mangeney

    1999-03-01

    Full Text Available The time domain sampler (TDS experiment on WIND measures electric and magnetic wave forms with a sampling rate which reaches 120 000 points per second. We analyse here observations made in the solar wind near the Lagrange point L1. In the range of frequencies above the proton plasma frequency fpi and smaller than or of the order of the electron plasma frequency fpe, TDS observed three kinds of electrostatic (e.s. waves: coherent wave packets of Langmuir waves with frequencies f ~ fpe, coherent wave packets with frequencies in the ion acoustic range fpi < f < fpe, and more or less isolated non-sinusoidal spikes lasting less than 1 ms. We confirm that the observed frequency of the low frequency (LF ion acoustic wave packets is dominated by the Doppler effect: the wavelengths are short, 10 to 50 electron Debye lengths λD. The electric field in the isolated electrostatic structures (IES and in the LF wave packets is more or less aligned with the solar wind magnetic field. Across the IES, which have a spatial width of the order of ~ 25λD, there is a small but finite electric potential drop, implying an average electric field generally directed away from the Sun. The IES wave forms, which have not been previously reported in the solar wind, are similar, although with a smaller amplitude, to the weak double layers observed in the auroral regions, and to the electrostatic solitary waves observed in other regions in the magnetosphere. We have also studied the solar wind conditions which favour the occurrence of the three kinds of waves: all these e.s. waves are observed more or less continuously in the whole solar wind (except in the densest regions where a parasite prevents the TDS observations. The type (wave packet or IES of the observed LF waves is mainly determined by the proton temperature and by the direction of the magnetic field, which themselves depend on the latitude of WIND with respect to the heliospheric current sheet.Key words

  10. Solar-wind minor ions: recent observations

    International Nuclear Information System (INIS)

    Bame, S.J.

    1982-01-01

    During the years following the Solar Wind Four Conference at Burghausen our knowledge of the solar wind ion composition and dynamics has grown. There have been some surprises, and our understanding of the evolution of the solar wind has been improved. Systematic studies have shown that the minor ions generally travel with a common bulk speed and have temperatures roughly proportional to their masses. It has been determined that the 3 He ++ content varies greatly; 3 He ++ / 4 He ++ ranges from as high as 10 2 values to below 2 x 10 - 4 . In some solar wind flows which can be related to energetic coronal events, the minor ions are found in unusual ionization states containing Fe 16 + as a prominent ion, showing that the states were formed at unusually high temperatures. Unexpectedly, in a few flows substantial quantities of 4 He + have been detected, sometimes with ions identifiable as O 2 + and O 3 + . Surprisingly, in some of these examples the ionization state is mixed showing that part of the plasma escaped the corona without attaining the usual million-degree temperatures while other parts were heated more nearly in the normal manner. Additionally, detailed studies of the minor ions have increased our understanding of the coronal expansion. For example, such studies have contributed to identifying near equatorial coronal streamers as the source of solar wind flows between high speed streams

  11. Solar wind ion trends and signatures: STEREO PLASTIC observations approaching solar minimum

    Directory of Open Access Journals (Sweden)

    A. B. Galvin

    2009-10-01

    Full Text Available STEREO has now completed the first two years of its mission, moving from close proximity to Earth in 2006/2007 to more than 50 degrees longitudinal separation from Earth in 2009. During this time, several large-scale structures have been observed in situ. Given the prevailing solar minimum conditions, these structures have been predominantly coronal hole-associated solar wind, slow solar wind, their interfaces, and the occasional transient event. In this paper, we extend earlier solar wind composition studies into the current solar minimum using high-resolution (1-h sampling times for the charge state analysis. We examine 2-year trends for iron charge states and solar wind proton speeds, and present a case study of Carrington Rotation 2064 (December 2007 which includes minor ion (He, Fe, O kinetic and Fe composition parameters in comparison with proton and magnetic field signatures at large-scale structures observed during this interval.

  12. Solar wind parameters responsible for the plasma injection into the magnetospheric ring current region

    International Nuclear Information System (INIS)

    Bobrov, M.S.

    1977-01-01

    Solar wind effect on the magnetospheric ring-current region has been considered. The correlations with solar wind parameters of the magnitude qsub(o) proportional to the total energy of particles being injected into the magnetospheric ring-current region per one hour are studied statistically and by comparison of time variations. The data on 8 sporadic geomagnetic storms of various intensity, from moderate to very severe one, are used. It is found that qsub(o) correlates not only with the magnitude and the direction of the solar-wind magnetic field component normal to the ecliptic plane, Bsub(z), but also with the variability, sigmasub(B), of the total magnetic-field strength vector. The solar-wind flux velocity ν influences the average storm intensity but the time variations of ν during any individual storm do not correlate with those of qsub(o)

  13. Interpretation of observed relations between solar wind characteristics and effects at ionospheric altitudes

    International Nuclear Information System (INIS)

    Cowley, S.W.H.

    1983-01-01

    This chapter discusses recent developments and remaining questions concerning the behavior of high latitude ionospheric flows and how they depend on solar wind conditions via magnetospheric coupling to the latter. The magnitude and direction of the interplanetary magnetic field (IMF) is found to be the primary factor. The relationships which have been found between the strength of high-latitude flows and solar wind and IMF conditions, and the inferences which can be drawn therefrom concerning the solar wind-magnetosphere coupling processes which result in convection are examined. The east-west asymmetries in highlatitude flows which are found to be associated with the B /SUB y/ (dawn-dusk) component of the IMF are investigated. Related asymmetries are shown to occur in the magnetosphere at large, and the unity of these effects as arising from one straightforward cause is stressed. Recent work on the ''reversed'' sunward flows which occur at high latitudes in association with strong B /SUB z/ in the IMF is described

  14. Kinetic Physics of the Solar Corona and Solar Wind

    Directory of Open Access Journals (Sweden)

    Marsch Eckart

    2006-07-01

    Full Text Available Kinetic plasma physics of the solar corona and solar wind are reviewed with emphasis on the theoretical understanding of the in situ measurements of solar wind particles and waves, as well as on the remote-sensing observations of the solar corona made by means of ultraviolet spectroscopy and imaging. In order to explain coronal and interplanetary heating, the microphysics of the dissipation of various forms of mechanical, electric and magnetic energy at small scales (e.g., contained in plasma waves, turbulences or non-uniform flows must be addressed. We therefore scrutinise the basic assumptions underlying the classical transport theory and the related collisional heating rates, and also describe alternatives associated with wave-particle interactions. We elucidate the kinetic aspects of heating the solar corona and interplanetary plasma through Landau- and cyclotron-resonant damping of plasma waves, and analyse in detail wave absorption and micro instabilities. Important aspects (virtues and limitations of fluid models, either single- and multi-species or magnetohydrodynamic and multi-moment models, for coronal heating and solar wind acceleration are critically discussed. Also, kinetic model results which were recently obtained by numerically solving the Vlasov–Boltzmann equation in a coronal funnel and hole are presented. Promising areas and perspectives for future research are outlined finally.

  15. Elemental composition and ionization state of the solar atmosphere and solar wind

    International Nuclear Information System (INIS)

    Joselyn, J.A.C.

    1978-01-01

    Abundance measurements have always proved useful in generating and refining astrophysical theories. Some of the classical problems of astrophysics involve determining the relative abundances of elements in the atmosphere of a star from observations of its line spectrum, and then synthesizing the physical processes which would produce such abundances. Theories of the formation of the solar system are critically tested by their ability to explain observed abundances, and, elemental abundances can serve as tracers, helping to determine the origin and transport of ions. Since the solar wind originates at the sun, it can act as a diagnostic probe of solar conditions. In particular, measurements of the composition of the solar wind should be related to the solar composition. And, assuming ionization equilibrium, measurements of the relative abundances of the ionization states in the solar wind should infer coronal temperatures and temperature gradients. However, most spherically symmetric models of the solar wind are unable to explain the relationship between the composition estimated from solar observations and as measured at 1 AU; and, recent observations of significant flow speeds in the transition region raise doubts about the validity of the assumption of ionization equilibrium

  16. Solar-wind interactions with the Moon: role of oxygen ions

    International Nuclear Information System (INIS)

    Mukherjee, N.R.

    1979-01-01

    The solar-wind interacts directly with the lunar surface due to tenuous atmosphere and magnetic field. The interaction results in an almost complete absorption of the solar-wind corpuscles producing no upstream bowshock but a cavity downstream. The solar-wind oxygen ionic species induce and undergo a complex set of reactions with the elements of the lunar minerals and the solar-wind derived trapped gases. In this paper, the long-term concentration and the role of oxygen derived from the solar-wind is discussed. (Auth.)

  17. Ion acoustic waves in the solar wind

    International Nuclear Information System (INIS)

    Gurnett, D.A.; Frank, L.A.

    1978-01-01

    Plasma wave measurements on the Helios I and 2 spacecraft have revealed the occurrence of electric field turbulence in the solar wind at frequencies between the electron and ion plasma frequencies. Wavelength measurements with the Imp 6 spacecraft now provide strong evidence that these waves are short-wavelength ion acoustic waves which are Doppler-shifted upward in frequency by the motion of the solar wind. Comparison of the Helios results with measurements from the earth-orbiting Imp 6 and 8 spacecraft shows that the ion acoustic turbulence detected in interplanetary space has characteristics essentially identical to those of bursts of electrostatic turbulence generated by protons streaming into the solar wind from the earth's bow shock. In a few cases, enhanced ion acoustic wave intensities have been observed in direct association with abrupt increases in the anisotropy of the solar wind electron distribution. This relationship strongly suggests that the ion acoustic waves detected by Helios far from the earth are produced by an electron heat flux instability, as was suggested by Forslund. Possible related mechanisms which could explain the generation of ion acoustic waves by protons streaming into the solar wind from the earth's bow shock are also considered

  18. Laboratory Facility for Simulating Solar Wind Sails

    International Nuclear Information System (INIS)

    Funaki, Ikkoh; Ueno, Kazuma; Oshio, Yuya; Ayabe, Tomohiro; Horisawa, Hideyuki; Yamakawa, Hiroshi

    2008-01-01

    Magnetic sail (MagSail) is a deep space propulsion system, in which an artificial magnetic cavity captures the energy of the solar wind to propel a spacecraft in the direction leaving the sun. For a scale-model experiment of the plasma flow of MagSail, we employed a magnetoplasmadynamic arcjet as a solar wind simulator. It is observed that a plasma flow from the solar wind simulator reaches a quasi-steady state of about 0.8 ms duration after a transient phase when initiating the discharge. During this initial phase of the discharge, a blast-wave was observed to develop radially in a vacuum chamber. When a solenoidal coil (MagSail scale model) is immersed into the quasi-steady flow where the velocity is 45 km/s, and the number density is 10 19 m-3, a bow shock as well as a magnetic cavity were formed in front of the coil. As a result of the interaction between the plasma flow and the magnetic cavity, the momentum of the simulated solar wind is decreased, and it is found from the thrust measurement that the solar wind momentum is transferred to the coil simulating MagSail.

  19. Solar wind temperature observations in the outer heliosphere

    Science.gov (United States)

    Gazis, P. R.; Barnes, A.; Mihalov, J. D.; Lazarus, A. J.

    1992-01-01

    The Pioneer 10, Pioneer 11, and Voyager 2 spacecraft are now at heliocentric distances of 50, 32 and 33 AU, and heliographic latitudes of 3.5 deg N, 17 deg N, and 0 deg N, respectively. Pioneer 11 and Voyager 2 are at similar celestial longitudes, while Pioneer l0 is on the opposite side of the sun. The baselines defined by these spacecraft make it possible to resolve radial, longitudinal, and latitudinal variations of solar wind parameters. The solar wind temperature decreases with increasing heliocentric distance out to a distance of 10-15 AU. At larger heliocentric distances, this gradient disappears. These high solar wind temperatures in the outer heliosphere have persisted for at least 10 years, which suggests that they are not a solar cycle effect. The solar wind temperature varied with heliographic latitude during the most recent solar minimum. The solar wind temperature at Pioneer 11 and Voyager 2 was higher than that seen at Pioneer 10 for an extended period of time, which suggests the existence of a large-scale variation of temperature with celestial longitude, but the contribution of transient phenomena is yet to be clarified.

  20. Effect of Alfvenic fluctuations on the solar wind

    International Nuclear Information System (INIS)

    Chien, T.H.

    1974-01-01

    The major source of microscale fluctuations in the interplanetary medium due to the outwardly propagating Alfven waves is considered. The effect of the Alfven waves on the supersonic expansion of the solar wind is studied under the assumption that the motion of the interplanetary medium can be resolved physically into a comparatively smooth and slowly varying mesoscale flow and field with very irregular disordered incompressible microscale Alfvenic fluctuations superposed on it. The important features of the solar wind such as heat conduction flux, spiral interplanetary magnetic field, and proton thermal anisotropy are included in the theory. For inviscid, steady state, spherically symmetrical model of the solar wind, the two-fluid formulation of the background mesoscale MHD equations is obtained. The results show that during the expansion process, fluctuation energy is converted into the kinetic energy of the solar wind. Due to the presence of the Alfvenic fluctuations, the velocity of the solar wind is about 5 percent higher than that without considering the fluctuations. (U.S.)

  1. The Western Wind and Solar Integration Study Phase 2

    Energy Technology Data Exchange (ETDEWEB)

    Lew, Debra [National Renewable Energy Lab. (NREL), Golden, CO (United States); Brinkman, Greg [National Renewable Energy Lab. (NREL), Golden, CO (United States); Ibanez, E. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Florita, A. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Heaney, M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Hodge, B. -M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Hummon, M. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Stark, G. [National Renewable Energy Lab. (NREL), Golden, CO (United States); King, J. [RePPAE; Lefton, S. A. [Intertek-APTECH, Houston, TX (United States); Kumar, N. [Intertek-APTECH, Houston, TX (United States); Agan, D. [Intertek-APTECH, Houston, TX (United States); Jordan, G. [GE Energy, Fairfield, CT (United States); Venkataraman, S. [GE Energy, Fairfield, CT (United States)

    2013-09-01

    The electric grid is a highly complex, interconnected machine, and changing one part of the grid can have consequences elsewhere. Adding wind and solar affects the operation of the other power plants and adding high penetrations can induce cycling of fossil-fueled generators. Cycling leads to wear-and-tear costs and changes in emissions. Phase 2 of the Western Wind and Solar Integration Study (WWSIS-2) evaluated these costs and emissions and simulated grid operations for a year to investigate the detailed impact of wind and solar on the fossil-fueled fleet. This built on Phase 1, one of the largest wind and solar integration studies ever conducted, which examined operational impacts of high wind and solar penetrations in the West(GE Energy 2010).

  2. The Western Wind and Solar Integration Study Phase 2

    Energy Technology Data Exchange (ETDEWEB)

    Lew, D.; Brinkman, G.; Ibanez, E.; Hodge, B. M.; Hummon, M.; Florita, A.; Heaney, M.

    2013-09-01

    The electric grid is a highly complex, interconnected machine, and changing one part of the grid can have consequences elsewhere. Adding wind and solar affects the operation of the other power plants and adding high penetrations can induce cycling of fossil-fueled generators. Cycling leads to wear-and-tear costs and changes in emissions. Phase 2 of the Western Wind and Solar Integration Study (WWSIS-2) evaluated these costs and emissions and simulated grid operations for a year to investigate the detailed impact of wind and solar on the fossil-fueled fleet. This built on Phase 1, one of the largest wind and solar integration studies ever conducted, which examined operational impacts of high wind and solar penetrations in the West.

  3. WIND observations of coherent electrostatic waves in the solar wind

    Directory of Open Access Journals (Sweden)

    A. Mangeney

    Full Text Available The time domain sampler (TDS experiment on WIND measures electric and magnetic wave forms with a sampling rate which reaches 120 000 points per second. We analyse here observations made in the solar wind near the Lagrange point L1. In the range of frequencies above the proton plasma frequency fpi and smaller than or of the order of the electron plasma frequency fpe, TDS observed three kinds of electrostatic (e.s. waves: coherent wave packets of Langmuir waves with frequencies f ~ fpe, coherent wave packets with frequencies in the ion acoustic range fpi < f < fpe, and more or less isolated non-sinusoidal spikes lasting less than 1 ms. We confirm that the observed frequency of the low frequency (LF ion acoustic wave packets is dominated by the Doppler effect: the wavelengths are short, 10 to 50 electron Debye lengths λD. The electric field in the isolated electrostatic structures (IES and in the LF wave packets is more or less aligned with the solar wind magnetic field. Across the IES, which have a spatial width of the order of ~ 25λD, there is a small but finite electric potential drop, implying an average electric field generally directed away from the Sun. The IES wave forms, which have not been previously reported in the solar wind, are similar, although with a smaller amplitude, to the weak double layers observed in the auroral regions, and to the electrostatic solitary waves observed in other regions in the magnetosphere. We have also studied the solar wind conditions which favour the occurrence of the three kinds of waves: all these e.s. waves are observed more or less continuously in the whole solar wind (except in the densest regions where a parasite prevents the TDS observations. The type (wave packet or IES of the observed LF waves is mainly determined

  4. The solar wind at solar maximum: comparisons of EISCAT IPS and in situ observations

    Directory of Open Access Journals (Sweden)

    A. R. Breen

    Full Text Available The solar maximum solar wind is highly structured in latitude, longitude and in time. Coronal measurements show a very high degree of variability, with large variations that are less apparent within in situ spacecraft measurements. Interplanetary scintillation (IPS observations from EISCAT, covering distances from 20 to 100 solar radii (RS, are an ideal source of information on the inner solar wind and can be used, therefore, to cast light on its evolution with distance from the Sun. Earlier comparisons of in situ and IPS measurements under solar minimum conditions showed good large-scale agreement, particularly in the fast wind. In this study we attempt a quantitative comparison of measurements made over solar maximum by EISCAT (20–100 RS and the Wind and Ulysses spacecraft (at 215 RS and 300–1000 RS, respectively. The intervals studied were August–September 1999, May 2000, September 2000 and May 2001, the last-named being the period of the second Ulysses fast latitude scan. Both ballistic and – when possible – MHD/ballistic hybrid models were used to relate the data sets, and we compare the results obtained from these two mapping methods. The results of this study suggest that solar wind velocities measured in situ were less variable than those estimated from IPS measurements closer to the Sun, with the greatest divergence between IPS velocities and in situ measurements occurring in regions where steep longitudinal velocity gradients were seen in situ. We suggest that the interaction between streams of solar wind with different velocities leads to "smoothing" of solar wind velocities between 30–60 RS and 1 AU, and that this process continues at greater distances from the Sun.

    Key words. Interplanetary physics (solar wind plasma; sources of the solar wind; instruments and techniques

  5. CONDITIONED ANALYSIS OF HIGH-LATITUDE SOLAR WIND INTERMITTENCY

    International Nuclear Information System (INIS)

    D'Amicis, R.; Consolini, G.; Bavassano, B.; Bruno, R.

    2012-01-01

    The solar wind is a turbulent medium displaying intermittency. Its intermittent features have been widely documented and studied, showing how the intermittent character is different in fast and slow wind. In this paper, a statistical conditioned analysis of the solar wind intermittency for a period of high-latitude fast solar wind is presented. In particular, the intermittent features are investigated as a function of the Alfvénic degree of fluctuations at a given scale. The results show that the main contribution to solar wind intermittency is due to non-Alfvénic structures, while Alfvénic increments are found to be characterized by a smaller level of intermittency than the previous ones. Furthermore, the lifetime statistics of Alfvénic periods are discussed in terms of a multiscale texture of randomly oriented flux tubes.

  6. Alfvénic fluctuations in "newborn"' polar solar wind

    Directory of Open Access Journals (Sweden)

    B. Bavassano

    2005-06-01

    Full Text Available The 3-D structure of the solar wind is strongly dependent upon the Sun's activity cycle. At low solar activity a bimodal structure is dominant, with a fast and uniform flow at the high latitudes, and slow and variable flows at low latitudes. Around solar maximum, in sharp contrast, variable flows are observed at all latitudes. This last kind of pattern, however, is a relatively short-lived feature, and quite soon after solar maximum the polar wind tends to regain its role. The plasma parameter distributions for these newborn polar flows appear very similar to those typically observed in polar wind at low solar activity. The point addressed here is about polar wind fluctuations. As is well known, the low-solar-activity polar wind is characterized by a strong flow of Alfvénic fluctuations. Does this hold for the new polar flows too? An answer to this question is given here through a comparative statistical analysis on parameters such as total energy, cross helicity, and residual energy, that are of general use to describe the Alfvénic character of fluctuations. Our results indicate that the main features of the Alfvénic fluctuations observed in low-solar-activity polar wind have been quickly recovered in the new polar flows developed shortly after solar maximum. Keywords. Interplanetary physics (MHD waves and turbulence; Sources of the solar wind – Space plasma physics (Turbulence

  7. The influence of solar wind variability on magnetospheric ULF wave power

    International Nuclear Information System (INIS)

    Pokhotelov, D.; Rae, I.J.; Mann, I.R.

    2015-01-01

    Magnetospheric ultra-low frequency (ULF) oscillations in the Pc 4-5 frequency range play an important role in the dynamics of Earth's radiation belts, both by enhancing the radial diffusion through incoherent interactions and through the coherent drift-resonant interactions with trapped radiation belt electrons. The statistical distributions of magnetospheric ULF wave power are known to be strongly dependent on solar wind parameters such as solar wind speed and interplanetary magnetic field (IMF) orientation. Statistical characterisation of ULF wave power in the magnetosphere traditionally relies on average solar wind-IMF conditions over a specific time period. In this brief report, we perform an alternative characterisation of the solar wind influence on magnetospheric ULF wave activity through the characterisation of the solar wind driver by its variability using the standard deviation of solar wind parameters rather than a simple time average. We present a statistical study of nearly one solar cycle (1996-2004) of geosynchronous observations of magnetic ULF wave power and find that there is significant variation in ULF wave powers as a function of the dynamic properties of the solar wind. In particular, we find that the variability in IMF vector, rather than variabilities in other parameters (solar wind density, bulk velocity and ion temperature), plays the strongest role in controlling geosynchronous ULF power. We conclude that, although time-averaged bulk properties of the solar wind are a key factor in driving ULF powers in the magnetosphere, the solar wind variability can be an important contributor as well. This highlights the potential importance of including solar wind variability especially in studies of ULF wave dynamics in order to assess the efficiency of solar wind-magnetosphere coupling.

  8. THREE-DIMENSIONAL EVOLUTION OF SOLAR WIND DURING SOLAR CYCLES 22–24

    International Nuclear Information System (INIS)

    Manoharan, P. K.

    2012-01-01

    This paper presents an analysis of three-dimensional evolution of solar wind density turbulence and speed at various levels of solar activity between solar cycles 22 and 24. The solar wind data used in this study have been obtained from the interplanetary scintillation (IPS) measurements made at the Ooty Radio Telescope, operating at 327 MHz. Results show that (1) on average, there was a downward trend in density turbulence from the maximum of cycle 22 to the deep minimum phase of cycle 23; (2) the scattering diameter of the corona around the Sun shrunk steadily toward the Sun, starting from 2003 to the smallest size at the deepest minimum, and it corresponded to a reduction of ∼50% in the density turbulence between the maximum and minimum phases of cycle 23; (3) the latitudinal distribution of the solar wind speed was significantly different between the minima of cycles 22 and 23. At the minimum phase of solar cycle 22, when the underlying solar magnetic field was simple and nearly dipole in nature, the high-speed streams were observed from the poles to ∼30° latitudes in both hemispheres. In contrast, in the long-decay phase of cycle 23, the sources of the high-speed wind at both poles, in accordance with the weak polar fields, occupied narrow latitude belts from poles to ∼60° latitudes. Moreover, in agreement with the large amplitude of the heliospheric current sheet, the low-speed wind prevailed in the low- and mid-latitude regions of the heliosphere. (4) At the transition phase between cycles 23 and 24, the high levels of density and density turbulence were observed close to the heliospheric equator and the low-speed solar wind extended from the equatorial-to-mid-latitude regions. The above results in comparison with Ulysses and other in situ measurements suggest that the source of the solar wind has changed globally, with the important implication that the supply of mass and energy from the Sun to the interplanetary space has been significantly reduced

  9. Genesis Solar Wind Science Canister Components Curated as Potential Solar Wind Collectors and Reference Contamination Sources

    Science.gov (United States)

    Allton, J. H.; Gonzalez, C. P.; Allums, K. K.

    2016-01-01

    The Genesis mission collected solar wind for 27 months at Earth-Sun L1 on both passive and active collectors carried inside of a Science Canister, which was cleaned and assembled in an ISO Class 4 cleanroom prior to launch. The primary passive collectors, 271 individual hexagons and 30 half-hexagons of semiconductor materials, are described in. Since the hard landing reduced the 301 passive collectors to many thousand smaller fragments, characterization and posting in the online catalog remains a work in progress, with about 19% of the total area characterized to date. Other passive collectors, surfaces of opportunity, have been added to the online catalog. For species needing to be concentrated for precise measurement (e.g. oxygen and nitrogen isotopes) an energy-independent parabolic ion mirror focused ions onto a 6.2 cm diameter target. The target materials, as recovered after landing, are described in. The online catalog of these solar wind collectors, a work in progress, can be found at: http://curator.jsc.nasa.gov/gencatalog/index.cfm This paper describes the next step, the cataloging of pieces of the Science Canister, which were surfaces exposed to the solar wind or component materials adjacent to solar wind collectors which may have contributed contamination.

  10. Correlation of Magnetic Fields with Solar Wind Plasma Parameters at 1AU

    Science.gov (United States)

    Shen, F.

    2017-12-01

    The physical parameters of the solar wind observed in-situ near 1AU have been studied for several decades, and relationships between them, such as the positive correlation between the solar wind plasma temperature T and velocity V, and the negative correlation between density N and velocity V, are well known. However, the magnetic field intensity does not appear to be well correlated with any individual plasma parameter. In this paper, we discuss previously under-reported correlations between B and the combined plasma parameters √NV2 as well as between B and √NT. These two correlations are strong during the periods of corotating interaction regions and high speed streams, moderate during intervals of slow solar wind, and rather poor during the passage of interplanetary coronal mass ejections. The results indicate that the magnetic pressure in the solar wind is well correlated both with the plasma dynamic pressure and the thermal pressure. Then, we employ a 3D MHD model to simulate the formation of the relationships between the magnetic strength B and √NV2 as well as √NT observed at 1AU. The inner boundary condition is derived by empirical models, with the magnetic field and density are optional. Five kinds of boundary conditions at the inner boundary of heliosphere are tested. In the cases that the magnetic field is related to speed at the inner boundary, the correlation coefficients between B and √NV2 as well as between B and √NT are even higher than that in the observational results. At 1AU the simulated radial magnetic field shows little latitude dependence, which matches the observation of Ulysses. Most of the modeled characters in these cases are closer to observation than others. This inner boundary condition may more accurately characterize Sun's magnetic influence on the heliosphere. The new input may be able to improve the simulation of CME propagation in the inner heliosphere and the space weather forecasting.

  11. Observation of solar wind with radio-star scintillation

    International Nuclear Information System (INIS)

    Watanabe, Takashi

    1974-01-01

    Large solar flares occurred in groups in early August 1972, and many interesting phenomena were observed. The solar wind condition during this period, obtained by scintillation observation, is reviewed. The velocity of solar wind has been determined from the observation of interplanetary space scintillation at Toyokawa, Fujigamine and Sugadaira. Four to ten radio wave sources were observed for ten minutes at each southing every day. Strong earth magnetic storm and the Forbush decrease of cosmic ray were observed during the period from August 3rd to 7th. Pioneer 9 observed a solar wind having the maximum velocity as high as 1,100 km/sec, and HEOS-II observed a solar wind having the velocity close to 2,000 km/sec. On the other hand, according to the scintillation of 3C-48 and 3C-144, the velocity of solar wind passing in the interplanetary space on the westside of the earth was only 300 to 400 km/sec. Therefore it is considered that the condition of solar wind on the east side of the earth differs from that on the west side of the earth. Pioneer 9 observed the pass of a shock wave on August 9th. With all radio wave sources, high velocity solar wind was observed and Pioneer 6 positioned on the west side of the earth also observed it. The thickness of this shock wave is at least 0.3 AU. Discussion is made on the cause for the difference between the asymmetric shock wave in the direction of south-west and symmetrical shock wave. The former may be blast wave, and the latter may be piston driven shock wave and the like. (Iwakiri, K.)

  12. Solar wind velocity and temperature in the outer heliosphere

    Science.gov (United States)

    Gazis, P. R.; Barnes, A.; Mihalov, J. D.; Lazarus, A. J.

    1994-01-01

    At the end of 1992, the Pioneer 10, Pioneer 11, and Voyager 2 spacecraft were at heliocentric distances of 56.0, 37.3, and 39.0 AU and heliographic latitudes of 3.3 deg N, 17.4 deg N, and 8.6 deg S, respectively. Pioneer 11 and Voyager 2 are at similar celestial longitudes, while Pioneer 10 is on the opposite side of the Sun. All three spacecraft have working plasma analyzers, so intercomparison of data from these spacecraft provides important information about the global character of the solar wind in the outer heliosphere. The averaged solar wind speed continued to exhibit its well-known variation with solar cycle: Even at heliocentric distances greater than 50 AU, the average speed is highest during the declining phase of the solar cycle and lowest near solar minimum. There was a strong latitudinal gradient in solar wind speed between 3 deg and 17 deg N during the last solar minimum, but this gradient has since disappeared. The solar wind temperature declined with increasing heliocentric distance out to a heliocentric distance of at least 20 AU; this decline appeared to continue at larger heliocentric distances, but temperatures in the outer heliosphere were suprisingly high. While Pioneer 10 and Voyager 2 observed comparable solar wind temperatures, the temperature at Pioneer 11 was significantly higher, which suggests the existence of a large-scale variation of temperature with heliographic longitude. There was also some suggestion that solar wind temperatures were higher near solar minimum.

  13. Wind and solar energy incentives in Iran

    International Nuclear Information System (INIS)

    Taleghani, G.; Kazemi Karegar, H.

    2006-01-01

    Incentive have yet been viewed as a means of supporting technological developments until a new technology becomes cost competitive wind based electricity is not jet generally competitive with alternate sources of electricity such as fossil fuels. This paper presents the potential for wind and solar in Iran and shows how much electric energy is now produced by renewable power plants compared to steam and gas. The importance of renewable energy effects on Iran environment and economy is also discussed and the issue of the contribution of renewable energy for producing electricity in the future will be shown. Also this paper highlights the ability of Iran to manufacture the components of the wind turbine and solar system locally, and its effect on the price of wind turbine and solar energy

  14. Clouds blown by the solar wind

    International Nuclear Information System (INIS)

    Voiculescu, M; Condurache-Bota, S; Usoskin, I

    2013-01-01

    In this letter we investigate possible relationships between the cloud cover (CC) and the interplanetary electric field (IEF), which is modulated by the solar wind speed and the interplanetary magnetic field. We show that CC at mid–high latitudes systematically correlates with positive IEF, which has a clear energetic input into the atmosphere, but not with negative IEF, in general agreement with predictions of the global electric circuit (GEC)-related mechanism. Thus, our results suggest that mid–high latitude clouds might be affected by the solar wind via the GEC. Since IEF responds differently to solar activity than, for instance, cosmic ray flux or solar irradiance, we also show that such a study allows distinguishing one solar-driven mechanism of cloud evolution, via the GEC, from others. (letter)

  15. Predictions of local ground geomagnetic field fluctuations during the 7-10 November 2004 events studied with solar wind driven models

    Directory of Open Access Journals (Sweden)

    P. Wintoft

    2005-11-01

    Full Text Available The 7-10 November 2004 period contains two events for which the local ground magnetic field was severely disturbed and simultaneously, the solar wind displayed several shocks and negative Bz periods. Using empirical models the 10-min RMS and at Brorfelde (BFE, 11.67° E, 55.63° N, Denmark, are predicted. The models are recurrent neural networks with 10-min solar wind plasma and magnetic field data as inputs. The predictions show a good agreement during 7 November, up until around noon on 8 November, after which the predictions become significantly poorer. The correlations between observed and predicted log RMS is 0.77 during 7-8 November but drops to 0.38 during 9-10 November. For RMS the correlations for the two periods are 0.71 and 0.41, respectively. Studying the solar wind data for other L1-spacecraft (WIND and SOHO it seems that the ACE data have a better agreement to the near-Earth solar wind during the first two days as compared to the last two days. Thus, the accuracy of the predictions depends on the location of the spacecraft and the solar wind flow direction. Another finding, for the events studied here, is that the and models showed a very different dependence on Bz. The model is almost independent of the solar wind magnetic field Bz, except at times when Bz is exceptionally large or when the overall activity is low. On the contrary, the model shows a strong dependence on Bz at all times.

  16. Relationship between velocity gradients and magnetic turbulence in the solar wind

    International Nuclear Information System (INIS)

    Garrett, H.B.

    1974-01-01

    The correlations among the time derivative of the solar-wind velocity, the magnitude of the interplanetary magnetic field (IMF), and the IMF turbulence level are examined to test the idea that interaction between two colliding solar-wind streams can generate turbulence in the solar wind and the IMF. Data obtained by Explorer 33 on the solar wind and IMF are described, and the analysis techniques are outlined. The results indicate that the IMF turbulence level, as measured by the variance, is correlated with the existence of positive velocity gradients in the solar wind. It is noted that while the variance is an increasing function of the field magnitude, it is also independently correlated with the solar-wind velocity gradient

  17. Different magnetospheric modes: solar wind driving and coupling efficiency

    Directory of Open Access Journals (Sweden)

    N. Partamies

    2009-11-01

    Full Text Available This study describes a systematic statistical comparison of isolated non-storm substorms, steady magnetospheric convection (SMC intervals and sawtooth events. The number of events is approximately the same in each group and the data are taken from about the same years to avoid biasing by different solar cycle phase. The very same superposed epoch analysis is performed for each event group to show the characteristics of ground-based indices (AL, PCN, PC potential, particle injection at the geostationary orbit and the solar wind and IMF parameters. We show that the monthly occurrence of sawtooth events and isolated non-stormtime substorms closely follows maxima of the geomagnetic activity at (or close to the equinoxes. The most strongly solar wind driven event type, sawtooth events, is the least efficient in coupling the solar wind energy to the auroral ionosphere, while SMC periods are associated with the highest coupling ratio (AL/EY. Furthermore, solar wind speed seems to play a key role in determining the type of activity in the magnetosphere. Slow solar wind is capable of maintaining steady convection. During fast solar wind streams the magnetosphere responds with loading–unloading cycles, represented by substorms during moderately active conditions and sawtooth events (or other storm-time activations during geomagnetically active conditions.

  18. Three Dimensional Explicit Model for Cometary Tail Ions Interactions with Solar Wind

    Science.gov (United States)

    Al Bermani, M. J. F.; Alhamed, S. A.; Khalaf, S. Z.; Ali, H. Sh.; Selman, A. A.

    2009-06-01

    The different interactions between cometary tail and solar wind ions are studied in the present paper based on three-dimensional Lax explicit method. The model used in this research is based on the continuity equations describing the cometary tail-solar wind interactions. Three dimensional system was considered in this paper. Simulation of the physical system was achieved using computer code written using Matlab 7.0. The parameters studied here assumed Halley comet type and include the particle density rho, the particles velocity v, the magnetic field strength B, dynamic pressure p and internal energy E. The results of the present research showed that the interaction near the cometary nucleus is mainly affected by the new ions added to the plasma of the solar wind, which increases the average molecular weight and result in many unique characteristics of the cometary tail. These characteristics were explained in the presence of the IMF.

  19. Intermittency Statistics in the Expanding Solar Wind

    Science.gov (United States)

    Cuesta, M. E.; Parashar, T. N.; Matthaeus, W. H.

    2017-12-01

    The solar wind is observed to be turbulent. One of the open questions in solar wind research is how the turbulence evolves as the solar wind expands to great distances. Some studies have focused on evolution of the outer scale but not much has been done to understand how intermittency evolves in the expanding wind beyond 1 AU (see [1,2]). We use magnetic field data from Voyager I spacecraft from 1 to 10AU to study the evolution of statistics of magnetic discontinuities. We perform various statistical tests on these discontinuities and make connections to the physical processes occurring in the expanding wind.[1] Tsurutani, Bruce T., and Edward J. Smith. "Interplanetary discontinuities: Temporal variations and the radial gradient from 1 to 8.5 AU." Journal of Geophysical Research: Space Physics 84.A6 (1979): 2773-2787.[2] Greco, A., et al. "Evidence for nonlinear development of magnetohydrodynamic scale intermittency in the inner heliosphere." The Astrophysical Journal 749.2 (2012): 105.

  20. Meteoric ions in the corona and solar wind

    International Nuclear Information System (INIS)

    Lemaire, J.

    1990-01-01

    The total mass of refractory material of interplanetary origin penetrating and evaporated in the meltosphere surrounding the sun has been inferred from observations of meteoroids and fireballs falling in earth's atmosphere. The amount of iron atoms deposited this way in the solar corona is of the order of 3000 t/s or larger. The measured flux of outflowing solar wind iron ions is equal to 2200 t/s. The close agreement of both fluxes is evidence that a significant fraction of iron ions observed in the solar wind and in the corona must be of meteoric origin. A similar accord is also obtained for silicon ions. The mean velocity of meteoroid ions formed in the solar corona is equal to the free-fall velocity: i.e., independent of their atomic mass as the thermal speed of heavy ion measured in low-density solar wind streams at 1 AU. Furthermore, the heavy ions of meteoric origin escape out of the corona with a larger bulk velocity than the protons which are mainly of solar origin. These differences of heavy ion and proton bulk velocities are also observed in the solar wind. 52 refs

  1. Electric solar wind sail mass budget model

    Directory of Open Access Journals (Sweden)

    P. Janhunen

    2013-02-01

    Full Text Available The electric solar wind sail (E-sail is a new type of propellantless propulsion system for Solar System transportation, which uses the natural solar wind to produce spacecraft propulsion. The E-sail consists of thin centrifugally stretched tethers that are kept charged by an onboard electron gun and, as such, experience Coulomb drag through the high-speed solar wind plasma stream. This paper discusses a mass breakdown and a performance model for an E-sail spacecraft that hosts a mission-specific payload of prescribed mass. In particular, the model is able to estimate the total spacecraft mass and its propulsive acceleration as a function of various design parameters such as the number of tethers and their length. A number of subsystem masses are calculated assuming existing or near-term E-sail technology. In light of the obtained performance estimates, an E-sail represents a promising propulsion system for a variety of transportation needs in the Solar System.

  2. Magnetic fields in the solar system planets, moons and solar wind interactions

    CERN Document Server

    Wicht, Johannes; Gilder, Stuart; Holschneider, Matthias

    2018-01-01

    This book addresses and reviews many of the still little understood questions related to the processes underlying planetary magnetic fields and their interaction with the solar wind. With focus on research carried out within the German Priority Program ”PlanetMag”, it also provides an overview of the most recent research in the field. Magnetic fields play an important role in making a planet habitable by protecting the environment from the solar wind. Without the geomagnetic field, for example, life on Earth as we know it would not be possible. And results from recent space missions to Mars and Venus strongly indicate that planetary magnetic fields play a vital role in preventing atmospheric erosion by the solar wind. However, very little is known about the underlying interaction between the solar wind and a planet’s magnetic field. The book takes a synergistic interdisciplinary approach that combines newly developed tools for data acquisition and analysis, computer simulations of planetary interiors an...

  3. Intensity of the Fe XV emission line corona, the level of geomagnetic activity and the velocity of the solar wind

    International Nuclear Information System (INIS)

    Bell, B.; Noci, G.

    1976-01-01

    The average solar wind velocity and the level of geomagnetic activity (Kp) following central meridian passage of coronal weak and bright features identified from Oso 7 isophotograms of Fe XV (284 A) are determined by the method of superposed epochs. Results are consistent with the concept that bright regions possess magnetic field of closed configurations, thereby reducing particle escape, while coronal holes possess open magnetic field lines favorable to particle escape or enhanced outflow of the solar wind. Coronal holes are identified with Bartels' M regions not only statistically but by linking specific long-lived holes with individual sequences of geomagnetic storms. In the study of bright region a subdivision by brightness temperature (T/sub b/) of associated 9.1-cm radiation was found to be significant, with the region s of higher T/sub b/ having a stronger inhibiting power on the outflow of the solar wind when they were located in the solar hemisphere on the same side of the solar equator as the earth. Regions of highest T/sub b/ most strongly depress the outflow of solar wind but are also the most likely to produce flare-associated great storms

  4. Synoptic maps of solar wind parameters from in situ spacecraft observations

    Science.gov (United States)

    Gazis, P. R.

    1995-01-01

    Solar wind observations from the Interplanetary Monitoring Platform-8 (IMP-8) and Pioneer Venus Orbiter (PVO) spacecraft from 1982 until 1988 are combined to construct synoptic maps of solar wind parameters near 1 AU. Each map consists of 6 months of hourly averaged solar wind data, binned by heliographic latitude and Carrington longitude and projected back to the Sun. These maps show the structure and time evolution of solar wind streams near 1 AU in the heliographic latitudes of +/- 7.25 deg and provide and explicit picture of several phenomena, such as gradients, changes in the inclination of the heliospheric current sheet, and the relative positions of various structures in the inner heliosphere, that is difficult to obtain from single-spacecraft observations. The stream structure varied significantly during the last solar cycle. Between 1982 and early 1985, solar wind parameters did not depend strongly on heliographic latitude. During the last solar minimum, the solar wind developed significant latitudinal structure, and high-speed streams were excluded from the vicinity of the solar equator. The interplanetary magnetic field was strongly correlated with the coronal field, and the current sheet tended to coincide with the coronal neutral line. The solar wind speed showed the expected correlations with temperature, interplanetary magnetic field, and distance from the current sheet. The solar wind speed was anticorrelated with density, but the regions of highest density occurred east of the heliospheric current sheet and the regions of lowest solar wind speed. This is consistent with compression at the leading edge of high-speed streams.

  5. The influence of solar wind variability on magnetospheric ULF wave power

    Directory of Open Access Journals (Sweden)

    D. Pokhotelov

    2015-06-01

    Full Text Available Magnetospheric ultra-low frequency (ULF oscillations in the Pc 4–5 frequency range play an important role in the dynamics of Earth's radiation belts, both by enhancing the radial diffusion through incoherent interactions and through the coherent drift-resonant interactions with trapped radiation belt electrons. The statistical distributions of magnetospheric ULF wave power are known to be strongly dependent on solar wind parameters such as solar wind speed and interplanetary magnetic field (IMF orientation. Statistical characterisation of ULF wave power in the magnetosphere traditionally relies on average solar wind–IMF conditions over a specific time period. In this brief report, we perform an alternative characterisation of the solar wind influence on magnetospheric ULF wave activity through the characterisation of the solar wind driver by its variability using the standard deviation of solar wind parameters rather than a simple time average. We present a statistical study of nearly one solar cycle (1996–2004 of geosynchronous observations of magnetic ULF wave power and find that there is significant variation in ULF wave powers as a function of the dynamic properties of the solar wind. In particular, we find that the variability in IMF vector, rather than variabilities in other parameters (solar wind density, bulk velocity and ion temperature, plays the strongest role in controlling geosynchronous ULF power. We conclude that, although time-averaged bulk properties of the solar wind are a key factor in driving ULF powers in the magnetosphere, the solar wind variability can be an important contributor as well. This highlights the potential importance of including solar wind variability especially in studies of ULF wave dynamics in order to assess the efficiency of solar wind–magnetosphere coupling.

  6. Solar winds along curved magnetic field lines

    OpenAIRE

    Li, Bo; Xia, Li-Dong; Chen, Yao

    2011-01-01

    Both remote-sensing measurements using the interplanetary scintillation (IPS) technique and in situ measurements by the Ulysses spacecraft show a bimodal structure for the solar wind at solar minimum conditions. At present what makes the fast wind fast and the slow wind slow still remains to be answered. While a robust empirical correlation exists between the coronal expansion rate $f_c$ of the flow tubes and the speeds $v$ measured in situ, further data analysis suggests that $v$ depends on ...

  7. Solar wind and its interaction with the Earth magnetosphere

    International Nuclear Information System (INIS)

    Grib, S.A.

    1978-01-01

    A critical review is given regarding the research of the stationary and non-stationary interaction of the solar wind with the Earth magnetosphere. Highlighted is the significance of the interplanetary magnetic field in the non-stationary movement of the solar wind flux. The problem of the solar wind shock waves interaction with the ''bow wave-Earth's magnetosphere'' system is being solved. Considered are the secondary phenomena, as a result of which the depression-type wave occurs, that lowers the pressure on the Earth's maanetosphere. The law, governing the movement of the magnetosphere subsolar point during the abrupt start of a geomagnetic storm has been discovered. Stationary circumvention of the magnetosphere by the solar wind flux is well described by the gas dynamic theory of the hypersonic flux. Non-stationary interaction of the solar wind shock waves with the magnetosphere is magnetohydrodynamic. It is pointed out, that the problems under consideration are important for the forecasting of strong geomagnetic perturbations on the basis of cosmic observations

  8. Understanding non-equilibrium collisional and expansion effects in the solar wind with Parker Solar Probe

    Science.gov (United States)

    Korreck, K. E.; Klein, K. G.; Maruca, B.; Alterman, B. L.

    2017-12-01

    The evolution of the solar wind from the corona to the Earth and throughout the heliosphere is a complex interplay between local micro kinetics and large scale expansion effects. These processes in the solar wind need to be separated in order to understand and distinguish the dominant mechanism for heating and acceleration of the solar wind. With the upcoming launch in 2018 of Parker Solar Probe and the launch of Solar Orbiter after, addressing the local and global phenomena will be enabled with in situ measurements. Parker Solar Probe will go closer to the Sun than any previous mission enabling the ability to examine the solar wind at an early expansion age. This work examines the predictions for what will be seen inside of the 0.25 AU (54 solar radii) where Parker Solar Probe will take measurements and lays the groundwork for disentangling the expansion and collisional effects. In addition, methods of thermal plasma data analysis to determine the stability of the plasma in the Parker Solar Probe measurements will be discussed.

  9. A study of the solar wind deceleration in the Earth's foreshock region

    Science.gov (United States)

    Zhang, T.-L.; Schwingenschuh, K.; Russell, C. T.

    1995-01-01

    Previous observations have shown that the solar wind is decelerated and deflected in the earth's upstream region populated by long-period waves. This deceleration is corelated with the 'diffuse' but not with the 'reflected' ion population. The speed of the solar wind may decrease tens of km/s in the foreshock region. The solar wind dynamic pressure exerted on the magnetopause may vary due to the fluctuation of the solar wind speed and density in the foreshock region. In this study, we examine this solar wind deceleration and determine how the solar wind deceleration varies in the foreshock region.

  10. Transient flows of the solar wind associated with small-scale solar activity in solar minimum

    Science.gov (United States)

    Slemzin, Vladimir; Veselovsky, Igor; Kuzin, Sergey; Gburek, Szymon; Ulyanov, Artyom; Kirichenko, Alexey; Shugay, Yulia; Goryaev, Farid

    The data obtained by the modern high sensitive EUV-XUV telescopes and photometers such as CORONAS-Photon/TESIS and SPHINX, STEREO/EUVI, PROBA2/SWAP, SDO/AIA provide good possibilities for studying small-scale solar activity (SSA), which is supposed to play an important role in heating of the corona and producing transient flows of the solar wind. During the recent unusually weak solar minimum, a large number of SSA events, such as week solar flares, small CMEs and CME-like flows were observed and recorded in the databases of flares (STEREO, SWAP, SPHINX) and CMEs (LASCO, CACTUS). On the other hand, the solar wind data obtained in this period by ACE, Wind, STEREO contain signatures of transient ICME-like structures which have shorter duration (<10h), weaker magnetic field strength (<10 nT) and lower proton temperature than usual ICMEs. To verify the assumption that ICME-like transients may be associated with the SSA events we investigated the number of weak flares of C-class and lower detected by SPHINX in 2009 and STEREO/EUVI in 2010. The flares were classified on temperature and emission measure using the diagnostic means of SPHINX and Hinode/EIS and were confronted with the parameters of the solar wind (velocity, density, ion composition and temperature, magnetic field, pitch angle distribution of the suprathermal electrons). The outflows of plasma associated with the flares were identified by their coronal signatures - CMEs (only in few cases) and dimmings. It was found that the mean parameters of the solar wind projected to the source surface for the times of the studied flares were typical for the ICME-like transients. The results support the suggestion that weak flares can be indicators of sources of transient plasma flows contributing to the slow solar wind at solar minimum, although these flows may be too weak to be considered as separate CMEs and ICMEs. The research leading to these results has received funding from the European Union’s Seventh Programme

  11. The model of unshocked deceleration of the solar wind

    International Nuclear Information System (INIS)

    Gidalevich, E.Ya.

    1977-01-01

    The motion of the Sun relative to the interstellar gas is considered as an hydrodynamic flow in a point-source field. Interstellar gas has been found to undergo considerable compaction as it is braked in the solar gravitational field. Solar-wind braking due to ion charge exchange processes on interstellar hydrogen atoms is discussed. It is shown that tangible solar-wind braking occurs at a distance of about 3x1O 14 cm from the Sun in the apex direction. In the opposite direction solar wind propagates freely

  12. Relationships between the solar wind and the polar cap magnetic activity

    International Nuclear Information System (INIS)

    Berthelier, A.

    1981-01-01

    The influence of solar wind conditions on magnetic activity is described in order to delineate the differences in the response of the magnetic activity to the arrival on the magnetopause of different typical solar wind variations. By determining a new index of local magnetic activity free from seasonal and diurnal effects we put in evidence the dependence of the various effects upon the invariant latitude. Most important results are: (1) the main increase of the magnetic activity does not occur at the same invariant latitude for different interplanetary variations, e.g. peaks of Bz tend to increase magnetic activity mainly in the auroral zones while peaks of B correspond to a uniform increase in magnetic activity over the polar cap and auroral zone; (2) there is a two steps response of magnetic activity to the high speed plasma streams; (3) an increase of magnetic activity is observed for large and northward Bz, which probably indicates that the solar wind-magnetosphere coupling is efficient under these circumstances. The specific influences of the IMF polarity are also briefly reviewed. (orig.)

  13. A hybrid solar photovoltaic-wind turbine-Rankine cycle for electricity generation in Turkish Republic of Northern Cyprus

    Directory of Open Access Journals (Sweden)

    Samuel Asumadu-Sarkodie

    2016-12-01

    Full Text Available This paper presents an energy demand model by designing a hybrid solar-wind-thermal power generation system of the Turkish Republic of Northern Cyprus, a promising substitute for the expensive battery banks. The study models the future energy demand of Turkish Republic of Northern Cyprus based on the IPCC emissions scenario A1B and A2 by designing a new hybrid solar-wind-thermal power system that satisfies the current and future requirements of firm capacity during peak periods. The study suggests an improvement in a hybrid solar-wind-thermal power system performance by predicting reliable outputs that can integrate renewable energy technologies to conventional power generation. The energy consumption prediction model emphasizes the energy requirement that has a growing demand from 300 to 400 GWh in scenario A1B and 150–450 GWh in scenario A2 from 2010 to 2050. The proposed design can meet 400 GWh of electricity demand in TRNC based on IPCC scenario A1B and 450 GWh of electricity demand in TRNC based on IPCC scenario A2. The percentage contribution of solar, wind and thermal energy for 2010, 2020, 2030, 2040 and 2050 are presented along with CO2 emissions and water consumption for each of the years.

  14. Ensemble downscaling in coupled solar wind-magnetosphere modeling for space weather forecasting.

    Science.gov (United States)

    Owens, M J; Horbury, T S; Wicks, R T; McGregor, S L; Savani, N P; Xiong, M

    2014-06-01

    Advanced forecasting of space weather requires simulation of the whole Sun-to-Earth system, which necessitates driving magnetospheric models with the outputs from solar wind models. This presents a fundamental difficulty, as the magnetosphere is sensitive to both large-scale solar wind structures, which can be captured by solar wind models, and small-scale solar wind "noise," which is far below typical solar wind model resolution and results primarily from stochastic processes. Following similar approaches in terrestrial climate modeling, we propose statistical "downscaling" of solar wind model results prior to their use as input to a magnetospheric model. As magnetospheric response can be highly nonlinear, this is preferable to downscaling the results of magnetospheric modeling. To demonstrate the benefit of this approach, we first approximate solar wind model output by smoothing solar wind observations with an 8 h filter, then add small-scale structure back in through the addition of random noise with the observed spectral characteristics. Here we use a very simple parameterization of noise based upon the observed probability distribution functions of solar wind parameters, but more sophisticated methods will be developed in the future. An ensemble of results from the simple downscaling scheme are tested using a model-independent method and shown to add value to the magnetospheric forecast, both improving the best estimate and quantifying the uncertainty. We suggest a number of features desirable in an operational solar wind downscaling scheme. Solar wind models must be downscaled in order to drive magnetospheric models Ensemble downscaling is more effective than deterministic downscaling The magnetosphere responds nonlinearly to small-scale solar wind fluctuations.

  15. Conductive solar wind models in rapidly diverging flow geometries

    International Nuclear Information System (INIS)

    Holzer, T.E.; Leer, E.

    1980-01-01

    A detailed parameter study of conductive models of the solar wind has been carried out, extending the previous similar studies of Durney (1972) and Durney and Hundhausen (1974) by considering collisionless inhibition of thermal conduction, rapidly diverging flow geometries, and the structure of solutions for the entire n 0 -T 0 plane (n 0 and T 0 are the coronal base density and temperature). Primary emphasis is placed on understanding the complex effects of the physical processes operative in conductive solar wind models. There are five points of particular interest that have arisen from the study: (1) neither collisionless inhibition of thermal conduction nor rapidly diverging flow geometries can significantly increase the solar wind speed at 1 AU; (2) there exists a firm upper limit on the coronal base temperature consistent with observed values of the coronal base pressure and solar wind mass flux density; (3) the principal effect of rapidly diverging flow geometries is a decrease in the solar wind mass flux density at 1 AU and an increase in the mass flux density at the coronal base; (4) collisionless inhibition of thermal conduction can lead to a solar wind flow speed that either increases or decreases with increasing coronal base density (n 0 ) and temperature (T 0 , depending on the region of the n 0 -T 0 plane considered; (5) there is a region of the n 0 -T/sub o/ plane at high coronal base densities where low-speed, high-mass-flux, transonic solar wind flows exist: a region not previously considered

  16. Charge States of Krypton and Xenon in the Solar Wind

    Science.gov (United States)

    Bochsler, Peter; Fludra, Andrzej; Giunta, Alessandra

    2017-09-01

    We calculate charge state distributions of Kr and Xe in a model for two different types of solar wind using the effective ionization and recombination rates provided from the OPEN_ADAS data base. The charge states of heavy elements in the solar wind are essential for estimating the efficiency of Coulomb drag in the inner corona. We find that xenon ions experience particularly low Coulomb drag from protons in the inner corona, comparable to the notoriously weak drag of protons on helium ions. It has been found long ago that helium in the solar wind can be strongly depleted near interplanetary current sheets, whereas coronal mass ejecta are sometimes strongly enriched in helium. We argue that if the extraordinary variability of the helium abundance in the solar wind is due to inefficient Coulomb drag, the xenon abundance must vary strongly. In fact, a secular decrease of the solar wind xenon abundance relative to the other heavier noble gases (Ne, Ar, Kr) has been postulated based on a comparison of noble gases in recently irradiated and ancient samples of ilmenite in the lunar regolith. We conclude that decreasing solar activity and decreasing frequency of coronal mass ejections over the solar lifetime might be responsible for a secularly decreasing abundance of xenon in the solar wind.

  17. Solar wind energy transfer through the magnetopause of an open magnetosphere

    International Nuclear Information System (INIS)

    Lee, L.C.; Roederer, J.G.

    1982-01-01

    An expression for the total power P/sub T/ transferred from the solar wind to an ''open'' magnetopause with a nonzero normal component of the magnetic field, which is identified as a rotational discontinuity. The total power P/sub T/ consists of (1) the power P/sub EM/ representing the electromagnetic energy transfer and (2) the power P/sub KE/ representing the rate of kinetic energy carried by particles penetrating into the magnetosphere. It is found that P/sub EM/approx. =V/sub SW/ B/sub SW/psi, P/sub KE/approx. =(1/2 M/sub A/-1) P/sub EM/ and P/sub T/approx. =1/2M/sub A/P/sub EM/, where V/sub SW/, B/sub SW/, and M/sub A/ are the velocity, magnetic field, and the Alfven--Mach number in the solar wind, respectively, and Psi is the open magnetic flux in the magnetosphere. The Alfven--Mach number of flow at the magnetopause determines the nature of the local energy transfer; the power per unit area transferred from the solar wind to the magnetosphere consists mainly of kinetic energy. The electromagnetic energy rate P/sub EM/ controls the near-earth magnetospheric activity, whereas the kinetic energy rate P/sub KE/(approx. =3--4 P/sub EM/) should dominate the dynamics of the distant magnetotail

  18. Diagnostics of the solar wind transition region

    International Nuclear Information System (INIS)

    Lotova, N.A.; Nagelis, Ya.V.; Rudnitskij, G.M.; Smirnova, T.V.; AN Latvijskoj SSR, Riga. Radioastrofizicheskaya Observatoriya; Moskovskij Gosudarstvennyj Univ.; AN SSSR, Moscow. Fizicheskij Inst.)

    1988-01-01

    Possibilities are discussed of a more complete study of hardly observable regions of the interplanetary medium, in the zone of the solar wind formation, where transition from subsonic to supersonic flow occurs at R sun . It is shown that an investigation of fine structure of the extended transonic region of the solar wind and of the sequence of changes in the parameters of the interplanetary plasma in the region of the solar wind formation with the changing distance from the Sun can be effectuated by using jointly different modifications of the occupation method. Combination of two or more modifications of this method supposes using compact radio sources of different classes and observations in two different wavelength ranges, namely at short centimeter and at meter waves

  19. QUANTIFYING THE ANISOTROPY AND SOLAR CYCLE DEPENDENCE OF '1/f' SOLAR WIND FLUCTUATIONS OBSERVED BY ADVANCED COMPOSITION EXPLORER

    International Nuclear Information System (INIS)

    Nicol, R. M.; Chapman, S. C.; Dendy, R. O.

    2009-01-01

    The power spectrum of the evolving solar wind shows evidence of a spectral break between an inertial range (IR) of turbulent fluctuations at higher frequencies and a '1/f' like region at lower frequencies. In the ecliptic plane at ∼1 AU, this break occurs approximately at timescales of a few hours and is observed in the power spectra of components of velocity and magnetic field. The '1/f' energy range is of more direct coronal origin than the IR, and carries signatures of the complex magnetic field structure of the solar corona, and of footpoint stirring in the solar photosphere. To quantify the scaling properties we use generic statistical methods such as generalized structure functions and probability density functions (PDFs), focusing on solar cycle dependence and on anisotropy with respect to the background magnetic field. We present structure function analysis of magnetic and velocity field fluctuations, using a novel technique to decompose the fluctuations into directions parallel and perpendicular to the mean local background magnetic field. Whilst the magnetic field is close to '1/f', we show that the velocity field is '1/f α ' with α ≠ 1. For the velocity, the value of α varies between parallel and perpendicular fluctuations and with the solar cycle. There is also variation in α with solar wind speed. We have examined the PDFs in the fast, quiet solar wind and intriguingly, whilst parallel and perpendicular are distinct, both the B field and velocity show the same PDF of their perpendicular fluctuations, which is close to gamma or inverse Gumbel. These results point to distinct physical processes in the corona and to their mapping out into the solar wind. The scaling exponents obtained constrain the models for these processes.

  20. Reevaluation of the Solar Wind 36Ar/38Ar Ratio

    Science.gov (United States)

    Becker, R. H.; Schlutter, D. J.; Rider, P. E.; Pepin, R. O.

    1996-03-01

    The isotopic composition of solar wind (SW) argon is an important parameter in the modeling of the evolution of the terrestrial planet atmospheres. Anders and Grevesse assumed a 36Ar/38Ar ratio for SW of 5.31, essentially equal to that of air. Considerable evidence has since developed which indicates that this ratio is too low. Benkert et al. have reported their best estimate for the recent SW as 5.48 +/- 0.05, determined from measurements of lunar soil 71501. Based on Ar data obtained from surface oxidation of a metal separate from the Weston meteorite and from an uncontrolled etch of lunar sample 67701, reported by our group previously, we consider even this value to be too low. Since values of 5.75 to 5.85 were reported by Black for initial low temperature (fairly high SW 36Ar/38Ar ratio (in the range of ~5.6 to ~5.7), we decided to analyze Kapoeta for its light solar wind gases using the acid-etching techniques developed in our laboratory based on the CSSE procedure of Benkert et al.

  1. Wind and Solar Curtailment: International Experience and Practices

    DEFF Research Database (Denmark)

    Lew, Debra; Bird, Lori; Milligan, Michael

    2013-01-01

    High penetrations of wind and solar generation on power systems are resulting in increasing curtailment. Wind and solar integration studies predict increased curtailment as penetration levels grow. This paper examines experiences with curtailment on bulk power systems internationally. It discusses...... how much curtailment is occurring, how it is occurring, why it is occurring, and what is being done to reduce curtailment. This summary is produced as part of the International Energy Agency Wind Task 25 on Design and Operation of Power Systems with Large Amounts of Wind Power....

  2. Internal plasma state of the high speed solar wind at 1 AU

    International Nuclear Information System (INIS)

    Feldman, W.C.; Abraham--Shrauner, B.; Asbridge, J.R.; Bame, S.J.

    1976-01-01

    The character of particle velocity distributions in the high speed solar wind is presented. It is found that electron distribution shapes differ from simple bi-Maxwellians in that a hot, strongly beamed, high energy electron component is always present and is observed to move relative to a distinct low energy electron component along the magnetic field direction, B, away from the sun. The velocity difference between hot and cold electron components appears, at times, to be strongly correlated with the local Alfven speed. This correlation suggests that the solar wind heat flux is being limited some of the time in the neighborhood of 1 AU. Proton velocity distributions are also best described in terms of two relatively convecting, unresolved components. The velocity of the lower density proton beam component is generally larger than that of the main component and the temperature of the main component perpendicular to B is typically 2 to 3 times larger than its parallel temperature. Alpha particles as a whole generally move faster than the protons along B and have a temperature which is, on the average, 6 times higher than the temperature of the total proton population. Evidence is presented which supports the idea that the two-component proton structure observed in high speed regions is intimately related to fine scale velocity variations at 1 AU, and hence by inference, to prominent spatial and/or temporal structures present throughout that part of the corona from which the solar wind evolves

  3. Long-period polar rain variations, solar wind and hemispherically symmetric polar rain

    International Nuclear Information System (INIS)

    Makita, K.; Meng, C.

    1987-01-01

    On the basic of electron data obtained by the Defense Meteorological Satellite Program (DMSP) F2 satellite the long-period variations of the polar rain flux are examined for four consecutive solar rotations. It is clearly demonstrated that the asymmetric enhancement of the polar rain flux is strongly controlled by the sector structure of the interplanetary magnetic field (IMF). However, the orbit-to-orbit and day-to-day variations of the polar rain flux are detected even during a very stable sector period, and the polar rain flux does not have any clear relationship to the magnitude of the IMF B/sub x/ or B/sub y/. Thus the polarity of B/sub x/ controls only the accessibility of a polar region. It is also noticed that the intensity of polar rain fluxes does not show any relationship to the density of the solar wind, suggesting that the origin of the polar rain electrons is different from the commonly observed part of the solar wind electron distribution function. In addition to the asymmetric polar rain distribution, increasing polar rain fluxes of similar high intensity are sometimes detected over both polar caps. An examination of more than 1 year's data from the DMSP F2 and F4 satellites shows that simultaneous intense uniform precipitations (>10 7 electrons/cm 2 s sr) over both polar caps are not coincidental; it also shows that the spectra are similar. The occurrence of hemispherically symmetric events is not common. They generally are observed after an IMF sector transition period, during unstable periods in the sector structure, and while the solar wind density is high. copyright American Geophysical Union 1987

  4. Wind in the Solar System

    Science.gov (United States)

    McIntosh, Gordon

    2010-01-01

    As an astronomy instructor I am always looking for commonly experienced Earthly phenomena to help my students and me understand and appreciate similar occurrences elsewhere in the solar system. Recently I wrote short "TPT" articles on frost and precipitation. The present article is on winds in the solar system. A windy day or storm might…

  5. The Solar Wind Source Cycle: Relationship to Dynamo Behavior

    Science.gov (United States)

    Luhmann, J. G.; Li, Y.; Lee, C. O.; Jian, L. K.; Petrie, G. J. D.; Arge, C. N.

    2017-12-01

    Solar cycle trends of interest include the evolving properties of the solar wind, the heliospheric medium through which the Sun's plasmas and fields interact with Earth and the planets -including the evolution of CME/ICMEs enroute. Solar wind sources include the coronal holes-the open field regions that constantly evolve with solar magnetic fields as the cycle progresses, and the streamers between them. The recent cycle has been notably important in demonstrating that not all solar cycles are alike when it comes to contributions from these sources, including in the case of ecliptic solar wind. In particular, it has modified our appreciation of the low latitude coronal hole and streamer sources because of their relative prevalence. One way to understand the basic relationship between these source differences and what is happening inside the Sun and on its surface is to use observation-based models like the PFSS model to evaluate the evolution of the coronal field geometry. Although the accuracy of these models is compromised around solar maximum by lack of global surface field information and the sometimes non-potential evolution of the field related to more frequent and widespread emergence of active regions, they still approximate the character of the coronal field state. We use these models to compare the inferred recent cycle coronal holes and streamer belt sources of solar wind with past cycle counterparts. The results illustrate how (still) hemispherically asymmetric weak polar fields maintain a complex mix of low-to-mid latitude solar wind sources throughout the latest cycle, with a related marked asymmetry in the hemispheric distribution of the ecliptic wind sources. This is likely to be repeated until the polar field strength significantly increases relative to the fields at low latitudes, and the latter symmetrize.

  6. Is tropospheric weather influenced by solar wind through atmospheric vertical coupling downward control?

    Science.gov (United States)

    Prikryl, Paul; Tsukijihara, Takumi; Iwao, Koki; Muldrew, Donald B.; Bruntz, Robert; Rušin, Vojto; Rybanský, Milan; Turňa, Maroš; Šťastný, Pavel; Pastirčák, Vladimír

    2017-04-01

    (Prikryl et al., Ann. Geophys., 27, 31-57, 2009). It is primarily the energy provided by release of latent heat that leads to intensification of storms. These results indicate that vertical coupling in the atmosphere exerts downward control from solar wind to the lower atmospheric levels influencing tropospheric weather development.

  7. Extended neutral atmosphere effect on solar wind interaction with nonmagnetic bodies of the solar system

    International Nuclear Information System (INIS)

    Breus, T.K.; Krymskij, A.M.; Mitnitskij, V.Ya.

    1987-01-01

    Numeric modelling of the Venus flow-around by the solar wind with regard to stream loading by heavy ions, produced under photoionization of the Venus neutral oxygen corona, is conducted. It is shown, that this effect can account for a whole number of peculiarities related to the solar wind interaction with the planet which have not been clearly explained yet, namely, shock wave position, solar wind stream and magnetic field characteristics behind the front

  8. EVOLUTION OF THE RELATIONSHIPS BETWEEN HELIUM ABUNDANCE, MINOR ION CHARGE STATE, AND SOLAR WIND SPEED OVER THE SOLAR CYCLE

    International Nuclear Information System (INIS)

    Kasper, J. C.; Stevens, M. L.; Korreck, K. E.; Maruca, B. A.; Kiefer, K. K.; Schwadron, N. A.; Lepri, S. T.

    2012-01-01

    The changing relationships between solar wind speed, helium abundance, and minor ion charge state are examined over solar cycle 23. Observations of the abundance of helium relative to hydrogen (A He ≡ 100 × n He /n H ) by the Wind spacecraft are used to examine the dependence of A He on solar wind speed and solar activity between 1994 and 2010. This work updates an earlier study of A He from 1994 to 2004 to include the recent extreme solar minimum and broadly confirms our previous result that A He in slow wind is strongly correlated with sunspot number, reaching its lowest values in each solar minima. During the last minimum, as sunspot numbers reached their lowest levels in recent history, A He continued to decrease, falling to half the levels observed in slow wind during the previous minimum and, for the first time observed, decreasing even in the fastest solar wind. We have also extended our previous analysis by adding measurements of the mean carbon and oxygen charge states observed with the Advanced Composition Explorer spacecraft since 1998. We find that as solar activity decreased, the mean charge states of oxygen and carbon for solar wind of a given speed also fell, implying that the wind was formed in cooler regions in the corona during the recent solar minimum. The physical processes in the coronal responsible for establishing the mean charge state and speed of the solar wind have evolved with solar activity and time.

  9. Solar wind plasma structure near a 'HELIOS-Perihelion'

    International Nuclear Information System (INIS)

    Kikuchi, H.

    1979-01-01

    The purpose of this paper is to introduce a couple of preliminary but important results obtained from HELIOS observation concerning solar wind plasma structure near a ''HELIOS-Perihelion'' among the data analyses in progress, partly in relation to laboratory plasma. Idealized profiles of the bulk velocity, density and temperature of solar wind near 0.3 AU as deduced from HELIOS A data and correlated K-coronal contours were obtained. During 1974 - 1976, the sun was in the period of declining cycle, and the coronal holes expanded to lower latitudes from northern and southern holes. There is general tendency that the northern coronal hole is somewhat larger than the southern coronal hole. In regards to solar wind velocity, there are two fast stream regions with velocity as high as 800 Km/sec. An electron spectrum measured near a HELIOS-Perihelion (0.3 AU) approximately in the solar direction is shown. Three regions can be distinguished in velocity distribution. The density contours of solar wind electrons in velocity space exhibit a narrow beam of electrons in the magnetic field direction close to the plane of observation. (Kato, T.)

  10. The genesis solar-wind sample return mission

    International Nuclear Information System (INIS)

    Wiens, Roger C.

    2009-01-01

    The compositions of the Earth's crust and mantle, and those of the Moon and Mars, are relatively well known both isotopically and elementally. The same is true of our knowledge of the asteroid belt composition, based on meteorite analyses. Remote measurements of Venus, the Jovian atmosphere, and the outer planet moons, have provided some estimates of their compositions. The Sun constitutes a large majority, > 99%, of all the matter in the solar system. The elemental composition of the photosphere, the visible 'surface' of the Sun, is constrained by absorption lines produced by particles above the surface. Abundances for many elements are reported to the ±10 or 20% accuracy level. However, the abundances of other important elements, such as neon, cannot be determined in this way due to a relative lack of atomic states at low excitation energies. Additionally and most importantly, the isotopic composition of the Sun cannot be determined astronomically except for a few species which form molecules above sunspots, and estimates derived from these sources lack the accuracy desired for comparison with meteoritic and planetary surface samples measured on the Earth. The solar wind spreads a sample of solar particles throughout the heliosphere, though the sample is very rarified: collecting a nanogram of oxygen, the third most abundant element, in a square centimeter cross section at the Earth's distance from the Sun takes five years. Nevertheless, foil collectors exposed to the solar wind for periods of hours on the surface of the Moon during the Apollo missions were used to determine the helium and neon solar-wind compositions sufficiently to show that the Earth's atmospheric neon was significantly evolved relative to the Sun. Spacecraft instruments developed subsequently have provided many insights into the composition of the solar wind, mostly in terms of elemental composition. These instruments have the advantage of observing a number of parameters simultaneously

  11. Wind/solar resource in Texas

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, V.; Starcher, K.; Gaines, H. [West Texas A& M Univ., Canyon, TX (United States)

    1997-12-31

    Data are being collected at 17 sites to delineate a baseline for the wind and solar resource across Texas. Wind data are being collected at 10, 25, and 40 m (in some cases at 50 m) to determine wind shear and power at hub heights of large turbines. Many of the sites are located in areas of predicted terrain enhancement. The typical day in a month for power and wind turbine output was calculated for selected sites and combination of sites; distributed systems. Major result to date is that there is the possibility of load matching in South Texas during the summer months, even though the average values by month indicate a low wind potential.

  12. RECONSTRUCTING THE SOLAR WIND FROM ITS EARLY HISTORY TO CURRENT EPOCH

    Energy Technology Data Exchange (ETDEWEB)

    Airapetian, Vladimir S.; Usmanov, Arcadi V., E-mail: vladimir.airapetian@nasa.gov, E-mail: avusmanov@gmail.com [NASA Goddard Space Flight Center, Greenbelt, MD (United States)

    2016-02-01

    Stellar winds from active solar-type stars can play a crucial role in removal of stellar angular momentum and erosion of planetary atmospheres. However, major wind properties except for mass-loss rates cannot be directly derived from observations. We employed a three-dimensional magnetohydrodynamic Alfvén wave driven solar wind model, ALF3D, to reconstruct the solar wind parameters including the mass-loss rate, terminal velocity, and wind temperature at 0.7, 2, and 4.65 Gyr. Our model treats the wind thermal electrons, protons, and pickup protons as separate fluids and incorporates turbulence transport, eddy viscosity, turbulent resistivity, and turbulent heating to properly describe proton and electron temperatures of the solar wind. To study the evolution of the solar wind, we specified three input model parameters, the plasma density, Alfvén wave amplitude, and the strength of the dipole magnetic field at the wind base for each of three solar wind evolution models that are consistent with observational constrains. Our model results show that the velocity of the paleo solar wind was twice as fast, ∼50 times denser and 2 times hotter at 1 AU in the Sun's early history at 0.7 Gyr. The theoretical calculations of mass-loss rate appear to be in agreement with the empirically derived values for stars of various ages. These results can provide realistic constraints for wind dynamic pressures on magnetospheres of (exo)planets around the young Sun and other active stars, which is crucial in realistic assessment of the Joule heating of their ionospheres and corresponding effects of atmospheric erosion.

  13. RECONSTRUCTING THE SOLAR WIND FROM ITS EARLY HISTORY TO CURRENT EPOCH

    International Nuclear Information System (INIS)

    Airapetian, Vladimir S.; Usmanov, Arcadi V.

    2016-01-01

    Stellar winds from active solar-type stars can play a crucial role in removal of stellar angular momentum and erosion of planetary atmospheres. However, major wind properties except for mass-loss rates cannot be directly derived from observations. We employed a three-dimensional magnetohydrodynamic Alfvén wave driven solar wind model, ALF3D, to reconstruct the solar wind parameters including the mass-loss rate, terminal velocity, and wind temperature at 0.7, 2, and 4.65 Gyr. Our model treats the wind thermal electrons, protons, and pickup protons as separate fluids and incorporates turbulence transport, eddy viscosity, turbulent resistivity, and turbulent heating to properly describe proton and electron temperatures of the solar wind. To study the evolution of the solar wind, we specified three input model parameters, the plasma density, Alfvén wave amplitude, and the strength of the dipole magnetic field at the wind base for each of three solar wind evolution models that are consistent with observational constrains. Our model results show that the velocity of the paleo solar wind was twice as fast, ∼50 times denser and 2 times hotter at 1 AU in the Sun's early history at 0.7 Gyr. The theoretical calculations of mass-loss rate appear to be in agreement with the empirically derived values for stars of various ages. These results can provide realistic constraints for wind dynamic pressures on magnetospheres of (exo)planets around the young Sun and other active stars, which is crucial in realistic assessment of the Joule heating of their ionospheres and corresponding effects of atmospheric erosion

  14. Combined wind and solar feed-in to the grid

    CSIR Research Space (South Africa)

    Mushwana, Crescent

    2018-05-01

    Full Text Available This presentation highlights South African wind and solar resources and presents a case study on wind and solar PV combination. It also distinguishes between traditional and new philosophies regarding energy system design and the changes...

  15. Solar-wind krypton and solid/gas fractionation in the early solar nebula

    Science.gov (United States)

    Wiens, Roger C.; Burnett, D. S.; Neugebauer, M.; Pepin, R. O.

    1991-01-01

    The solar-system Kr abundance is calculated from solar-wind noble-gas ratios, determined previously by low-temperature oxidations of lunar ilmenite grains, normalized to Si by spacecraft solar-wind measurements. The estimated Kr-83 abundance of 4.1 + or - 1.5 per million Si atoms is within uncertainty of estimates assuming no fractionation, determined from CI-chondrite abundances of surrounding elements. This is significant because it is the first such constraint on solid/gas fractionation, though the large uncertainty only confines it to somewhat less than a factor of two.

  16. Identifying Wind and Solar Ramping Events: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Florita, A.; Hodge, B. M.; Orwig, K.

    2013-01-01

    Wind and solar power are playing an increasing role in the electrical grid, but their inherent power variability can augment uncertainties in power system operations. One solution to help mitigate the impacts and provide more flexibility is enhanced wind and solar power forecasting; however, its relative utility is also uncertain. Within the variability of solar and wind power, repercussions from large ramping events are of primary concern. At the same time, there is no clear definition of what constitutes a ramping event, with various criteria used in different operational areas. Here the Swinging Door Algorithm, originally used for data compression in trend logging, is applied to identify variable generation ramping events from historic operational data. The identification of ramps in a simple and automated fashion is a critical task that feeds into a larger work of 1) defining novel metrics for wind and solar power forecasting that attempt to capture the true impact of forecast errors on system operations and economics, and 2) informing various power system models in a data-driven manner for superior exploratory simulation research. Both allow inference on sensitivities and meaningful correlations, as well as the ability to quantify the value of probabilistic approaches for future use in practice.

  17. The Solar Wind as a Turbulence Laboratory

    Directory of Open Access Journals (Sweden)

    Vincenzo Carbone

    2013-05-01

    Full Text Available In this review we will focus on a topic of fundamental importance for both astrophysics and plasma physics, namely the occurrence of large-amplitude low-frequency fluctuations of the fields that describe the plasma state. This subject will be treated within the context of the expanding solar wind and the most meaningful advances in this research field will be reported emphasizing the results obtained in the past decade or so. As a matter of fact, Helios inner heliosphere and Ulysses' high latitude observations, recent multi-spacecrafts measurements in the solar wind (Cluster four satellites and new numerical approaches to the problem, based on the dynamics of complex systems, brought new important insights which helped to better understand how turbulent fluctuations behave in the solar wind. In particular, numerical simulations within the realm of magnetohydrodynamic (MHD turbulence theory unraveled what kind of physical mechanisms are at the basis of turbulence generation and energy transfer across the spectral domain of the fluctuations. In other words, the advances reached in these past years in the investigation of solar wind turbulence now offer a rather complete picture of the phenomenological aspect of the problem to be tentatively presented in a rather organic way.

  18. The solar wind in time: a change in the behaviour of older winds?

    Science.gov (United States)

    O'Fionnagáin, D.; Vidotto, A. A.

    2018-05-01

    In this paper, we model the wind of solar analogues at different ages to investigate the evolution of the solar wind. Recently, it has been suggested that winds of solar type stars might undergo a change in properties at old ages, whereby stars older than the Sun would be less efficient in carrying away angular momentum than what was traditionally believed. Adding to this, recent observations suggest that old solar-type stars show a break in coronal properties, with a steeper decay in X-ray luminosities and temperatures at older ages. We use these X-ray observations to constrain the thermal acceleration of winds of solar analogues. Our sample is based on the stars from the `Sun in Time' project with ages between 120 and 7000 Myr. The break in X-ray properties leads to a break in wind mass-loss rates (\\dot{M}) at roughly 2 Gyr, with \\dot{M} (t 2 Gyr) ∝ t-3.9. This steep decay in \\dot{M} at older ages could be the reason why older stars are less efficient at carrying away angular momentum, which would explain the anomalously rapid rotation observed in older stars. We also show that none of the stars in our sample would have winds dense enough to produce thermal emission above 1-2 GHz, explaining why their radio emissions have not yet been detected. Combining our models with dynamo evolution models for the magnetic field of the Earth, we find that, at early ages (≈100 Myr), our Earth had a magnetosphere that was three or more times smaller than its current size.

  19. Weather-power station. Solar energy, wind energy, water energy

    Energy Technology Data Exchange (ETDEWEB)

    Schatta, M

    1975-10-02

    A combined power station is described, which enables one to convert solar energy and wind energy into other forms of energy. The plant consists of a water-filled boiler, in which solar energy heats the water by concentration, solar cells, and finally wind rotors, which transform wind energy into electrical energy. The transformed energy is partly available as steam heat, partly as mechanical or electrical energy. The plant can be used for supplying heating systems or electrolysis equipment. Finally, by incorporating suitable motors, a mobile version of the system can be produced.

  20. ENERGY DISSIPATION PROCESSES IN SOLAR WIND TURBULENCE

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Y.; Wei, F. S.; Feng, X. S.; Sun, T. R.; Zuo, P. B. [SIGMA Weather Group, State Key Laboratory for Space Weather, National Space Science Center, Chinese Academy of Sciences, Beijing 100190 (China); Xu, X. J. [Space Science Institute, Macau University of Science and Technology, Macao (China); Zhang, J., E-mail: yw@spaceweather.ac.cn [School of Physics, Astronomy and Computational Sciences, George Mason University, 4400 University Drive, MSN 3F3, Fairfax, Virginia 22030 (United States)

    2015-12-15

    Turbulence is a chaotic flow regime filled by irregular flows. The dissipation of turbulence is a fundamental problem in the realm of physics. Theoretically, dissipation ultimately cannot be achieved without collisions, and so how turbulent kinetic energy is dissipated in the nearly collisionless solar wind is a challenging problem. Wave particle interactions and magnetic reconnection (MR) are two possible dissipation mechanisms, but which mechanism dominates is still a controversial topic. Here we analyze the dissipation region scaling around a solar wind MR region. We find that the MR region shows unique multifractal scaling in the dissipation range, while the ambient solar wind turbulence reveals a monofractal dissipation process for most of the time. These results provide the first observational evidences for intermittent multifractal dissipation region scaling around a MR site, and they also have significant implications for the fundamental energy dissipation process.

  1. Magnetosheath Propagation Time of Solar Wind Directional Discontinuities

    Science.gov (United States)

    Samsonov, A. A.; Sibeck, D. G.; Dmitrieva, N. P.; Semenov, V. S.; Slivka, K. Yu.; Å afránkova, J.; Němeček, Z.

    2018-05-01

    Observed delays in the ground response to solar wind directional discontinuities have been explained as the result of larger than expected magnetosheath propagation times. Recently, Samsonov et al. (2017, https://doi.org/10.1002/2017GL075020) showed that the typical time for a southward interplanetary magnetic field (IMF) turning to propagate across the magnetosheath is 14 min. Here by using a combination of magnetohydrodynamic simulations, spacecraft observations, and analytic calculations, we study the dependence of the propagation time on solar wind parameters and near-magnetopause cutoff speed. Increases in the solar wind speed result in greater magnetosheath plasma flow velocities, decreases in the magnetosheath thickness and, as a result, decreases in the propagation time. Increases in the IMF strength result in increases in the magnetosheath thickness and increases in the propagation time. Both magnetohydrodynamic simulations and observations suggest that propagation times are slightly smaller for northward IMF turnings. Magnetosheath flow deceleration must be taken into account when predicting the arrival times of solar wind structures at the dayside magnetopause.

  2. Theoretical contributions to solar wind research - a review

    International Nuclear Information System (INIS)

    Cuperman, S.

    1977-01-01

    The theoretical work on the solar wind phenomena done since 1958 can be divided into two main parts: Part I - development and refinement of Parker's initial macroscopic model, the emphasis being placed upon steady state, spherically symmetric flow and the identification of the structure-less background solar wind plasma with the low speed flow. It is in this part that much progress in understanding the solar wind phenomenon has been achieved; Part II - generalization of Parker's initial model such as to include microscopic (kinetic) aspects, temporal variations, deviations from spherically symmetric conditions, complex local magnetic configurations, etc. The last two aspects, in particular, have received considerable attention with the discovery of the coronal holes, their association with high-speed flows and the tentative identification of these flows with the structure-less background solar wind plasma. This review is confined to Part I, as defined above. However, for completeness, several important aspects connected with the subjects enumerated under Part II and which represent the objects of the most recent investigation are also briefly reviewed. (Auth.)

  3. A Study of the Association of Pc 3, 4 Micropulsations with Interplanetary Magnetic Field Orientation & Other Solar Wind Parameters.

    Science.gov (United States)

    1977-11-13

    Streams in the Earths’s Foreshock Appendix H. Current Investigation of the Mid-Period Geomagnetic Pulsations and Potential Use of the AFGL Network Appendix...the top, Solar Wind, Foreshock , Magnetosheath, etc., represent distinct regimes forming the plasma-physical chain linking the solar wind with the...VSW -] IMF. Foreshock Magnetosheath S V 68 I i Ii Ii I Magnetopause SR I! ! oB MP IMP Magnetosphere 3B M,6j I 9 Earth Surface IB S ....._ Symbols

  4. Latitudinal distribution of the solar wind properties in the low- and high-pressure regimes: Wind observations

    Directory of Open Access Journals (Sweden)

    C. Lacombe

    Full Text Available The solar wind properties depend on λ, the heliomagnetic latitude with respect to the heliospheric current sheet (HCS, more than on the heliographic latitude. We analyse the wind properties observed by Wind at 1 AU during about 2.5 solar rotations in 1995, a period close to the last minimum of solar activity. To determine λ, we use a model of the HCS which we fit to the magnetic sector boundary crossings observed by Wind. We find that the solar wind properties mainly depend on the modulus |λ|. But they also depend on a local parameter, the total pressure (magnetic pressure plus electron and proton thermal pressure. Furthermore, whatever the total pressure, we observe that the plasma properties also depend on the time: the latitudinal gradients of the wind speed and of the proton temperature are not the same before and after the closest HCS crossing. This is a consequence of the dynamical stream interactions. In the low pressure wind, at low |λ|, we find a clear maximum of the density, a clear minimum of the wind speed and of the proton temperature, a weak minimum of the average magnetic field strength, a weak maximum of the average thermal pressure, and a weak maximum of the average β factor. This overdense sheet is embedded in a density halo. The latitudinal thickness is about 5° for the overdense sheet, and 20° for the density halo. The HCS is thus wrapped in an overdense sheet surrounded by a halo, even in the non-compressed solar wind. In the high-pressure wind, the plasma properties are less well ordered as functions of the latitude than in the low-pressure wind; the minimum of the average speed is seen before the HCS crossing. The latitudinal thickness of the high-pressure region is about 20°. Our observations are qualitatively consistent with the numerical model of Pizzo for the deformation of the heliospheric current sheet and plasma sheet.

    Key words: Interplanetary physics (solar wind

  5. The Potential of hybrid solar-wind electricity generation in Ghana

    International Nuclear Information System (INIS)

    Tibiru, Ayirewura Vitus

    2013-07-01

    In this work the potential of harnessing electricity from solar and wind sources in Ghana is evaluated both quantitatively and qualitatively. In this regard solar, wind and other relevant data were collected (over a period of one year) from various parts of Ghana. Detailed assessment of the capacity or potential of power production from hybrid solar-wind sources is done with the use of empirical mathematical formulae and the PRO VITUS model incorporated in the 'ENERGY X' software. The various characteristics of wind, solar and available energy resources for the five locations over a one year period have been studied too. The annual mean wind speed at a height of 10 m above ground level for five locations namely Accra, Kumasi, Takoradi, Sunyani and Tamale are 2.38 ms"-"1 ± 0.05, 2.39 ms"-"1 ± 0.05, 2.38 ms"-"1 ± 0.06, 2.18 ms"-"1 ± 0.05 and 2.47 ± ms"-"1 respectively and their corresponding annual mean solar radiations are 228.71 Wm"-"2 ± 9.81, 187.69 Wm"-"2 ± 9.60, 236.58 Wm"-"2 ± 10.39, 200.99 Wm"-"2 ± 9.88 and 231.63 Wm"-"2 . Thus, the five sites hold potential for hybrid solar-wind energy exploitation. (au)

  6. Velocity fluctuations in polar solar wind: a comparison between different solar cycles

    Directory of Open Access Journals (Sweden)

    B. Bavassano

    2009-02-01

    Full Text Available The polar solar wind is a fast, tenuous and steady flow that, with the exception of a relatively short phase around the Sun's activity maximum, fills the high-latitude heliosphere. The polar wind properties have been extensively investigated by Ulysses, the first spacecraft able to perform in-situ measurements in the high-latitude heliosphere. The out-of-ecliptic phases of Ulysses cover about seventeen years. This makes possible to study heliospheric properties at high latitudes in different solar cycles. In the present investigation we focus on hourly- to daily-scale fluctuations of the polar wind velocity. Though the polar wind is a quite uniform flow, fluctuations in its velocity do not appear negligible. A simple way to characterize wind velocity variations is that of performing a multi-scale statistical analysis of the wind velocity differences. Our analysis is based on the computation of velocity differences at different time lags and the evaluation of statistical quantities (mean, standard deviation, skewness, and kurtosis for the different ensembles. The results clearly show that, though differences exist in the three-dimensional structure of the heliosphere between the investigated solar cycles, the velocity fluctuations in the core of polar coronal holes exhibit essentially unchanged statistical properties.

  7. Velocity fluctuations in polar solar wind: a comparison between different solar cycles

    Directory of Open Access Journals (Sweden)

    B. Bavassano

    2009-02-01

    Full Text Available The polar solar wind is a fast, tenuous and steady flow that, with the exception of a relatively short phase around the Sun's activity maximum, fills the high-latitude heliosphere. The polar wind properties have been extensively investigated by Ulysses, the first spacecraft able to perform in-situ measurements in the high-latitude heliosphere. The out-of-ecliptic phases of Ulysses cover about seventeen years. This makes possible to study heliospheric properties at high latitudes in different solar cycles. In the present investigation we focus on hourly- to daily-scale fluctuations of the polar wind velocity. Though the polar wind is a quite uniform flow, fluctuations in its velocity do not appear negligible. A simple way to characterize wind velocity variations is that of performing a multi-scale statistical analysis of the wind velocity differences. Our analysis is based on the computation of velocity differences at different time lags and the evaluation of statistical quantities (mean, standard deviation, skewness, and kurtosis for the different ensembles. The results clearly show that, though differences exist in the three-dimensional structure of the heliosphere between the investigated solar cycles, the velocity fluctuations in the core of polar coronal holes exhibit essentially unchanged statistical properties.

  8. 26 CFR 31.3121(b)(19)-1 - Services of certain nonresident aliens.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Services of certain nonresident aliens. 31.3121... 1954) General Provisions § 31.3121(b)(19)-1 Services of certain nonresident aliens. (a) (1) Services performed after 1961 by a nonresident alien individual who is temporarily present in the United States as a...

  9. The turbulent cascade and proton heating in the solar wind during solar minimum

    International Nuclear Information System (INIS)

    Coburn, Jesse T.; Smith, Charles W.; Vasquez, Bernard J.; Stawarz, Joshua E.; Forman, Miriam A.

    2013-01-01

    Solar wind measurements at 1 AU during the recent solar minimum and previous studies of solar maximum provide an opportunity to study the effects of the changing solar cycle on in situ heating. Our interest is to compare the levels of activity associated with turbulence and proton heating. Large-scale shears in the flow caused by transient activity are a source that drives turbulence that heats the solar wind, but as the solar cycle progresses the dynamics that drive the turbulence and heat the medium are likely to change. The application of third-moment theory to Advanced Composition Explorer (ACE) data gives the turbulent energy cascade rate which is not seen to vary with the solar cycle. Likewise, an empirical heating rate shows no significan changes in proton heating over the cycle.

  10. HEMISPHERIC ASYMMETRIES IN THE POLAR SOLAR WIND OBSERVED BY ULYSSES NEAR THE MINIMA OF SOLAR CYCLES 22 AND 23

    Energy Technology Data Exchange (ETDEWEB)

    Ebert, R. W.; Dayeh, M. A.; Desai, M. I.; McComas, D. J. [Southwest Research Institute, P.O. Drawer 28510, San Antonio, TX 78228 (United States); Pogorelov, N. V. [Physics Department, University of Alabama in Huntsville, Huntsville, AL 35899 (United States)

    2013-05-10

    We examined solar wind plasma and interplanetary magnetic field (IMF) observations from Ulysses' first and third orbits to study hemispheric differences in the properties of the solar wind and IMF originating from the Sun's large polar coronal holes (PCHs) during the declining and minimum phase of solar cycles 22 and 23. We identified hemispheric asymmetries in several parameters, most notably {approx}15%-30% south-to-north differences in averages for the solar wind density, mass flux, dynamic pressure, and energy flux and the radial and total IMF magnitudes. These differences were driven by relatively larger, more variable solar wind density and radial IMF between {approx}36 Degree-Sign S-60 Degree-Sign S during the declining phase of solar cycles 22 and 23. These observations indicate either a hemispheric asymmetry in the PCH output during the declining and minimum phase of solar cycles 22 and 23 with the southern hemisphere being more active than its northern counterpart, or a solar cycle effect where the PCH output in both hemispheres is enhanced during periods of higher solar activity. We also report a strong linear correlation between these solar wind and IMF parameters, including the periods of enhanced PCH output, that highlight the connection between the solar wind mass and energy output and the Sun's magnetic field. That these enhancements were not matched by similar sized variations in solar wind speed points to the mass and energy responsible for these increases being added to the solar wind while its flow was subsonic.

  11. HEMISPHERIC ASYMMETRIES IN THE POLAR SOLAR WIND OBSERVED BY ULYSSES NEAR THE MINIMA OF SOLAR CYCLES 22 AND 23

    International Nuclear Information System (INIS)

    Ebert, R. W.; Dayeh, M. A.; Desai, M. I.; McComas, D. J.; Pogorelov, N. V.

    2013-01-01

    We examined solar wind plasma and interplanetary magnetic field (IMF) observations from Ulysses' first and third orbits to study hemispheric differences in the properties of the solar wind and IMF originating from the Sun's large polar coronal holes (PCHs) during the declining and minimum phase of solar cycles 22 and 23. We identified hemispheric asymmetries in several parameters, most notably ∼15%-30% south-to-north differences in averages for the solar wind density, mass flux, dynamic pressure, and energy flux and the radial and total IMF magnitudes. These differences were driven by relatively larger, more variable solar wind density and radial IMF between ∼36°S-60°S during the declining phase of solar cycles 22 and 23. These observations indicate either a hemispheric asymmetry in the PCH output during the declining and minimum phase of solar cycles 22 and 23 with the southern hemisphere being more active than its northern counterpart, or a solar cycle effect where the PCH output in both hemispheres is enhanced during periods of higher solar activity. We also report a strong linear correlation between these solar wind and IMF parameters, including the periods of enhanced PCH output, that highlight the connection between the solar wind mass and energy output and the Sun's magnetic field. That these enhancements were not matched by similar sized variations in solar wind speed points to the mass and energy responsible for these increases being added to the solar wind while its flow was subsonic.

  12. A Deeper Understanding of Stability in the Solar Wind: Applying Nyquist's Instability Criterion to Wind Faraday Cup Data

    Science.gov (United States)

    Alterman, B. L.; Klein, K. G.; Verscharen, D.; Stevens, M. L.; Kasper, J. C.

    2017-12-01

    Long duration, in situ data sets enable large-scale statistical analysis of free-energy-driven instabilities in the solar wind. The plasma beta and temperature anisotropy plane provides a well-defined parameter space in which a single-fluid plasma's stability can be represented. Because this reduced parameter space can only represent instability thresholds due to the free energy of one ion species - typically the bulk protons - the true impact of instabilities on the solar wind is under estimated. Nyquist's instability criterion allows us to systematically account for other sources of free energy including beams, drifts, and additional temperature anisotropies. Utilizing over 20 years of Wind Faraday cup and magnetic field observations, we have resolved the bulk parameters for three ion populations: the bulk protons, beam protons, and alpha particles. Applying Nyquist's criterion, we calculate the number of linearly growing modes supported by each spectrum and provide a more nuanced consideration of solar wind stability. Using collisional age measurements, we predict the stability of the solar wind close to the sun. Accounting for the free-energy from the three most common ion populations in the solar wind, our approach provides a more complete characterization of solar wind stability.

  13. The solar wind neon abundance observed with ACE/SWICS and ULYSSES/SWICS

    International Nuclear Information System (INIS)

    Shearer, Paul; Raines, Jim M.; Lepri, Susan T.; Thomas, Jonathan W.; Gilbert, Jason A.; Landi, Enrico; Zurbuchen, Thomas H.; Von Steiger, Rudolf

    2014-01-01

    Using in situ ion spectrometry data from ACE/SWICS, we determine the solar wind Ne/O elemental abundance ratio and examine its dependence on wind speed and evolution with the solar cycle. We find that Ne/O is inversely correlated with wind speed, is nearly constant in the fast wind, and correlates strongly with solar activity in the slow wind. In fast wind streams with speeds above 600 km s –1 , we find Ne/O = 0.10 ± 0.02, in good agreement with the extensive polar observations by Ulysses/SWICS. In slow wind streams with speeds below 400 km s –1 , Ne/O ranges from a low of 0.12 ± 0.02 at solar maximum to a high of 0.17 ± 0.03 at solar minimum. These measurements place new and significant empirical constraints on the fractionation mechanisms governing solar wind composition and have implications for the coronal and photospheric abundances of neon and oxygen. The results are made possible by a new data analysis method that robustly identifies rare elements in the measured ion spectra. The method is also applied to Ulysses/SWICS data, which confirms the ACE observations and extends our view of solar wind neon into the three-dimensional heliosphere.

  14. The solar wind neon abundance observed with ACE/SWICS and ULYSSES/SWICS

    Energy Technology Data Exchange (ETDEWEB)

    Shearer, Paul; Raines, Jim M.; Lepri, Susan T.; Thomas, Jonathan W.; Gilbert, Jason A.; Landi, Enrico; Zurbuchen, Thomas H. [Department of Atmospheric, Oceanic, and Space Sciences, University of Michigan, Ann Arbor, MI 48109 (United States); Von Steiger, Rudolf [International Space Science Institute, Hallerstrasse 6, CH-3012 Bern (Switzerland)

    2014-07-01

    Using in situ ion spectrometry data from ACE/SWICS, we determine the solar wind Ne/O elemental abundance ratio and examine its dependence on wind speed and evolution with the solar cycle. We find that Ne/O is inversely correlated with wind speed, is nearly constant in the fast wind, and correlates strongly with solar activity in the slow wind. In fast wind streams with speeds above 600 km s{sup –1}, we find Ne/O = 0.10 ± 0.02, in good agreement with the extensive polar observations by Ulysses/SWICS. In slow wind streams with speeds below 400 km s{sup –1}, Ne/O ranges from a low of 0.12 ± 0.02 at solar maximum to a high of 0.17 ± 0.03 at solar minimum. These measurements place new and significant empirical constraints on the fractionation mechanisms governing solar wind composition and have implications for the coronal and photospheric abundances of neon and oxygen. The results are made possible by a new data analysis method that robustly identifies rare elements in the measured ion spectra. The method is also applied to Ulysses/SWICS data, which confirms the ACE observations and extends our view of solar wind neon into the three-dimensional heliosphere.

  15. Coupled Solar Wind-Magnetosphere-Ionosphere-Thermosphere System by QFT

    Science.gov (United States)

    Chen, Shao-Guang

    NM may be applied to the high-speed and the microscopic conditions. Because of the result of a test of GR with use of a hydrogen-maser frequency standard in a spacecraft launched nearly vertically upward to 10000 km (R. F. C. Vessot et.al., Phys. Rev. Lett. 45, 2081 (1980)), the isotropy of one-way velocity of light had been validated at the 1*10 (-10) level (D2.4-0030-12, H0.1-0009-12, H0.2-0008-12). Again from the Lorentz transformation (H01-0006-08) and the uncertainty principle (H05-0036-10) deduced from the metrical results of Doppler effects, SR and QM, thereby QFT and GR, all become the inferential theorems from generalized NM. Eq.(1) is as a bridge to join the modern physics and classical physics. In my paper ‘Basal electric and magnetic fields of celestial bodies come from positive-negative charge separation caused by gravitation of quasi-Casimir pressure in weak interaction’ (D31-0054-10): According to QFT the gravitation is the statistic average pressure collided by net virtual neutrinos nuν _{0} flux, the net nuν _{0} flux can press a part freedom electrons in plasma of ionosphere into the surface of celestial bodies, the static electric force of redundant positive ions prevents electrons further falling and till reach the equilibrium of stable spatial charge distribution, which is just the cause of the geomagnetic field and the geo-electric field. In the solar surface plasma add the negative charge from ionosphere electrons again rotate, thereby come into being the solar basal magnetic field. The solar surface plasma with additional electrons get the dynamic balance between the upwards force of stable positive charge distribution in the solar upside gas and the downwards force of the vacuum net nuν _{0} flux pressure (solar gravity). When the Jupiter enter into the connecting line of Sun and the center of Galaxy, the pressure (solar gravity) observed from earth will weaken because of the Jupiter stop (shield) the most net nuν _{0} flux which

  16. Dependence of the cross polar cap potential saturation on the type of solar wind streams

    OpenAIRE

    Nikolaeva, N. S.; Yermolaev, Yu. I.; Lodkina, I. G.

    2013-01-01

    We compare of the cross polar cap potential (CPCP) saturation during magnetic storms induced by various types of the solar wind drivers. By using the model of Siscoe-Hill \\citep{Hilletal1976,Siscoeetal2002a,Siscoeetal2002b,Siscoeetal2004,Siscoe2011} we evaluate criteria of the CPCP saturation during the main phases of 257 magnetic storms ($Dst_{min} \\le -50$ nT) induced by the following types of the solar wind streams: magnetic clouds (MC), Ejecta, the compress region Sheath before MC ($Sh_{M...

  17. The Yaglom law in the expanding solar wind

    International Nuclear Information System (INIS)

    Gogoberidze, G.; Perri, S.; Carbone, V.

    2013-01-01

    We study the Yaglom law, which relates the mixed third-order structure function to the average dissipation rate of turbulence, in a uniformly expanding solar wind by using the two-scale expansion model of magnetohydrodynamic (MHD) turbulence. We show that due to the expansion of the solar wind, two new terms appear in the Yaglom law. The first term is related to the decay of the turbulent energy by nonlinear interactions, whereas the second term is related to the non-zero cross-correlation of the Elsässer fields. Using magnetic field and plasma data from WIND and Helios 2 spacecrafts, we show that at lower frequencies in the inertial range of MHD turbulence the new terms become comparable to Yaglom's third-order mixed moment, and therefore they cannot be neglected in the evaluation of the energy cascade rate in the solar wind.

  18. On Lunar Exospheric Column Densities and Solar Wind Access Beyond the Terminator from ROSAT Soft X-Ray Observations of Solar Wind Charge Exchange

    Science.gov (United States)

    Collier, Michael R.; Snowden, S. L.; Sarantos, M.; Benna, M.; Carter, J. A.; Cravens, T. E.; Farrell, W. M.; Fatemi, S.; Hills, H. Kent; Hodges, R. R.; hide

    2014-01-01

    We analyze the Rontgen satellite (ROSAT) position sensitive proportional counter soft X-ray image of the Moon taken on 29 June 1990 by examining the radial profile of the surface brightness in three wedges: two 19 deg wedges (one north and one south) 13-32 deg off the terminator toward the dark side and one wedge 38 deg wide centered on the antisolar direction. The radial profiles of both the north and the south wedges show significant limb brightening that is absent in the 38 deg wide antisolar wedge. An analysis of the soft X-ray intensity increase associated with the limb brightening shows that its magnitude is consistent with that expected due to solar wind charge exchange (SWCX) with the tenuous lunar atmosphere based on lunar exospheric models and hybrid simulation results of solar wind access beyond the terminator. Soft X-ray imaging thus can independently infer the total lunar limb column density including all species, a property that before now has not been measured, and provide a large-scale picture of the solar wind-lunar interaction. Because the SWCX signal appears to be dominated by exospheric species arising from solar wind implantation, this technique can also determine how the exosphere varies with solar wind conditions. Now, along with Mars, Venus, and Earth, the Moon represents another solar system body at which SWCX has been observed.

  19. AUTOMATIC DETECTION ALGORITHM OF DYNAMIC PRESSURE PULSES IN THE SOLAR WIND

    International Nuclear Information System (INIS)

    Zuo, Pingbing; Feng, Xueshang; Wang, Yi; Xie, Yanqiong; Li, Huijun; Xu, Xiaojun

    2015-01-01

    Dynamic pressure pulses (DPPs) in the solar wind are a significant phenomenon closely related to the solar-terrestrial connection and physical processes of solar wind dynamics. In order to automatically identify DPPs from solar wind measurements, we develop a procedure with a three-step detection algorithm that is able to rapidly select DPPs from the plasma data stream and simultaneously define the transition region where large dynamic pressure variations occur and demarcate the upstream and downstream region by selecting the relatively quiet status before and after the abrupt change in dynamic pressure. To demonstrate the usefulness, efficiency, and accuracy of this procedure, we have applied it to the Wind observations from 1996 to 2008 by successfully obtaining the DPPs. The procedure can also be applied to other solar wind spacecraft observation data sets with different time resolutions

  20. Solar wind heating by an embedded quasi-isothermal pick-up ion fluid

    Directory of Open Access Journals (Sweden)

    H. J. Fahr

    Full Text Available It is well known that the solar wind plasma consists of primary ions of solar coronal origin and secondary ions of interstellar origin. Interstellar H-atoms penetrate into the inner heliosphere and when ionized there are converted into secondary ions. These are implanted into the magnetized solar wind flow and are essentially enforced to co-move with this flow. By nonlinear interactions with wind-entrained Alfvén waves the latter are processed in the co-moving velocity space. This pick-up process, however, also causes actions back upon the original solar wind flow, leading to a deceleration, as well as a heating of the solar wind plasma. The resulting deceleration is not only due to the loading effect, but also due to the action of the pressure gradient. To calculate the latter, it is important to take into account the stochastic acceleration that suffers at their convection out of the inner heliosphere by the quasi-linear interactions with MHD turbulences. Only then can the presently reported VOYAGER observations of solar wind decelerations and heatings in the outer heliosphere be understood in terms of the current, most likely values of interstellar gas parameters. In a consistent view of the thermodynamics of the solar wind plasma, which is composed of secondary ions and solar wind protons, we also derive that the latter are globally heated at their motion to larger solar distances. The arising heat transfer is due to the action of suprathermal ions which drive MHD waves that are partially absorbed by solar wind protons and thereby establish their observed quasi-polytropy. We obtain a quantitative expression for the solar wind proton pressure as a function of solar distance. This expression clearly shows the change from an adiabatic to a quasi-polytropic behaviour with a decreasing polytropic index at increasing distances, as has been observed by the VOYAGERS. This also allows one to calculate the average percentage of the intitial energy

  1. Solar wind heating by an embedded quasi-isothermal pick-up ion fluid

    Directory of Open Access Journals (Sweden)

    H. J. Fahr

    2002-10-01

    Full Text Available It is well known that the solar wind plasma consists of primary ions of solar coronal origin and secondary ions of interstellar origin. Interstellar H-atoms penetrate into the inner heliosphere and when ionized there are converted into secondary ions. These are implanted into the magnetized solar wind flow and are essentially enforced to co-move with this flow. By nonlinear interactions with wind-entrained Alfvén waves the latter are processed in the co-moving velocity space. This pick-up process, however, also causes actions back upon the original solar wind flow, leading to a deceleration, as well as a heating of the solar wind plasma. The resulting deceleration is not only due to the loading effect, but also due to the action of the pressure gradient. To calculate the latter, it is important to take into account the stochastic acceleration that suffers at their convection out of the inner heliosphere by the quasi-linear interactions with MHD turbulences. Only then can the presently reported VOYAGER observations of solar wind decelerations and heatings in the outer heliosphere be understood in terms of the current, most likely values of interstellar gas parameters. In a consistent view of the thermodynamics of the solar wind plasma, which is composed of secondary ions and solar wind protons, we also derive that the latter are globally heated at their motion to larger solar distances. The arising heat transfer is due to the action of suprathermal ions which drive MHD waves that are partially absorbed by solar wind protons and thereby establish their observed quasi-polytropy. We obtain a quantitative expression for the solar wind proton pressure as a function of solar distance. This expression clearly shows the change from an adiabatic to a quasi-polytropic behaviour with a decreasing polytropic index at increasing distances, as has been observed by the VOYAGERS. This also allows one to calculate the average percentage of the intitial energy

  2. Wind tunnel and CFD modelling of wind pressures on solar energy systems on flat roofs

    NARCIS (Netherlands)

    Bronkhorst, A.J.; Franke, J.; Geurts, C.P.W.; Bentum, van C.A.; Grepinet, F.

    2010-01-01

    Design of solar energy mounting systems requires more knowledge on the wind patterns around these systems. To obtain more insight in the flow patterns, which cause the pressure distributions on the solar energy systems, a wind tunnel test and Computational Fluid Dynamics analysis have been

  3. Wind loads on solar energy roofs

    NARCIS (Netherlands)

    Geurts, C.P.W.; Bentum, C.A. van

    2007-01-01

    This paper presents an overview of the wind loads on roofs, equipped with solar energy products, so called Active Roofs. Values given in this paper have been based on wind tunnel and full scale measurements, carried out at TNO, and on an interpretation of existing rules and guidelines. The results

  4. Solar wind power electric plant on Vis (Croatia)

    International Nuclear Information System (INIS)

    1998-01-01

    A project of a solar photovoltaic electric power plant presented by the Republic of Croatia at the meeting of the E.P.I.A. Mission for photovoltaic technology of the Mediterranean countries, aroused a great interest of the representatives of the invited countries. However, the interest within Croatia in the project has disappeared although E.P.I.A. offered a financing of two thirds of costs. There are attempts to construct 1800 kw wind-driven generators at the same location not taking into consideration a possibility of building a hybrid solar-wind-power electric plant. The chance that the solar part is completely of domestic origin is not accepted but the preference is given to the building of imported wind-driven generators. (orig.)

  5. INERTIAL RANGE TURBULENCE OF FAST AND SLOW SOLAR WIND AT 0.72 AU AND SOLAR MINIMUM

    Energy Technology Data Exchange (ETDEWEB)

    Teodorescu, Eliza; Echim, Marius; Munteanu, Costel [Institute for Space Sciences, Măgurele (Romania); Zhang, Tielong [Space Research Institute, Graz (Austria); Bruno, Roberto [INAF-IAPS, Istituto di Astrofizica e Planetologia Spaziali, Rome (Italy); Kovacs, Peter, E-mail: eliteo@spacescience.ro [Geological and Geophysical Institute of Hungary, Budapest (Hungary)

    2015-05-10

    We investigate Venus Express observations of magnetic field fluctuations performed systematically in the solar wind at 0.72 Astronomical Units (AU), between 2007 and 2009, during the deep minimum of solar cycle 24. The power spectral densities (PSDs) of the magnetic field components have been computed for time intervals that satisfy the data integrity criteria and have been grouped according to the type of wind, fast and slow, defined for speeds larger and smaller, respectively, than 450 km s{sup −1}. The PSDs show higher levels of power for the fast wind than for the slow. The spectral slopes estimated for all PSDs in the frequency range 0.005–0.1 Hz exhibit a normal distribution. The average value of the trace of the spectral matrix is −1.60 for fast solar wind and −1.65 for slow wind. Compared to the corresponding average slopes at 1 AU, the PSDs are shallower at 0.72 AU for slow wind conditions suggesting a steepening of the solar wind spectra between Venus and Earth. No significant time variation trend is observed for the spectral behavior of both the slow and fast wind.

  6. The Character of the Solar Wind, Surface Interactions, and Water

    Science.gov (United States)

    Farrell, William M.

    2011-01-01

    We discuss the key characteristics of the proton-rich solar wind and describe how it may interact with the lunar surface. We suggest that solar wind can be both a source and loss of water/OH related volatiles, and review models showing both possibilities. Energy from the Sun in the form of radiation and solar wind plasma are in constant interaction with the lunar surface. As such, there is a solar-lunar energy connection, where solar energy and matter are continually bombarding the lunar surface, acting at the largest scale to erode the surface at 0.2 Angstroms per year via ion sputtering [1]. Figure 1 illustrates this dynamically Sun-Moon system.

  7. LONG-TERM TRENDS IN THE SOLAR WIND PROTON MEASUREMENTS

    Energy Technology Data Exchange (ETDEWEB)

    Elliott, Heather A.; McComas, David J. [Southwest Research Institute, San Antonio, TX (United States); DeForest, Craig E. [Southwest Research Institute, Boulder, CO (United States)

    2016-11-20

    We examine the long-term time evolution (1965–2015) of the relationships between solar wind proton temperature ( T {sub p}) and speed ( V {sub p}) and between the proton density ( n {sub p}) and speed using OMNI solar wind observations taken near Earth. We find a long-term decrease in the proton temperature–speed ( T {sub p}– V {sub p}) slope that lasted from 1972 to 2010, but has been trending upward since 2010. Since the solar wind proton density–speed ( n {sub p}– V {sub p}) relationship is not linear like the T {sub p}– V {sub p} relationship, we perform power-law fits for n {sub p}– V {sub p}. The exponent (steepness in the n {sub p}– V {sub p} relationship) is correlated with the solar cycle. This exponent has a stronger correlation with current sheet tilt angle than with sunspot number because the sunspot number maxima vary considerably from cycle to cycle and the tilt angle maxima do not. To understand this finding, we examined the average n {sub p} for different speed ranges, and found that for the slow wind n {sub p} is highly correlated with the sunspot number, with a lag of approximately four years. The fast wind n {sub p} variation was less, but in phase with the cycle. This phase difference may contribute to the n {sub p}– V {sub p} exponent correlation with the solar cycle. These long-term trends are important since empirical formulas based on fits to T {sub p} and V {sub p} data are commonly used to identify interplanetary coronal mass ejections, but these formulas do not include any time dependence. Changes in the solar wind density over a solar cycle will create corresponding changes in the near-Earth space environment and the overall extent of the heliosphere.

  8. Solar-wind interactions with the Moon: nature and composition of nitrogen compounds

    International Nuclear Information System (INIS)

    Mukherjee, N.R.

    1981-01-01

    The lunar atmosphere and magnetic field are very tenuous. The solar wind, therefore, interacts directly with the lunar surface material and the dominant nature of interaction is essentially complete absorption of solar-wind particles by the surface material resulting in no upstream bowshock, but a cavity downstream. The solar-wind nitrogen ion species induce and undergo a complex set of reactions with the elements of lunar material and the solar-wind-derived trapped elements. The nitrogen concentration indigeneous to the lunar surface material is practically nil. Therefore any nitrogen and nitrogen compounds found in the lunar surface material are due to the solar-wind implantation of nitrogen ions. The flux of the solar-wind nitrogen ion species is about 6 X 10 3 cm -2 s -1 . Since there is no evidence for accumulation of nitrogen species in the lunar surface material, the outflux of nitrogen species from the lunar material to the atmosphere is the same as the solar-wind nitrogen ion flux. The species of the outflux are primarily NO and NH 3 , and their respective concentrations in the near surface lunar atmosphere are found to be 327 and 295 cm -3 . (Auth.)

  9. Cometary X-rays : solar wind charge exchange in cometary atmospheres

    NARCIS (Netherlands)

    Bodewits, Dennis

    2007-01-01

    The interaction of the solar wind with the planets and the interstellar medium is of key importance for the evolution of our solar system. The interaction with Earth's atmosphere is best known for the northern light. In case of Mars, the interaction with the solar wind might have lead to the erosion

  10. Air emissions due to wind and solar power.

    Science.gov (United States)

    Katzenstein, Warren; Apt, Jay

    2009-01-15

    Renewables portfolio standards (RPS) encourage large-scale deployment of wind and solar electric power. Their power output varies rapidly, even when several sites are added together. In many locations, natural gas generators are the lowest cost resource available to compensate for this variability, and must ramp up and down quickly to keep the grid stable, affecting their emissions of NOx and CO2. We model a wind or solar photovoltaic plus gas system using measured 1-min time-resolved emissions and heat rate data from two types of natural gas generators, and power data from four wind plants and one solar plant. Over a wide range of renewable penetration, we find CO2 emissions achieve approximately 80% of the emissions reductions expected if the power fluctuations caused no additional emissions. Using steam injection, gas generators achieve only 30-50% of expected NOx emissions reductions, and with dry control NOx emissions increase substantially. We quantify the interaction between state RPSs and NOx constraints, finding that states with substantial RPSs could see significant upward pressure on NOx permit prices, if the gas turbines we modeled are representative of the plants used to mitigate wind and solar power variability.

  11. Solar origins of solar wind properties during the cycle 23 solar minimum and rising phase of cycle 24

    Science.gov (United States)

    Luhmann, Janet G.; Petrie, Gordon; Riley, Pete

    2012-01-01

    The solar wind was originally envisioned using a simple dipolar corona/polar coronal hole sources picture, but modern observations and models, together with the recent unusual solar cycle minimum, have demonstrated the limitations of this picture. The solar surface fields in both polar and low-to-mid-latitude active region zones routinely produce coronal magnetic fields and related solar wind sources much more complex than a dipole. This makes low-to-mid latitude coronal holes and their associated streamer boundaries major contributors to what is observed in the ecliptic and affects the Earth. In this paper we use magnetogram-based coronal field models to describe the conditions that prevailed in the corona from the decline of cycle 23 into the rising phase of cycle 24. The results emphasize the need for adopting new views of what is ‘typical’ solar wind, even when the Sun is relatively inactive. PMID:25685422

  12. Wind Energy literature survey no. 31

    DEFF Research Database (Denmark)

    Henriksen, Lars Christian

    2014-01-01

    As a service to readers, Wind Energy regularly conducts literature surveys and publishes lists of relevant articles drawn from recent issues of Wind Energy itself and a large number of periodicals including: Journal of Wind Engineering and Industrial Aerodynamics, International Journal of Energy...... Research, Renewable Energy, Energy Sources, Journal of Solar Energy Engineering, American Institute of Aeronautics and Astronautics Journal, Electric Power Components and Systems along with a number of periodicals published by the Institute of Electrical and Electronics Engineers, and so on. The list...... is limited exclusively to journals not specifically devoted to wind energy and its applications. To assist the reader, the list is separated into broad categories. Although many papers fit several categories, each paper is listed only once under the category thought most appropriate. Please note...

  13. Analysis of ISEE-3/ICE solar wind data

    Science.gov (United States)

    Coplan, Michael A.

    1989-01-01

    Under the grant that ended November 11, 1988 work was accomplished in a number of areas, as follows: (1) Analysis of solar wind data; (2) Analysis of Giacobini/Zinner encounter data; (3) Investigation of solar wind and magnetospheric electron velocity distributions; and (4) Experimental investigation of the electronic structure of clusters. Reprints and preprints of publications resulting from this work are included in the appendices.

  14. Distributed Wind Cost Reduction: Learning from Solar

    Energy Technology Data Exchange (ETDEWEB)

    Tegen, Suzanne

    2016-02-23

    The distributed wind energy industry can learn several lessons from the solar industry regarding reducing soft costs. Suzanne Tegen presented this overview at the 2016 Distributed Wind Energy Association Business Conference in Washington, D.C., on February 23, 2016.

  15. Agua Caliente Wind/Solar Project at Whitewater Ranch

    Energy Technology Data Exchange (ETDEWEB)

    Hooks, Todd [Agua Caliente Band of Cahuilla Indians, Palm Springs, CA (United States); Stewart, Royce [Red Mountain Energy Partners, Sante Fe, NM (United States)

    2014-12-16

    Agua Caliente Band of Cahuilla Indians (ACBCI) was awarded a grant by the Department of Energy (DOE) to study the feasibility of a wind and/or solar renewable energy project at the Whitewater Ranch (WWR) property of ACBCI. Red Mountain Energy Partners (RMEP) was engaged to conduct the study. The ACBCI tribal lands in the Coachella Valley have very rich renewable energy resources. The tribe has undertaken several studies to more fully understand the options available to them if they were to move forward with one or more renewable energy projects. With respect to the resources, the WWR property clearly has excellent wind and solar resources. The DOE National Renewable Energy Laboratory (NREL) has continued to upgrade and refine their library of resource maps. The newer, more precise maps quantify the resources as among the best in the world. The wind and solar technology available for deployment is also being improved. Both are reducing their costs to the point of being at or below the costs of fossil fuels. Technologies for energy storage and microgrids are also improving quickly and present additional ways to increase the wind and/or solar energy retained for later use with the network management flexibility to provide power to the appropriate locations when needed. As a result, renewable resources continue to gain more market share. The transitioning to renewables as the major resources for power will take some time as the conversion is complex and can have negative impacts if not managed well. While the economics for wind and solar systems continue to improve, the robustness of the WWR site was validated by the repeated queries of developers to place wind and/or solar there. The robust resources and improving technologies portends toward WWR land as a renewable energy site. The business case, however, is not so clear, especially when the potential investment portfolio for ACBCI has several very beneficial and profitable alternatives.

  16. Solar and wind exergy potentials for Mars

    International Nuclear Information System (INIS)

    Delgado-Bonal, Alfonso; Martín-Torres, F. Javier; Vázquez-Martín, Sandra; Zorzano, María-Paz

    2016-01-01

    The energy requirements of the planetary exploration spacecrafts constrain the lifetime of the missions, their mobility and capabilities, and the number of instruments onboard. They are limiting factors in planetary exploration. Several missions to the surface of Mars have proven the feasibility and success of solar panels as energy source. The analysis of the exergy efficiency of the solar radiation has been carried out successfully on Earth, however, to date, there is not an extensive research regarding the thermodynamic exergy efficiency of in-situ renewable energy sources on Mars. In this paper, we analyse the obtainable energy (exergy) from solar radiation under Martian conditions. For this analysis we have used the surface environmental variables on Mars measured in-situ by the Rover Environmental Monitoring Station onboard the Curiosity rover and from satellite by the Thermal Emission Spectrometer instrument onboard the Mars Global Surveyor satellite mission. We evaluate the exergy efficiency from solar radiation on a global spatial scale using orbital data for a Martian year; and in a one single location in Mars (the Gale crater) but with an appreciable temporal resolution (1 h). Also, we analyse the wind energy as an alternative source of energy for Mars exploration and compare the results with those obtained on Earth. We study the viability of solar and wind energy station for the future exploration of Mars, showing that a small square solar cell of 0.30 m length could maintain a meteorological station on Mars. We conclude that the low density of the atmosphere of Mars is responsible of the low thermal exergy efficiency of solar panels. It also makes the use of wind energy uneffective. Finally, we provide insights for the development of new solar cells on Mars. - Highlights: • We analyse the exergy of solar radiation under Martian environment • Real data from in-situ instruments is used to determine the maximum efficiency of radiation • Wind

  17. Global solar magetic field organization in the extended corona: influence on the solar wind speed and density over the cycle.

    Science.gov (United States)

    Réville, V.; Velli, M.; Brun, S.

    2017-12-01

    The dynamics of the solar wind depends intrinsically on the structure of the global solar magnetic field, which undergoes fundamental changes over the 11yr solar cycle. For instance, the wind terminal velocity is thought to be anti-correlated with the expansion factor, a measure of how the magnetic field varies with height in the solar corona, usually computed at a fixed height (≈ 2.5 Rȯ, the source surface radius which approximates the distance at which all magnetic field lines become open). However, the magnetic field expansion affects the solar wind in a more detailed way, its influence on the solar wind properties remaining significant well beyond the source surface: we demonstrate this using 3D global MHD simulations of the solar corona, constrained by surface magnetograms over half a solar cycle (1989-2001). For models to comply with the constraints provided by observed characteristics of the solar wind, namely, that the radial magnetic field intensity becomes latitude independent at some distance from the Sun (Ulysses observations beyond 1 AU), and that the terminal wind speed is anti-correlated with the mass flux, they must accurately describe expansion beyond the solar wind critical point (even up to 10Rȯ and higher in our model). We also show that near activity minimum, expansion in the higher corona beyond 2.5 Rȯ is actually the dominant process affecting the wind speed. We discuss the consequences of this result on the necessary acceleration profile of the solar wind, the location of the sonic point and of the energy deposition by Alfvén waves.

  18. Effect of solar wind plasma parameters on space weather

    International Nuclear Information System (INIS)

    Rathore, Balveer S.; Gupta, Dinesh C.; Kaushik, Subhash C.

    2015-01-01

    Today's challenge for space weather research is to quantitatively predict the dynamics of the magnetosphere from measured solar wind and interplanetary magnetic field (IMF) conditions. Correlative studies between geomagnetic storms (GMSs) and the various interplanetary (IP) field/plasma parameters have been performed to search for the causes of geomagnetic activity and develop models for predicting the occurrence of GMSs, which are important for space weather predictions. We find a possible relation between GMSs and solar wind and IMF parameters in three different situations and also derived the linear relation for all parameters in three situations. On the basis of the present statistical study, we develop an empirical model. With the help of this model, we can predict all categories of GMSs. This model is based on the following fact: the total IMF B total can be used to trigger an alarm for GMSs, when sudden changes in total magnetic field B total occur. This is the first alarm condition for a storm's arrival. It is observed in the present study that the southward B z component of the IMF is an important factor for describing GMSs. A result of the paper is that the magnitude of B z is maximum neither during the initial phase (at the instant of the IP shock) nor during the main phase (at the instant of Disturbance storm time (Dst) minimum). It is seen in this study that there is a time delay between the maximum value of southward B z and the Dst minimum, and this time delay can be used in the prediction of the intensity of a magnetic storm two-three hours before the main phase of a GMS. A linear relation has been derived between the maximum value of the southward component of B z and the Dst, which is Dst = (−0.06) + (7.65) B z +t. Some auxiliary conditions should be fulfilled with this, for example the speed of the solar wind should, on average, be 350 km s −1 to 750 km s −1 , plasma β should be low and, most importantly, plasma temperature

  19. Solar wind flows associated with hot heavy ions

    International Nuclear Information System (INIS)

    Fenimore, E.E.

    1980-05-01

    Solar wind heavy ion spectra measured with the Vela instrumentation have been studied with the goal of determining the solar origins of various solar wind structures which contain anomalously high ionization states. Since the ionization states freeze-in close to the sun they are good indicators of the plasma conditions in the low and intermediate corona. Heavy ion spectra from three different periods throughout the solar cycle have been analyzed. These data are consistent with freezing-in temperatures ranging from approx. 1.5 x 10 6 K to higher than 9 x 10 6 . The spectra indicating hot coronal conditions occur in roughly 1/7 of all measurements and almost exclusively in postshock flows (PSFs), nonshock related helium abundance enhancements (HAEs), or noncompressive density enhancements (NCDEs). The PSFs and HAEs are both probably interplanetary manifestations of solar flares. The observation of several flare-related HAEs which were not preceded by an interplanetary shock suggests that the flare-heated plasma can evolve into the solar wind without producing a noticeable shock at 1 AU. The NCDEs with hot heavy ions differ from the PSF-HAEs in several ways implying that they evolve from events or places with lower temperatures and less energy than those associated with the flares, but with higher temperatures and densities than the quiet corona. Active regions, coronal mass ejections, and equatorial streamers are possible sources for the NCDEs with spectra indicating hot coronal conditions. These events owe their enhanced densities to coronal processes as opposed to interplanetary dynamical processes. Models of the solar wind expansion demonstrate how some NCDEs can have extreme, nonequilibrium ionization distributions

  20. Solar wind modulation of the Martian ionosphere observed by Mars Global Surveyor

    Directory of Open Access Journals (Sweden)

    J.-S. Wang

    2004-06-01

    Full Text Available Electron density profiles in the Martian ionosphere observed by the radio occultation experiment on board Mars Global Surveyor have been analyzed to determine if the densities are influenced by the solar wind. Evidence is presented that the altitude of the maximum ionospheric electron density shows a positive correlation to the energetic proton flux in the solar wind. The solar wind modulation of the Martian ionosphere can be attributed to heating of the neutral atmosphere by the solar wind energetic proton precipitation. The modulation is observed to be most prominent at high solar zenith angles. It is argued that this is consistent with the proposed modulation mechanism.

  1. Diamagnetic effect in the foremoon solar wind observed by Kaguya

    Science.gov (United States)

    Nishino, Masaki N.; Saito, Yoshifumi; Tsunakawa, Hideo; Miyake, Yohei; Harada, Yuki; Yokota, Shoichiro; Takahashi, Futoshi; Matsushima, Masaki; Shibuya, Hidetoshi; Shimizu, Hisayoshi

    2017-04-01

    Direct interaction between the lunar surface and incident solar wind is one of the crucial phenomena of the planetary plasma sciences. Recent observations by lunar orbiters revealed that strength of the interplanetary magnetic field (IMF) at spacecraft altitude often increases over crustal magnetic fields on the dayside. In addition, variations of the IMF on the lunar night side have been reported in the viewpoint of diamagnetic effect around the lunar wake. However, few studies have been performed for the IMF over non-magnetized regions on the dayside. Here we show an event where strength of the IMF decreases at 100 km altitude on the lunar dayside (i.e. in the foremoon solar wind) when the IMF is almost parallel to the incident solar wind flow, comparing the upstream solar wind data from ACE with Kaguya magnetometer data. The lunar surface below the Kaguya orbit is not magnetized (or very weakly magnetized), and the sunward-travelling protons show signatures of those back-scattered at the lunar surface. We find that the decrease in the magnetic pressure is compensated by the thermal pressure of the back-scattered protons. In other words, the IMF strength in the foremoon solar wind decreases by diamagnetic effect of sunward-travelling protons back-scattered at the lunar dayside surface. Such an effect would be prominent in the high-beta solar wind, and may be ubiquitous in the environment where planetary surface directly interacts with surrounding space plasma.

  2. Interaction of intersteller pick-up ions with the solar wind

    International Nuclear Information System (INIS)

    Mobius, E.; Klecker, B.; Hovestadt, D.; Scholer, M.

    1988-01-01

    The interaction of interstellar pick-up ions with the solar wind is studied by comparing a model for the velocity distribution function of pick-up ions with actual measurements of He + ions in the solar wind. The model includes the effects of pitch-angle diffusion due to interplanetary Alfven waves, adiabatic deceleration in the expanding solar wind and the radial variation of the source function. It is demonstrated that the scattering mean free path is in the range ≤0.1 AU and that energy diffusion can be neglected as compared with adiabatic deceleration. The effects of adiabatic focusing, of the radial variation of the neutral density and of an variation of the solar wind velocity with distance from the Sun are investigated. With the correct choice of these parameters the authors can model the measured energy spectra of the pick-up ions does not vary with the solar wind velocity and the direction of the interplanetary magnetic field for a given local neutral gas density and ionization rate. Therefore, the comparison of the model distributions with the measurements leads to a quantitative determination of the local interstellar gas density

  3. Estimated solar wind-implanted helium-3 distribution on the Moon

    Science.gov (United States)

    Johnson, J. R.; Swindle, T.D.; Lucey, P.G.

    1999-01-01

    Among the solar wind-implanted volatiles present in the lunar regolith, 3 He is possibly the most valuable resource because of its potential as a fusion fuel. The abundance of 3 He in the lunar regolith at a given location depends on surface maturity, the amount of solar wind fluence, and titanium content, because ilmenite (FeTiO3) retains helium much better than other major lunar minerals. Surface maturity and TiO2 maps from Clementine multispectral data sets are combined here with a solar wind fluence model to produce a 3He abundance map of the Moon. Comparison of the predicted 3He values to landing site observations shows good correlation. The highest 3He abundances occur in the farside maria (due to greater solar wind fluence received) and in higher TiO2 nearside mare regions.

  4. Electron heat flux instabilities in the solar wind

    International Nuclear Information System (INIS)

    Gary, S.P.; Feldman, W.C.; Forslund, D.W.; Montgomery, M.D.

    1975-01-01

    There are at least three plasma instabilities associated with the electron heat flux in the solar wind. This letter reports the study of the unstable fast magnetosonic, Alfven and whistler modes via a computer code which solves the full electromagnetic, linear, Vlasov dispersion relation. Linear theory demonstrates that both the magnetosonic and Alfven instabilities are candidates for turbulent limitation of the heat flux in the solar wind at 1 A.U

  5. The effect of asymmetric solar wind on the Lyman α sky background

    International Nuclear Information System (INIS)

    Joselyn, J.A.; Holzer, T.E.

    1975-01-01

    The Lyman α (Ly α) sky background arises from the scattering of solar Ly α from a spatial distribution of neutral hydrogen in interplanetary space. This distribution is partially determined by the solar wind proton flux, which provides the principal mechanism of loss by charge exchange of the neutral hydrogen. By generating isophotal maps of scattered Ly α for several choices of interstellar wind direction and solar wind proton flux distributions, the results show that latitudinal variations of the solar wind proton flux can have a significant effect on the observed location and shape of the Ly α intensity maximum. This fact should aid in the interpretation of Ly α maps and also indicates a possible method for inferring values for the average solar wind proton flux out of the ecliptic plane

  6. Preferred solar wind emitting longitudes on the sun

    International Nuclear Information System (INIS)

    Gosling, J.T.; Asbridge, J.R.; Bame, S.J.; Feldman, W.C.

    1977-01-01

    During the 11 1/2-year period from July 1964 through December 1975, high- and low-speed solar wind flows originated from preferred solar longitudes. The preferred longitude effect was most pronounced from 1970 onward but was also evident in the years preceding 1970. The most pronounced modulation in average solar wind speed with longitude (approximately 20%) was obtained when it was assumed that the synodic rotation period of the sun is 27.025 days. Some deep internal structure in the sun must ultmately be responsible for these long-lived longitudinal effects, which appear to rotate rigidly with the sun

  7. Multicriteria GIS modeling of wind and solar farms in Colorado

    Energy Technology Data Exchange (ETDEWEB)

    Janke, Jason R. [Metropolitan State College of Denver, Department of Earth and Atmospheric Sciences, CB 22 P.O. Box 173362-22, Denver, CO 80217-3362 (United States)

    2010-10-15

    The majority of electricity and heat in Colorado comes from coal and natural gas; however, renewable energy sources will play an integral role in the state's energy future. Colorado is the 11th windiest state and has more than 250 sunny days per year. The objectives of this research are to: 1) determine which landcover classes are affiliated with high wind and solar potential; and 2) identify areas that are suitable for wind and solar farms using multicriteria GIS modelling techniques. Renewable potential (NREL wind speed measurements at 50 m above the ground and NREL annual insolation data), landcover, population density, federal lands, and distance to roads, transmission lines, and cities were reclassified according to their suitability. Each was assigned weights based on their relative importance to one another. Superb wind classes are located in high alpine areas. Unfortunately, these areas are not suitable for large-scale wind farm development due to their inaccessibility and location within a sensitive ecosystem. Federal lands have low wind potential. According to the GIS model, ideal areas for wind farm development are located in northeastern Colorado. About 41 850 km{sup 2} of the state has model scores that are in the 90-100% range. Although annual solar radiation varies slightly, inter-mountain areas receive the most insolation. As far as federal lands, Indian reservations have the greatest solar input. The GIS model indicates that ideal areas for solar development are located in northwestern Colorado and east of Denver. Only 191 km{sup 2} of the state had model scores that were in the 90-100% range. These results suggest that the variables used in this analysis have more of an effect at eliminating non-suitable areas for large-scale solar farms; a greater area exists for suitable wind farms. However, given the statewide high insolation values with minimal variance, solar projects may be better suited for small-scale residential or commercial

  8. Cause of solar wind speed variations observed at 1 a.u

    International Nuclear Information System (INIS)

    Hakamada, K.; Akasofu, S.

    1981-01-01

    An attempt is made to interpret solar wind variations observed at the earth's distance, namely the solar cycle variations, the semi-annual variations, and the 27-day variations, as well as the polarity changes of the interplanetary magnetic field, mainly in terms of two effects, a positive latitudinal gradient of the solar wind speed and a wobbling solar dipole, combined with the annual (heliospheric) latitudinal excursion of the earth. It is shown that a significant part of the solar wind variations observed at the earth's distance and the changes of polarity pattern of the interplanetary magnetic field can be reasonably well reproduced by the two effects

  9. Potential for Development of Solar and Wind Resource in Bhutan

    Energy Technology Data Exchange (ETDEWEB)

    Gilman, P.; Cowlin, S.; Heimiller, D.

    2009-09-01

    With support from the U.S. Agency for International Development (USAID), the U.S. Department of Energy's National Renewable Energy Laboratory (NREL) produced maps and data of the wind and solar resources in Bhutan. The solar resource data show that Bhutan has an adequate resource for flat-plate collectors, with annual average values of global horizontal solar radiation ranging from 4.0 to 5.5 kWh/m2-day (4.0 to 5.5 peak sun hours per day). The information provided in this report may be of use to energy planners in Bhutan involved in developing energy policy or planning wind and solar projects, and to energy analysts around the world interested in gaining an understanding of Bhutan's wind and solar energy potential.

  10. RELATIVE CONTRIBUTION OF THE MAGNETIC FIELD BARRIER AND SOLAR WIND SPEED IN ICME-ASSOCIATED FORBUSH DECREASES

    International Nuclear Information System (INIS)

    Bhaskar, Ankush; Vichare, Geeta; Subramanian, Prasad

    2016-01-01

    We study 50 cosmic-ray Forbush decreases (FDs) from the Oulu neutron monitor data during 1997–2005 that were associated with Earth-directed interplanetary coronal mass ejections (ICMEs). Such events are generally thought to arise due to the shielding of cosmic rays by a propagating diffusive barrier. The main processes at work are the diffusion of cosmic rays across the large-scale magnetic fields carried by the ICME and their advection by the solar wind. In an attempt to better understand the relative importance of these effects, we analyze the relationship between the FD profiles and those of the interplanetary magnetic field (B) and the solar wind speed (V sw ). Over the entire duration of a given FD, we find that the FD profile is generally (anti)correlated with the B and V sw profiles. This trend holds separately for the FD main and recovery phases too. For the recovery phases, however, the FD profile is highly anti-correlated with the V sw profile, but not with the B profile. While the total duration of the FD profile is similar to that of the V sw profile, it is significantly longer than that of the B profile. Using the convection–diffusion model, a significant contribution of advection by solar wind is found during the recovery phases of the FD.

  11. RELATIVE CONTRIBUTION OF THE MAGNETIC FIELD BARRIER AND SOLAR WIND SPEED IN ICME-ASSOCIATED FORBUSH DECREASES

    Energy Technology Data Exchange (ETDEWEB)

    Bhaskar, Ankush; Vichare, Geeta [Indian Institute of Geomagnetism, Kalamboli Highway, New Panvel, Navi Mumbai 410218 (India); Subramanian, Prasad, E-mail: ankushbhaskar@gmail.com [Indian Institute of Science Education and Research, Dr. Homi Bhabha Road, Pashan, Pune 411008 (India)

    2016-09-10

    We study 50 cosmic-ray Forbush decreases (FDs) from the Oulu neutron monitor data during 1997–2005 that were associated with Earth-directed interplanetary coronal mass ejections (ICMEs). Such events are generally thought to arise due to the shielding of cosmic rays by a propagating diffusive barrier. The main processes at work are the diffusion of cosmic rays across the large-scale magnetic fields carried by the ICME and their advection by the solar wind. In an attempt to better understand the relative importance of these effects, we analyze the relationship between the FD profiles and those of the interplanetary magnetic field (B) and the solar wind speed (V {sub sw}). Over the entire duration of a given FD, we find that the FD profile is generally (anti)correlated with the B and V {sub sw} profiles. This trend holds separately for the FD main and recovery phases too. For the recovery phases, however, the FD profile is highly anti-correlated with the V {sub sw} profile, but not with the B profile. While the total duration of the FD profile is similar to that of the V {sub sw} profile, it is significantly longer than that of the B profile. Using the convection–diffusion model, a significant contribution of advection by solar wind is found during the recovery phases of the FD.

  12. Solar Energetic Particles (SEP) and Galactic Cosmic Rays (GCR) as tracers of solar wind conditions near Saturn: Event lists and applications

    Science.gov (United States)

    Roussos, E.; Jackman, C. M.; Thomsen, M. F.; Kurth, W. S.; Badman, S. V.; Paranicas, C.; Kollmann, P.; Krupp, N.; Bučík, R.; Mitchell, D. G.; Krimigis, S. M.; Hamilton, D. C.; Radioti, A.

    2018-01-01

    measurements can be used to provide the phase of CIRs at Saturn. We further demonstrate the utility of our survey results by determining that: (a) Magnetospheric convection induced by solar wind disturbances associated with SEPs is a necessary driver for the formation of transient radiation belts that were observed throughout Saturn's magnetosphere on several occasions during 2005 and on day 105 of 2012. (b) An enhanced solar wind perturbation period that is connected to an SEP of day 332/2013 was the definite source of a strong magnetospheric compression which led to open flux loading in the magnetotail. Finally, we propose how the event lists can define the basis for single case studies or statistical investigations on how Saturn and its moons (particularly Titan) respond to extreme solar wind conditions or on the transport of SEPs and GCRs in the heliosphere.

  13. Dawn-dusk asymmetry in particles of solar wind origin within the magnetosphere

    Directory of Open Access Journals (Sweden)

    T. J. Stubbs

    Full Text Available Solar wind/magnetosheath plasma in the magnetosphere can be identified using a component that has a higher charge state, lower density and, at least soon after their entry into the magnetosphere, lower energy than plasma from a terrestrial source. We survey here observations taken over 3 years of He2+ ions made by the Magnetospheric Ion Composition Sensor (MICS of the Charge and Mass Magnetospheric Ion Composition Experiment (CAMMICE instrument aboard POLAR. The occurrence probability of these solar wind ions is then plotted as a function of Magnetic Local Time (MLT and invariant latitude (7 for various energy ranges. For all energies observed by MICS (1.8–21.4 keV and all solar wind conditions, the occurrence probabilities peaked around the cusp region and along the dawn flank. The solar wind conditions were filtered to see if this dawnward asymmetry is controlled by the Svalgaard-Mansurov effect (and so depends on the BY component of the interplanetary magnetic field, IMF or by Fermi acceleration of He2+ at the bow shock (and so depends on the IMF ratio BX /BY . It is shown that the asymmetry remained persistently on the dawn flank, suggesting it was not due to effects associated with direct entry into the magnetosphere. This asymmetry, with enhanced fluxes on the dawn flank, persisted for lower energy ions (below a "cross-over" energy of about 23 keV but reversed sense to give higher fluxes on the dusk flank at higher energies. This can be explained by the competing effects of gradient/curvature drifts and the convection electric field on ions that are convecting sunward on re-closed field lines. The lower-energy He2+ ions E × B drift dawnwards as they move earthward, whereas the higher energy ions curvature/ gradient drift towards dusk. The convection electric field in the tail is weaker for

  14. Application of Power Systems Economics to Wind and Solar Power Integration

    OpenAIRE

    Mills, Andrew David

    2015-01-01

    The focus of this dissertation is the economic implications of the technical challenges of integrating variable generation, namely wind and solar, into the electric power system. The research is organized around three topics: short-term variability of wind and solar generation, changes in the economic value of wind and solar with increasing penetration, and the effectiveness of different measures at mitigating changes in economic value with increasing penetration levels. Early studies of PV g...

  15. 26 CFR 31.3302(b)-1 - Additional credit against tax.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Additional credit against tax. 31.3302(b)-1... credit against tax. (a) In general. In addition to the credit against the tax allowable for contributions... credit allowable against the tax for such year shall be the aggregate of the additional credits allowable...

  16. Ulysses solar wind plasma observations at high southerly latitudes.

    Science.gov (United States)

    Phillips, J L; Bame, S J; Feldman, W C; Gosling, J T; Hammond, C M; McComas, D J; Goldstein, B E; Neugebauer, M; Scime, E E; Suess, S T

    1995-05-19

    Solar wind plasma observations made by the Ulysses spacecraft through -80.2 degrees solar latitude and continuing equatorward to -40.1 degrees are summarized. Recurrent high-speed streams and corotating interaction regions dominated at middle latitudes. The speed of the solar wind was typically 700 to 800 kilometers per second poleward of -35 degrees . Corotating reverse shocks persisted farther south than did forward shocks because of the tilt of the heliomagnetic streamer belt. Sporadic coronal mass ejections were seen as far south as -60.5 degrees . Proton temperature was higher and the electron strahl was broader at higher latitudes. The high-latitude wind contained compressional, pressure-balanced, and Alfvénic structures.

  17. Formation of Heliospheric Arcs of Slow Solar Wind

    Energy Technology Data Exchange (ETDEWEB)

    Higginson, A. K.; Zurbuchen, T. H. [Department of Climate and Space Sciences and Engineering, University of Michigan, Ann Arbor, MI 48109 (United States); Antiochos, S. K.; DeVore, C. R. [Heliophysics Science Division, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Wyper, P. F., E-mail: aleida@umich.edu [Department of Mathematical Sciences, Durham University, Durham DH1 3LE (United Kingdom)

    2017-05-01

    A major challenge in solar and heliospheric physics is understanding the origin and nature of the so-called slow solar wind. The Sun’s atmosphere is divided into magnetically open regions, known as coronal holes, where the plasma streams out freely and fills the solar system, and closed regions, where the plasma is confined to coronal loops. The boundary between these regions extends outward as the heliospheric current sheet (HCS). Measurements of plasma composition strongly imply that much of the slow wind consists of plasma from the closed corona that escapes onto open field lines, presumably by field-line opening or by interchange reconnection. Both of these processes are expected to release closed-field plasma into the solar wind within and immediately adjacent to the HCS. Mysteriously, however, slow wind with closed-field plasma composition is often observed in situ far from the HCS. We use high-resolution, three-dimensional, magnetohydrodynamic simulations to calculate the dynamics of a coronal hole with a geometry that includes a narrow corridor flanked by closed field and is driven by supergranule-like flows at the coronal-hole boundary. These dynamics produce giant arcs of closed-field plasma that originate at the open-closed boundary in the corona, but extend far from the HCS and span tens of degrees in latitude and longitude at Earth. We conclude that such structures can account for the long-puzzling slow-wind observations.

  18. Design of Hybrid Solar and Wind Energy Harvester for Fishing Boat

    Science.gov (United States)

    Banjarnahor, D. A.; Hanifan, M.; Budi, E. M.

    2017-07-01

    In southern beach of West Java, Indonesia, there are many villagers live as fishermen. They use small boats for fishing, in one to three days. Therefore, they need a fish preservation system. Fortunately, the area has high potential of solar and wind energy. This paper presents the design of a hybrid solar and wind energy harvester to power a refrigerator in the fishing boat. The refrigerator should keep the fish in 2 - 4 °C. The energy needed is 720 Wh daily. In the area, the daily average wind velocity is 4.27 m/s and the sun irradiation is 672 W/m2. The design combined two 100W solar panels and a 300W wind turbine. The testing showed that the solar panels can harvest 815 - 817 Wh of energy, while the wind turbine can harvest 43 - 62 Wh of energy daily. Therefore, the system can fulfil the energy requirement in fishing boat, although the solar panels were more dominant. To install the wind turbine on the fishing-boat, a computational design had been conducted. The boat hydrostatic dimension was measured to determine its stability condition. To reach a stable equilibrium condition, the wind turbine should be installed no more than 1.7 m of height.

  19. Beyond Solar-B: MTRAP, the Magnetic TRAnsition Region Probe

    Science.gov (United States)

    Davis, J. M.; Moore, R. L.; Hathaway, D. H.; Science Definition CommitteeHigh-Resolution Solar Magnetography Beyond Solar-B Team

    2003-05-01

    The next generation of solar missions will reveal and measure fine-scale solar magnetic fields and their effects in the solar atmosphere at heights, small scales, sensitivities, and fields of view well beyond the reach of Solar-B. The necessity for, and potential of, such observations for understanding solar magnetic fields, their generation in and below the photosphere, and their control of the solar atmosphere and heliosphere, were the focus of a science definition workshop, "High-Resolution Solar Magnetography from Space: Beyond Solar-B," held in Huntsville Alabama in April 2001. Forty internationally prominent scientists active in solar research involving fine-scale solar magnetism participated in this Workshop and reached consensus that the key science objective to be pursued beyond Solar-B is a physical understanding of the fine-scale magnetic structure and activity in the magnetic transition region, defined as the region between the photosphere and corona where neither the plasma nor the magnetic field strongly dominates the other. The observational objective requires high cadence (x 16K pixels) with high QE at 150 nm, and extendable spacecraft structures. The Science Organizing Committee of the Beyond Solar-B Workshop recommends that: 1. Science and Technology Definition Teams should be established in FY04 to finalize the science requirements and to define technology development efforts needed to ensure the practicality of MTRAP's observational goals. 2. The necessary technology development funding should be included in Code S budgets for FY06 and beyond to prepare MTRAP for a new start no later than the nominal end of the Solar-B mission, around 2010.

  20. CHARACTERIZATION OF TRANSITIONS IN THE SOLAR WIND PARAMETERS

    International Nuclear Information System (INIS)

    Perri, S.; Balogh, A.

    2010-01-01

    The distinction between fast and slow solar wind streams and the dynamically evolved interaction regions is reflected in the characteristic fluctuations of both the solar wind and the embedded magnetic field. High-resolution magnetic field data from the Ulysses spacecraft have been analyzed. The observations show rapid variations in the magnetic field components and in the magnetic field strength, suggesting a structured nature of the solar wind at small scales. The typical sizes of fluctuations cover a broad range. If translated to the solar surface, the scales span from the size of granules (∼10 3 km) and supergranules (∼10 4 km) on the Sun down to ∼10 2 km and less. The properties of the short time structures change in the different types of solar wind. While fluctuations in fast streams are more homogeneous, slow streams present a bursty behavior in the magnetic field variances, and the regions of transition are characterized by high levels of power in narrow structures around the transitions. The probability density functions of the magnetic field increments at several scales reveal a higher level of intermittency in the mixed streams, which is related to the presence of well localized features. It is concluded that, apart from the differences in the nature of fluctuations in flows of different coronal origin, there is a small-scale structuring that depends on the origin of streams themselves but it is also related to a bursty generation of the fluctuations.

  1. A hybrid reconfigurable solar and wind energy system

    Science.gov (United States)

    Gadkari, Sagar A.

    We study the feasibility of a novel hybrid solar-wind hybrid system that shares most of its infrastructure and components. During periods of clear sunny days the system will generate electricity from the sun using a parabolic concentrator. The concentrator is formed by individual mirror elements and focuses the light onto high intensity vertical multi-junction (VMJ) cells. During periods of high wind speeds and at night, the same concentrator setup will be reconfigured to channel the wind into a wind turbine which will be used to harness wind energy. In this study we report on the feasibility of this type of solar/wind hybrid energy system. The key mechanisms; optics, cooling mechanism of VMJ cells and air flow through the system were investigated using simulation tools. The results from these simulations, along with a simple economic analysis giving the levelized cost of energy for such a system are presented. An iterative method of design refinement based on the simulation results was used to work towards a prototype design. The levelized cost of the system achieved in the economic analysis shows the system to be a good alternative for a grid isolated site and could be used as a standalone system in regions of lower demand. The new approach to solar wind hybrid system reported herein will pave way for newer generation of hybrid systems that share common infrastructure in addition to the storage and distribution of energy.

  2. Solar Wind Associated with Near Equatorial Coronal Hole M ...

    Indian Academy of Sciences (India)

    2015-05-25

    May 25, 2015 ... coronal hole and solar wind. For both the wavelength bands, we also com- pute coronal hole radiative energy near the earth and it is found to be of similar order as that of solar wind energy. However, for the wavelength. 193 Å, owing to almost similar magnitudes of energy emitted by coronal hole and ...

  3. Heating of Solar Wind Ions via Cyclotron Resonance

    Science.gov (United States)

    Navarro, R.; Moya, P. S.; Figueroa-Vinas, A.; Munoz, V.; Valdivia, J. A.

    2017-12-01

    Remote and in situ observations in the solar wind show that ion and electron velocity distributions persistently deviate from thermal equilibrium in the form of relative streaming between species components, temperature anisotropy, etc. These non-thermal features represent a source of free energy for the excitation of kinetic instabilities and fluctuations in the plasma. In this regard, it is believed that plasma particles can be heated, through a second order Fermi acceleration process, by multiple resonances with unstable counter-propagating field-aligned Ion-cyclotron waves. For multi-species plasmas, several collective wave modes participate in this process. In this work, we test this model by studying the percentage of ions that resonate with the waves modes described by the proper kinetic multi-species dispersion relation in a solar-wind-like plasma composed of electrons, protons, and alpha particles. Numerical results are compared with WIND spacecraft data to test its relevance for the existence of thresholds for the preferential perpendicular heating of He+2 ions as observed in the solar wind fast streams.

  4. Contribution of Strong Discontinuities to the Power Spectrum of the Solar Wind

    International Nuclear Information System (INIS)

    Borovsky, Joseph E.

    2010-01-01

    Eight and a half years of magnetic field measurements (2 22 samples) from the ACE spacecraft in the solar wind at 1 A.U. are analyzed. Strong (large-rotation-angle) discontinuities in the solar wind are collected and measured. An artificial time series is created that preserves the timing and amplitudes of the discontinuities. The power spectral density of the discontinuity series is calculated and compared with the power spectral density of the solar-wind magnetic field. The strong discontinuities produce a power-law spectrum in the ''inertial subrange'' with a spectral index near the Kolmogorov -5/3 index. The discontinuity spectrum contains about half of the power of the full solar-wind magnetic field over this ''inertial subrange.'' Warnings are issued about the significant contribution of discontinuities to the spectrum of the solar wind, complicating interpretation of spectral power and spectral indices.

  5. An analytical investigation: Effect of solar wind on lunar photoelectron sheath

    Science.gov (United States)

    Mishra, S. K.; Misra, Shikha

    2018-02-01

    The formation of a photoelectron sheath over the lunar surface and subsequent dust levitation, under the influence of solar wind plasma and continuous solar radiation, has been analytically investigated. The photoelectron sheath characteristics have been evaluated using the Poisson equation configured with population density contributions from half Fermi-Dirac distribution of the photoemitted electrons and simplified Maxwellian statistics of solar wind plasma; as a consequence, altitude profiles for electric potential, electric field, and population density within the photoelectron sheath have been derived. The expression for the accretion rate of sheath electrons over the levitated spherical particles using anisotropic photoelectron flux has been derived, which has been further utilized to characterize the charging of levitating fine particles in the lunar sheath along with other constituent photoemission and solar wind fluxes. This estimate of particle charge has been further manifested with lunar sheath characteristics to evaluate the altitude profile of the particle size exhibiting levitation. The inclusion of solar wind flux into analysis is noticed to reduce the sheath span and altitude of the particle levitation; the dependence of the sheath structure and particle levitation on the solar wind plasma parameters has been discussed and graphically presented.

  6. Kinetic Properties of Solar Wind Silicon and Iron Ions

    Science.gov (United States)

    Janitzek, N. P.; Berger, L.; Drews, C.; Wimmer-Schweingruber, R. F.

    2017-12-01

    Heavy ions with atomic numbers Z>2 account for less than one percent of the solar wind ions. However, serving as test particles with differing mass and charge, they provide a unique experimental approach to major questions of solar and fundamental plasma physics such as coronal heating, the origin and acceleration of the solar wind and wave-particle interaction in magnetized plasma. Yet the low relative abundances of the heavy ions pose substantial challenges to the instrumentation measuring these species with reliable statistics and sufficient time resolution. As a consequence the numbers of independent measurements and studies are small. The Charge Time-Of-Flight (CTOF) mass spectrometer as part of the Charge, ELement and Isotope Analysis System (CELIAS) onboard the SOlar and Heliospheric Observatory (SOHO) is a linear time-of-flight mass spectrometer which was operated at Lagrangian point L1 in 1996 for a few months only, before it suffered an instrument failure. Despite its short operation time, the CTOF sensor measured solar wind heavy ions with excellent charge state separation, an unprecedented cadence of 5 minutes and very high counting statistics, exceeding similar state-of-the-art instruments by a factor of ten. In contrast to earlier CTOF studies which were based on reduced onboard post-processed data, in our current studies we use raw Pulse Height Analysis (PHA) data providing a significantly increased mass, mass-per-charge and velocity resolution. Focussing on silicon and iron ion measurements, we present an overview of our findings on (1) short time behavior of heavy ion 1D radial velocity distribution functions, (2) differential streaming between heavy ions and solar wind bulk protons, (3) kinetic temperatures of heavy ions. Finally, we compare the CTOF results with measurements of the Solar Wind Ion Composition Spectrometer (SWICS) instrument onboard the Advanced Composition Explorer (ACE).

  7. Detection of fast nanoparticles in the solar wind

    International Nuclear Information System (INIS)

    Meyer-Vernet, N.; Maksimovic, M.; Lecacheux, A.; Le Chat, G.; Czechowski, A.; Mann, I.; Goetz, K.; Kaiser, M. L.; Cyr, O. C. St.; Bale, S. D.

    2010-01-01

    Dust grains in the nanometer range bridge the gap between atoms and larger grains made of bulk material. Their small size embodies them with special properties. Due to their high relative surface area, they have a high charge-to-mass ratio, so that the Lorentz force in the solar wind magnetic field exceeds the gravitational force and other forces by a large amount, and they are accelerated to a speed of the order of magnitude of the solar wind speed. When such fast nanoparticles impact a spacecraft, they produce craters whose matter vaporises and ionises, yielding transient voltages as high as do much larger grains of smaller speed. These properties are at the origin of their recent detection at 1 AU in the solar wind. We discuss the detection of fast nanoparticles by wave instruments of different configurations, with applications to the recent detections on STEREO/WAVES and CASSINI/RPWS. Finally we discuss the opportunities for nanoparticle detection by wave instruments on future missions and/or projects in the inner heliosphere such as Bepi-Colombo and Solar Orbiter.

  8. Global Solar Magnetic Field Organization in the Outer Corona: Influence on the Solar Wind Speed and Mass Flux Over the Cycle

    Science.gov (United States)

    Réville, Victor; Brun, Allan Sacha

    2017-11-01

    The dynamics of the solar wind depends intrinsically on the structure of the global solar magnetic field, which undergoes fundamental changes over the 11-year solar cycle. For instance, the wind terminal velocity is thought to be anti-correlated with the expansion factor, a measure of how the magnetic field varies with height in the solar corona, usually computed at a fixed height (≈ 2.5 {R}⊙ , the source surface radius that approximates the distance at which all magnetic field lines become open). However, the magnetic field expansion affects the solar wind in a more detailed way, its influence on the solar wind properties remaining significant well beyond the source surface. We demonstrate this using 3D global magnetohydrodynamic (MHD) simulations of the solar corona, constrained by surface magnetograms over half a solar cycle (1989-2001). A self-consistent expansion beyond the solar wind critical point (even up to 10 {R}⊙ ) makes our model comply with observed characteristics of the solar wind, namely, that the radial magnetic field intensity becomes latitude independent at some distance from the Sun, and that the mass flux is mostly independent of the terminal wind speed. We also show that near activity minimum, the expansion in the higher corona has more influence on the wind speed than the expansion below 2.5 {R}⊙ .

  9. Voyager observations of solar wind proton temperature - 1-10 AU

    Science.gov (United States)

    Gazis, P. R.; Lazarus, A. J.

    1982-01-01

    Simultaneous measurements are made of the solar wind proton temperatures by the Voyager 1 and 2 spacecraft, far from earth, and the IMP 8 spacecraft in earth orbit. This technique permits a separation of radial and temporal variations of solar wind parameters. The average value of the proton temperature between 1 and 9 AU is observed to decrease as r (the heliocentric radius) to the -(0.7 + or - 0.2). This is slower than would be expected for adiabatic expansion. A detailed examination of the solar wind stream structure shows that considerable heating occurs at the interface between high and low speed streams.

  10. Predicting Ionization Rates from SEP and Solar Wind Proton Precipitation into the Martian Atmosphere

    Science.gov (United States)

    Jolitz, R.; Dong, C.; Lee, C. O.; Curry, S.; Lillis, R. J.; Brain, D.; Halekas, J. S.; Larson, D. E.; Bougher, S. W.; Jakosky, B. M.

    2017-12-01

    Precipitating energetic particles ionize planetary atmospheres and increase total electron content. At Mars, the solar wind and solar energetic particles (SEPs) can precipitate directly into the atmosphere because solar wind protons can charge exchange to become neutrals and pass through the magnetosheath, while SEPs are sufficiently energetic to cross the magnetosheath unchanged. In this study we will present predicted ionization rates and resulting electron densities produced by solar wind and SEP proton ionization during nominal solar activity and a CME shock front impact event on May 16 2016. We will use the Atmospheric Scattering of Protons and Energetic Neutrals (ASPEN) model to compare ionization by SEP and solar wind protons currently measured by the SWIA (Solar Wind Ion Analyzer) and SEP instruments aboard the MAVEN spacecraft. Results will help to quantify how the ionosphere responds to extreme solar events during solar minimum.

  11. Self consistent MHD modeling of the solar wind from polar coronal holes

    International Nuclear Information System (INIS)

    Stewart, G. A.; Bravo, S.

    1996-01-01

    We have developed a 2D self consistent MHD model for solar wind flow from antisymmetric magnetic geometries. We present results in the case of a photospheric magnetic field which has a dipolar configuration, in order to investigate some of the general characteristics of the wind at solar minimum. As in previous studies, we find that the magnetic configuration is that of a closed field region (a coronal helmet belt) around the solar equator, extending up to about 1.6 R · , and two large open field regions centred over the poles (polar coronal holes), whose magnetic and plasma fluxes expand to fill both hemispheres in interplanetary space. In addition, we find that the different geometries of the magnetic field lines across each hole (from the almost radial central polar lines to the highly curved border equatorial lines) cause the solar wind to have greatly different properties depending on which region it flows from. We find that, even though our simplified model cannot produce realistic wind values, we can obtain a polar wind that is faster, less dense and hotter than equatorial wind, and found that, close to the Sun, there exists a sharp transition between the two wind types. As these characteristics coincide with observations we conclude that both fast and slow solar wind can originate from coronal holes, fast wind from the centre, slow wind from the border

  12. The influence of solar active region evolution on solar wind streams, coronal hole boundaries and geomagnetic storms

    International Nuclear Information System (INIS)

    Gold, R.E.; Dodson-Prince, H.W.; Hedeman, E.R.; Roelof, E.C.

    1982-01-01

    We have studied solar and interplanetary data by identification of the heliographic longitudes of the coronal source regions of high speed solar wind streams and by mapping the velocities measured near earth back to the sun using the approximation of constant radial velocity. Interplay of active regions and solar wind were studied

  13. On the influence of the magnetization of a model solar wind on a laboratory magnetosphere

    International Nuclear Information System (INIS)

    Rahman, H.U.; Yur, G.; White, R.S.; Birn, J.; Wessel, F.J.

    1991-01-01

    The interaction of a magnetized plasma beam with a stationary dipole field, analogous to the interaction of the solar wind with the Earth's magnetosphere, is explored in a laboratory experiment. Experimental parameters are chosen to scale qualitatively similar to the parameters in the Earth's magnetosphere. The authors find that the magnetization of the laboratory solar wind, generated by injecting a plasma across a preexisting magnetic field, requires a certain minimum magnetic field strength. Differences between the resulting magnetospheres for northward and southward solar wind or interplanetary magnetic fields (IMF) are demonstrated by global pictures and by magnetic field measurements above the north polar region. These measurements show patterns of the variation of the transverse field component which are similar to those found by satellite measurements above the Earth. This indicates the presence of similar field-aligned current systems. They demonstrate particularly the presence (for northward IMF) and absence (for southward IMF) of the pattern attributed to the NBZ (northward B z ) current system

  14. Long-term solar wind electron variations between 1971 and 1978

    International Nuclear Information System (INIS)

    Feldman, W.C.; Asbridge, J.R.; Bame, S.J.; Gosling, J.T.

    1979-01-01

    Imp solar wind electron data measured between 1971 and 1978 were studied with the aim of determining long-term variations near the earth. Two separate sets of parameter variations were observed: (1) in 1976--1977 the solar wind density, the electron temperature, and the interplanetary electrostatic potential were all enhanced, and (2) the halo density and associated electron parameters were all depressed during a 1 1/2-year period centered on the last 6 months of 1976. Although interpretation of these results in terms of corresponding coronal and interplanetary variations is not unique, it may be significant that measured solar wind parameters near the minimum of solar cycle 20 agree better with the Hartle-Sturrock model of the coronal expansion than they do during other epochs

  15. A model for the origin of solar wind stream interfaces

    International Nuclear Information System (INIS)

    Hundhausen, A.J.; Burlaga, L.F.

    1975-01-01

    The basic variations in solar wind properties that have been observed at 'stream interfaces' near 1 AU are explained by a gas dynamic model in which a radially propagating stream, produced by a temperature variation in the solar envelope, steepens nonlinearly while moving through interplanetary space. The region thus identified with the stream interface separates the ambient solar wind from the fresh hot material originally in the stream. However, the interface regions given by the present model are thicker than most stream interfaces observed in the solar wind, a fact suggesting that some additional physical process may be important in determining that thickness. Variations in the density, speed, or Alfven pressure alone appear not to produce streams with such an interface

  16. Plasma depletion layer: its dependence on solar wind conditions and the Earth dipole tilt

    Directory of Open Access Journals (Sweden)

    Y. L. Wang

    2004-12-01

    Full Text Available The plasma depletion layer (PDL is a layer on the sunward side of the magnetopause with lower plasma density and higher magnetic field compared to their corresponding upstream magnetosheath values. It is believed that the PDL is controlled jointly by conditions in the solar wind plasma and the (IMF. In this study, we extend our former model PDL studies by systematically investigating the dependence of the PDL and the slow mode front on solar wind conditions using global MHD simulations. We first point out the difficulties for the depletion factor method and the plasma β method for defining the outer boundary of the plasma depletion layer. We propose to use the N/B ratio to define the PDL outer boundary, which can give the best description of flux tube depletion. We find a strong dependence of the magnetosheath environment on the solar wind magnetosonic Mach number. A difference between the stagnation point and the magnetopause derived from the open-closed magnetic field boundary is found. We also find a strong and complex dependence of the PDL and the slow mode front on the IMF Bz. A density structure right inside the subsolar magnetopause for higher IMF Bz;might be responsible for some of this dependence. Both the IMF tilt and clock angles are found to have little influence on the magnetosheath and the PDL structures. However, the IMF geometry has a much stronger influence on the slow mode fronts in the magnetosheath. Finally, the Earth dipole tilt is found to play a minor role for the magnetosheath geometry and the PDL along the Sun-Earth line. A complex slow mode front geometry is found for cases with different Earth dipole tilts. Comparisons between our results with those from some former studies are conducted, and consistencies and inconsistencies are found.

    Key words. Magnetospheric physics (magnetosheath, solar wind-magnetosphere interactions – Space plasma physics (numerical

  17. Implications of the Deep Minimum for Slow Solar Wind Origin

    Science.gov (United States)

    Antiochos, S. K.; Mikic, Z.; Lionello, R.; Titov, V. S.; Linker, J. A.

    2009-12-01

    The origin of the slow solar wind has long been one of the most important problems in solar/heliospheric physics. Two observational constraints make this problem especially challenging. First, the slow wind has the composition of the closed-field corona, unlike the fast wind that originates on open field lines. Second, the slow wind has substantial angular extent, of order 30 degrees, which is much larger than the widths observed for streamer stalks or the widths expected theoretically for a dynamic heliospheric current sheet. We propose that the slow wind originates from an intricate network of narrow (possibly singular) open-field corridors that emanate from the polar coronal hole regions. Using topological arguments, we show that these corridors must be ubiquitous in the solar corona. The total solar eclipse in August 2008, near the lowest point of the Deep Minimum, affords an ideal opportunity to test this theory by using the ultra-high resolution Predictive Science's (PSI) eclipse model for the corona and wind. Analysis of the PSI eclipse model demonstrates that the extent and scales of the open-field corridors can account for both the angular width of the slow wind and its closed-field composition. We discuss the implications of our slow wind theory for the structure of the corona and heliosphere at the Deep Minimum and describe further observational and theoretical tests. This work has been supported by the NASA HTP, SR&T, and LWS programs.

  18. Evolution of the solar wind acceleration region during 1990-1994

    International Nuclear Information System (INIS)

    Tokumaru, Munetoshi; Kondo, Tetsuro; Takaba, Hiroshi; Mori, Hirotaka; Tanaka, Takashi

    1996-01-01

    The single-station measurements of interplanetary scintillation (IPS) at 2GHz and 8GHz using the Kashima radio telescope are used to study the distribution of the solar wind velocity and density fluctuations near the sun. Wind velocities derived from our IPS data with the IPS co-spectrum method show a radial increase in the distance range between 10 and 30 Rs (solar radii). From the scintillation index analysis, it is found that the radial fall of density fluctuations in the solar wind is described by the power-law function. A series of Kashima IPS observations reveals that a pronounced change in velocity and turbulence level occurs at the polar region of the sun during 1990-1994. That is, the high-speed wind and the reduced-turbulence region develop there as the solar activity declines. This fact is consistent with the long-term evolution of the coronal magnetic structure inferred from He1083nm observations

  19. Saturn radio emission and the solar wind - Voyager-2 studies

    International Nuclear Information System (INIS)

    Desch, M.D.; Rucker, H.O.; Observatorium Lustbuhel, Graz, Austria)

    1985-01-01

    Voyager 2 data from the Plasma Science experiment, the Magnetometer experiment and the Planetary Radio Astronomy experiment were used to analyze the relationship between parameters of the solar wind/interplanetary medium and the nonthermal Saturn radiation. Solar wind and interplanetary magnetic field properties were combined to form quantities known to be important in controlling terrestrial magnetospheric processes. The Voyager 2 data set used in this investigation consists of 237 days of Saturn preencounter measurements. However, due to the immersion of Saturn and the Voyager 2 spacecraft into the extended Jupiter magnetic tail, substantial periods of the time series were lacking solar wind data. To cope with this problem a superposed epoch method (CHREE analysis) was used. The results indicate the superiority of the quantities containing the solar wind density in stimulating the radio emission of Saturn - a result found earlier using Voyager 1 data - and the minor importance of quantities incorporating the interplanetary magnetic field. 10 references

  20. Solar wind reconstruction from magnetosheath data using an adjoint approach

    International Nuclear Information System (INIS)

    Nabert, C.; Othmer, C.

    2015-01-01

    We present a new method to reconstruct solar wind conditions from spacecraft data taken during magnetosheath passages, which can be used to support, e.g., magnetospheric models. The unknown parameters of the solar wind are used as boundary conditions of an MHD (magnetohydrodynamics) magnetosheath model. The boundary conditions are varied until the spacecraft data matches the model predictions. The matching process is performed using a gradient-based minimization of the misfit between data and model. To achieve this time-consuming procedure, we introduce the adjoint of the magnetosheath model, which allows efficient calculation of the gradients. An automatic differentiation tool is used to generate the adjoint source code of the model. The reconstruction method is applied to THEMIS (Time History of Events and Macroscale Interactions during Substorms) data to calculate the solar wind conditions during spacecraft magnetosheath transitions. The results are compared to actual solar wind data. This allows validation of our reconstruction method and indicates the limitations of the MHD magnetosheath model used.

  1. Solar wind reconstruction from magnetosheath data using an adjoint approach

    Energy Technology Data Exchange (ETDEWEB)

    Nabert, C.; Othmer, C. [Technische Univ. Braunschweig (Germany). Inst. fuer Geophysik und extraterrestrische Physik; Glassmeier, K.H. [Technische Univ. Braunschweig (Germany). Inst. fuer Geophysik und extraterrestrische Physik; Max Planck Institute for Solar System Research, Goettingen (Germany)

    2015-07-01

    We present a new method to reconstruct solar wind conditions from spacecraft data taken during magnetosheath passages, which can be used to support, e.g., magnetospheric models. The unknown parameters of the solar wind are used as boundary conditions of an MHD (magnetohydrodynamics) magnetosheath model. The boundary conditions are varied until the spacecraft data matches the model predictions. The matching process is performed using a gradient-based minimization of the misfit between data and model. To achieve this time-consuming procedure, we introduce the adjoint of the magnetosheath model, which allows efficient calculation of the gradients. An automatic differentiation tool is used to generate the adjoint source code of the model. The reconstruction method is applied to THEMIS (Time History of Events and Macroscale Interactions during Substorms) data to calculate the solar wind conditions during spacecraft magnetosheath transitions. The results are compared to actual solar wind data. This allows validation of our reconstruction method and indicates the limitations of the MHD magnetosheath model used.

  2. ANALYSING SOLAR-WIND HYBRID POWER GENERATING SYSTEM

    Directory of Open Access Journals (Sweden)

    Mustafa ENGİN

    2005-02-01

    Full Text Available In this paper, a solar-wind hybrid power generating, system that will be used for security lighting was designed. Hybrid system was installed and solar cells, wind turbine, battery bank, charge regulators and inverter performance values were measured through the whole year. Using measured values of overall system efficiency, reliability, demanded energy cost per kWh were calculated, and percentage of generated energy according to resources were defined. We also include in the paper a discussion of new strategies to improve hybrid power generating system performance and demanded energy cost per kWh.

  3. Costs of solar and wind power variability for reducing CO2 emissions.

    Science.gov (United States)

    Lueken, Colleen; Cohen, Gilbert E; Apt, Jay

    2012-09-04

    We compare the power output from a year of electricity generation data from one solar thermal plant, two solar photovoltaic (PV) arrays, and twenty Electric Reliability Council of Texas (ERCOT) wind farms. The analysis shows that solar PV electricity generation is approximately one hundred times more variable at frequencies on the order of 10(-3) Hz than solar thermal electricity generation, and the variability of wind generation lies between that of solar PV and solar thermal. We calculate the cost of variability of the different solar power sources and wind by using the costs of ancillary services and the energy required to compensate for its variability and intermittency, and the cost of variability per unit of displaced CO(2) emissions. We show the costs of variability are highly dependent on both technology type and capacity factor. California emissions data were used to calculate the cost of variability per unit of displaced CO(2) emissions. Variability cost is greatest for solar PV generation at $8-11 per MWh. The cost of variability for solar thermal generation is $5 per MWh, while that of wind generation in ERCOT was found to be on average $4 per MWh. Variability adds ~$15/tonne CO(2) to the cost of abatement for solar thermal power, $25 for wind, and $33-$40 for PV.

  4. Predicting Atmospheric Ionization and Excitation by Precipitating SEP and Solar Wind Protons Measured By MAVEN

    Science.gov (United States)

    Jolitz, Rebecca; Dong, Chuanfei; Lee, Christina; Lillis, Rob; Brain, David; Curry, Shannon; Halekas, Jasper; Bougher, Stephen W.; Jakosky, Bruce

    2017-10-01

    Precipitating energetic particles ionize and excite planetary atmospheres, increasing electron content and producing aurora. At Mars, the solar wind and solar energetic particles (SEPs) can precipitate directly into the atmosphere because solar wind protons can charge exchange to become neutral and pass the magnetosheath, and SEPs are sufficiently energetic to cross the magnetosheath unchanged. We will compare ionization and Lyman alpha emission rates for solar wind and SEP protons during nominal solar activity and a CME shock front impact event on May 16 2016. We will use the Atmospheric Scattering of Protons and Energetic Neutrals (ASPEN) model to compare excitation and ionization rates by SEPs and solar wind protons currently measured by the SWIA (Solar Wind Ion Analyzer) and SEP instruments aboard the MAVEN spacecraft. Results will help quantify how SEP and solar wind protons influence atmospheric energy deposition during solar minimum.

  5. Effects of the Solar Wind Pressure on Mercury's Exosphere: Hybrid Simulations

    Science.gov (United States)

    Travnicek, P. M.; Schriver, D.; Orlando, T. M.; Hellinger, P.

    2017-12-01

    We study effects of the changed solar wind pressure on the precipitation of hydrogen on the Mercury's surface and on the formation of Mercury's magnetosphere. We carry out a set of global hybrid simulations of the Mercury's magnetosphere with the interplanetary magnetic field oriented in the equatorial plane. We change the solar wind pressure by changing the velocity of injected solar wind plasma (vsw = 2 vA,sw; vsw = 4 vA,sw; vsw = 6 vA,sw). For each of the cases we examine proton and electron precipitation on Mercury's surface and calculate yields of heavy ions released from Mercury's surface via various processes (namely: Photo-Stimulated Desorption, Solar Wind Sputtering, and Electron Stimulated Desorption). We study circulation of the released ions within the Mercury's magnetosphere for the three cases.

  6. Coronal mass ejections and disturbances in solar wind plasma parameters in relation with geomagnetic storms

    International Nuclear Information System (INIS)

    Verma, P L; Singh, Puspraj; Singh, Preetam

    2014-01-01

    Coronal Mass Ejections (CMEs) are the drastic solar events in which huge amount of solar plasma materials are ejected into the heliosphere from the sun and are mainly responsible to generate large disturbances in solar wind plasma parameters and geomagnetic storms in geomagnetic field. We have studied geomagnetic storms, (Dst ≤-75 nT) observed during the period of 1997-2007 with Coronal Mass Ejections and disturbances in solar wind plasma parameters (solar wind temperature, velocity, density and interplanetary magnetic field) .We have inferred that most of the geomagnetic storms are associated with halo and partial halo Coronal Mass Ejections (CMEs).The association rate of halo and partial halo coronal mass ejections are found 72.37 % and 27.63 % respectively. Further we have concluded that geomagnetic storms are closely associated with the disturbances in solar wind plasma parameters. We have determined positive co-relation between magnitudes of geomagnetic storms and magnitude of jump in solar wind plasma temperature, jump in solar wind plasma density, jump in solar wind plasma velocity and jump in average interplanetary magnetic field with co-relation co-efficient 0 .35 between magnitude of geomagnetic storms and magnitude of jump in solar wind plasma temperature, 0.19 between magnitude of geomagnetic storms and magnitude of jump in solar wind density, 0.34 between magnitude of geomagnetic storms and magnitude of jump in solar wind plasma velocity, 0.66 between magnitude of geomagnetic storms and magnitude of jump in average interplanetary magnetic field respectively. We have concluded that geomagnetic storms are mainly caused by Coronal Mass Ejections and disturbances in solar wind plasma parameters that they generate.

  7. A 15N-poor isotopic composition for the solar system as shown by Genesis solar wind samples.

    Science.gov (United States)

    Marty, B; Chaussidon, M; Wiens, R C; Jurewicz, A J G; Burnett, D S

    2011-06-24

    The Genesis mission sampled solar wind ions to document the elemental and isotopic compositions of the Sun and, by inference, of the protosolar nebula. Nitrogen was a key target element because the extent and origin of its isotopic variations in solar system materials remain unknown. Isotopic analysis of a Genesis Solar Wind Concentrator target material shows that implanted solar wind nitrogen has a (15)N/(14)N ratio of 2.18 ± 0.02 × 10(-3) (that is, ≈40% poorer in (15)N relative to terrestrial atmosphere). The (15)N/(14)N ratio of the protosolar nebula was 2.27 ± 0.03 × 10(-3), which is the lowest (15)N/(14)N ratio known for solar system objects. This result demonstrates the extreme nitrogen isotopic heterogeneity of the nascent solar system and accounts for the (15)N-depleted components observed in solar system reservoirs.

  8. Turbulence in the solar wind

    CERN Document Server

    Bruno, Roberto

    2016-01-01

    This book provides an overview of solar wind turbulence from both the theoretical and observational perspective. It argues that the interplanetary medium offers the best opportunity to directly study turbulent fluctuations in collisionless plasmas. In fact, during expansion, the solar wind evolves towards a state characterized by large-amplitude fluctuations in all observed parameters, which resembles, at least at large scales, the well-known hydrodynamic turbulence. This text starts with historical references to past observations and experiments on turbulent flows. It then introduces the Navier-Stokes equations for a magnetized plasma whose low-frequency turbulence evolution is described within the framework of the MHD approximation. It also considers the scaling of plasma and magnetic field fluctuations and the study of nonlinear energy cascades within the same framework. It reports observations of turbulence in the ecliptic and at high latitude, treating Alfvénic and compressive fluctuations separately in...

  9. NEMO 2 - Be aware: Wind and solar are coming

    Energy Technology Data Exchange (ETDEWEB)

    Lund, P. [Helsinki Univ. of Technology, Otaniemi (Finland)

    1996-12-31

    Finnish research and development is well placed with respect to new renewable energy technologies in that there exists considerable expertise in specialized areas. For example, over 20 % of all power transmission equipment and generators used in wind energy systems world-wide are manufactured in Finland, while advanced instruments for monitoring wind speed are also highly regarded internationally. Moreover, unique wind technology for complex windy and freezing conditions have been developed. Finland has a 10 % share in the European photovoltaic market, and has competitive advantages in photovoltaic systems and applications, thin film solar cells, and automated electronic controlling systems. A unique solar energy storage system based on hydrogen technology demonstrates skills on overcoming the summer-winter syndrome of large-scale solar energy utilization. The annual turnover of the Finnish industries on solar and wind energy has increased from 5 million ECU in 1988 to almost 50 million ECU in 1996. The national R and D and D from 1988 onwards has played an important role in this context. Most of the research and development into new and renewable energy technologies in Finland has been carried out through the Advanced New Energy Systems and Technologies Research Programme (NEMO2) of Tekes

  10. Solar wind dynamic pressure variations and transient magnetospheric signatures

    International Nuclear Information System (INIS)

    Sibeck, D.G.; Baumjohann, W.

    1989-01-01

    Contrary to the prevailing popular view, we find some transient ground events with bipolar north-south signatures are related to variations in solar wind dynamic pressure and not necessarily to magnetic merging. We present simultaneous solar wind plasma observations for two previously reported transient ground events observed at dayside auroral latitudes. During the first event, originally reported by Lanzerotti et al. [1987], conjugate ground magnetometers recorded north-south magetic field deflections in the east-west and vertical directions. The second event was reported by Todd et al. [1986], we noted ground rader observations indicating strong northward then southward ionospheric flows. The events were associated with the postulated signatures of patchy, sporadic, merging of magnetosheath and magnetospheric magnetic field lines at the dayside magnetospause, known as flux transfer events. Conversely, we demonstrate that the event reported by Lanzerotti et al. was accompanied by a sharp increase in solar wind dynamic pressure, a magnetospheric compression, and a consequent ringing of the magnetospheric magnetic field. The event reported by Todd et al. was associated with a brief but sharp increase in the solar wind dynamic pressure. copyright American Geophysical Union 1989

  11. Proton fire hose instabilities in the expanding solar wind

    Czech Academy of Sciences Publication Activity Database

    Hellinger, Petr

    2017-01-01

    Roč. 83, č. 1 (2017), č. článku 705830105. ISSN 0022-3778 Institutional support: RVO:68378289 Keywords : astrophysicals plasmas * plasma expansion * plasma simulation Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics) Impact factor: 1.160, year: 2016 https://www.cambridge.org/ core /journals/journal-of-plasma-physics/article/proton-fire-hose-instabilities-in-the-expanding-solar-wind/6BA70378B25728533588A1A68073AC2F

  12. The 3-D solar radioastronomy and the structure of the corona and the solar wind. [solar probes of solar activity

    Science.gov (United States)

    Steinberg, J. L.; Caroubalos, C.

    1976-01-01

    The mechanism causing solar radio bursts (1 and 111) is examined. It is proposed that a nonthermal energy source is responsible for the bursts; nonthermal energy is converted into electromagnetic energy. The advantages are examined for an out-of-the-ecliptic solar probe mission, which is proposed as a means of stereoscopically viewing solar radio bursts, solar magnetic fields, coronal structure, and the solar wind.

  13. ULF Wave Activity in the Magnetosphere: Resolving Solar Wind Interdependencies to Identify Driving Mechanisms

    Science.gov (United States)

    Bentley, S. N.; Watt, C. E. J.; Owens, M. J.; Rae, I. J.

    2018-04-01

    Ultralow frequency (ULF) waves in the magnetosphere are involved in the energization and transport of radiation belt particles and are strongly driven by the external solar wind. However, the interdependency of solar wind parameters and the variety of solar wind-magnetosphere coupling processes make it difficult to distinguish the effect of individual processes and to predict magnetospheric wave power using solar wind properties. We examine 15 years of dayside ground-based measurements at a single representative frequency (2.5 mHz) and a single magnetic latitude (corresponding to L ˜ 6.6RE). We determine the relative contribution to ULF wave power from instantaneous nonderived solar wind parameters, accounting for their interdependencies. The most influential parameters for ground-based ULF wave power are solar wind speed vsw, southward interplanetary magnetic field component Bzstill account for significant amounts of power. We suggest that these three parameters correspond to driving by the Kelvin-Helmholtz instability, formation, and/or propagation of flux transfer events and density perturbations from solar wind structures sweeping past the Earth. We anticipate that this new parameter reduction will aid comparisons of ULF generation mechanisms between magnetospheric sectors and will enable more sophisticated empirical models predicting magnetospheric ULF power using external solar wind driving parameters.

  14. Observations of micro-turbulence in the solar wind near the sun with interplanetary scintillation

    Science.gov (United States)

    Yamauchi, Y.; Misawa, H.; Kojima, M.; Mori, H.; Tanaka, T.; Takaba, H.; Kondo, T.; Tokumaru, M.; Manoharan, P. K.

    1995-01-01

    Velocity and density turbulence of solar wind were inferred from interplanetary scintillation (IPS) observations at 2.3 GHz and 8.5 GHz using a single-antenna. The observations were made during September and October in 1992 - 1994. They covered the distance range between 5 and 76 solar radii (Rs). We applied the spectrum fitting method to obtain a velocity, an axial ratio, an inner scale and a power-law spectrum index. We examined the difference of the turbulence properties near the Sun between low-speed solar wind and high-speed solar wind. Both of solar winds showed acceleration at the distance range of 10 - 30 Rs. The radial dependence of anisotropy and spectrum index did not have significant difference between low-speed and high-speed solar winds. Near the sun, the radial dependence of the inner scale showed the separation from the linear relation as reported by previous works. We found that the inner scale of high-speed solar wind is larger than that of low-speed wind.

  15. GPP Webinar: Market Outlook and Innovations in Wind and Solar Power

    Science.gov (United States)

    Green Power Partnership webinar reviewing the state of the renewable energy industry as a whole, with a focus on wind and solar power and exploring recent marketplace innovations in wind and solar power and renewable energy purchases.

  16. Solar-wind system powers mountain clean-up

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-03-01

    By using a hybrid solar-wind system, the Japanese have tackled the problem of human excrement left by tourists in mountain lodges and in natural parks by installing flush toilets and wastewater treatment plants. The solar array (4.9 kW{sub p}) consists of 76 panels of single-crystal photovoltaic cells each with an output of 64 Wp. The wind turbines (total capacity 2.1 kW) operate whatever the wind strength or direction. Storage batteries prevent any dip in power which would result from low ambient temperatures. The system can still function at temperatures as low as minus 25{sup o}C. Between November and April when the lodge is closed, the waste is decomposed biologically. A block diagram shows the elements of the system, and details of cost are given. The system won the 1999 New Energy Award.

  17. Enhancing information for solar and wind energy technology deployment in Brazil

    Energy Technology Data Exchange (ETDEWEB)

    Ramos Martins, Fernando, E-mail: fernando.martins@inpe.br [Centro de Ciencia do Sistema Terrestre-Instituto Nacisonal de Pesquisas Espaciais (Earth System Center-National Institute for Space Research), P.O. Box 515, 12245-970, Sao Jose dos Campos (Brazil); Pereira, Enio Bueno, E-mail: enio.pereira@inpe.br [Centro de Ciencia do Sistema Terrestre-Instituto Nacisonal de Pesquisas Espaciais (Earth System Center-National Institute for Space Research), P.O. Box 515, 12245-970, Sao Jose dos Campos (Brazil)

    2011-07-15

    Brazil's primary energy matrix is based on more than 47% of renewables, and more than 85% of its electricity is generated by hydro power sources. Despite this large fraction of renewable energy resources, less than 0.3% of the national energy supply comes from solar or wind sources. This paper presents a diagnostic review on the penetration of the solar and wind energy technologies in Brazil. It also includes a survey of the latest government policies and incentives for renewable energies deployment by entrepreneurs, industry and commercial and residential consumers. In addition, the paper analyses how to best meet the requirements for policy support and information technology to boost the deployment of solar technology and wind energy in Brazil. This study was mostly based on results of a widely distributed survey covering key issues, and also by personal interviews carried out with key stakeholders in order to better understand the issues highlighted in the survey responses. The study pointed out some of the main obstacles to effectively promote and improve government policies and actions for investment in solar and wind energy market in Brazil. - Highlights: > Current status on the solar and wind energy deployment in Brazil is presented. > Policy framework required to support solar and wind energy was discussed. > Study was based on responses for consultations with key stakeholders. > Worthiness Index was established to rank the stakeholders outlooks. > Energy price, human resources and tax reductions were indicated as priority.

  18. Enhancing information for solar and wind energy technology deployment in Brazil

    International Nuclear Information System (INIS)

    Ramos Martins, Fernando; Pereira, Enio Bueno

    2011-01-01

    Brazil's primary energy matrix is based on more than 47% of renewables, and more than 85% of its electricity is generated by hydro power sources. Despite this large fraction of renewable energy resources, less than 0.3% of the national energy supply comes from solar or wind sources. This paper presents a diagnostic review on the penetration of the solar and wind energy technologies in Brazil. It also includes a survey of the latest government policies and incentives for renewable energies deployment by entrepreneurs, industry and commercial and residential consumers. In addition, the paper analyses how to best meet the requirements for policy support and information technology to boost the deployment of solar technology and wind energy in Brazil. This study was mostly based on results of a widely distributed survey covering key issues, and also by personal interviews carried out with key stakeholders in order to better understand the issues highlighted in the survey responses. The study pointed out some of the main obstacles to effectively promote and improve government policies and actions for investment in solar and wind energy market in Brazil. - Highlights: → Current status on the solar and wind energy deployment in Brazil is presented. → Policy framework required to support solar and wind energy was discussed. → Study was based on responses for consultations with key stakeholders. → Worthiness Index was established to rank the stakeholders outlooks. → Energy price, human resources and tax reductions were indicated as priority.

  19. Analysis of off-grid hybrid wind turbine/solar PV water pumping systems

    Science.gov (United States)

    While many remote water pumping systems exist (e.g. mechanical windmills, solar photovoltaic , wind-electric, diesel powered), very few combine both the wind and solar energy resources to possibly improve the reliability and the performance of the system. In this paper, off-grid wind turbine (WT) a...

  20. The Solar Wind as a Turbulence Laboratory

    Directory of Open Access Journals (Sweden)

    Bruno Roberto

    2005-09-01

    Full Text Available In this review we will focus on a topic of fundamental importance for both plasma physics and astrophysics, namely the occurrence of large-amplitude low-frequency fluctuations of the fields that describe the plasma state. This subject will be treated within the context of the expanding solar wind and the most meaningful advances in this research field will be reported emphasizing the results obtained in the past decade or so. As a matter of fact, Ulysses’ high latitude observations and new numerical approaches to the problem, based on the dynamics of complex systems, brought new important insights which helped to better understand how turbulent fluctuations behave in the solar wind. In particular, numerical simulations within the realm of magnetohydrodynamic (MHD turbulence theory unraveled what kind of physical mechanisms are at the basis of turbulence generation and energy transfer across the spectral domain of the fluctuations. In other words, the advances reached in these past years in the investigation of solar wind turbulence now offer a rather complete picture of the phenomenological aspect of the problem to be tentatively presented in a rather organic way.

  1. Construction of Solar-Wind-Like Magnetic Fields

    Science.gov (United States)

    Roberts, Dana Aaron

    2012-01-01

    Fluctuations in the solar wind fields tend to not only have velocities and magnetic fields correlated in the sense consistent with Alfven waves traveling from the Sun, but they also have the magnitude of the magnetic field remarkably constant despite their being broadband. This paper provides, for the first time, a method for constructing fields with nearly constant magnetic field, zero divergence, and with any specified power spectrum for the fluctuations of the components of the field. Every wave vector, k, is associated with two polarizations the relative phases of these can be chosen to minimize the variance of the field magnitude while retaining the\\random character of the fields. The method is applied to a case with one spatial coordinate that demonstrates good agreement with observed time series and power spectra of the magnetic field in the solar wind, as well as with the distribution of the angles of rapid changes (discontinuities), thus showing a deep connection between two seemingly unrelated issues. It is suggested that using this construction will lead to more realistic simulations of solar wind turbulence and of the propagation of energetic particles.

  2. Solar wind fluctuations at large scale: A comparison between low and high solar activity conditions

    International Nuclear Information System (INIS)

    Bavassano, B.; Bruno, R.

    1991-01-01

    The influence of the Sun's activity cycle on the solar wind fluctuations at time scales from 1 hour to 3 days in the inner heliosphere (0.3 to 1 AU) is investigated. Hourly averages of plasma and magnetic field data by Helios spacecraft are used. Since fluctuations behave quite differently with changing scale, the analysis is performed separately for two different ranges in time scale. Between 1 and 6 hours Alfvenic fluctuations and pressure-balanced structures are extensively observed. At low solar activity and close to 0.3 AU, Alfvenic fluctuations are more frequent than pressure-balanced structures. This predominance, however, weakens for rising solar activity and radial distance, to the point that a role exchange, in terms of occurrence rate, is found at the maximum of the cycle close to 1 AU. On the other hand, in all cases Alfvenic fluctuations have a larger amplitude than pressure-balanced structures. On the whole, the Alfvenic contribution to the solar wind energy spectrum comes out to be dominant at all solar activity conditions. At scales from 0.5 to 3 days the most important feature is the growth, as the solar wind expansion develops, of strong positive correlations between magnetic and thermal pressures. These structures are progressively built up by the interaction between different wind flows. This effect is more pronounced at low than at high activity. Our findings support the conclusion that the solar cycle evolution of the large-scale velocity pattern is the factor governing the observed variations

  3. Solar power. [comparison of costs to wind, nuclear, coal, oil and gas

    Science.gov (United States)

    Walton, A. L.; Hall, Darwin C.

    1990-01-01

    This paper describes categories of solar technologies and identifies those that are economic. It compares the private costs of power from solar, wind, nuclear, coal, oil, and gas generators. In the southern United States, the private costs of building and generating electricity from new solar and wind power plants are less than the private cost of electricity from a new nuclear power plant. Solar power is more valuable than nuclear power since all solar power is available during peak and midpeak periods. Half of the power from nuclear generators is off-peak power and therefore is less valuable. Reliability is important in determining the value of wind and nuclear power. Damage from air pollution, when factored into the cost of power from fossil fuels, alters the cost comparison in favor of solar and wind power. Some policies are more effective at encouraging alternative energy technologies that pollute less and improve national security.

  4. Thermodynamic characteristics of a novel wind-solar-liquid air energy storage system

    Science.gov (United States)

    Ji, W.; Zhou, Y.; Sun, Y.; Zhang, W.; Pan, C. Z.; Wang, J. J.

    2017-12-01

    Due to the nature of fluctuation and intermittency, the utilization of wind and solar power will bring a huge impact to the power grid management. Therefore a novel hybrid wind-solar-liquid air energy storage (WS-LAES) system was proposed. In this system, wind and solar power are stored in the form of liquid air by cryogenic liquefaction technology and thermal energy by solar thermal collector, respectively. Owing to the high density of liquid air, the system has a large storage capacity and no geographic constraints. The WS-LAES system can store unstable wind and solar power for a stable output of electric energy and hot water. Moreover, a thermodynamic analysis was carried out to investigate the best system performance. The result shows that the increases of compressor adiabatic efficiency, turbine inlet pressure and inlet temperature all have a beneficial effect.

  5. Solar wind acceleration in coronal holes

    International Nuclear Information System (INIS)

    Kopp, R.A.

    1978-01-01

    Past attempts to explain the large solar wind velocities in high speed streams by theoretical models of the expansion have invoked either extended nonthermal heating of the corona, heat flux inhibition, or direct addition of momentum to the expanding coronal plasma. Several workers have shown that inhibiting the heat flux at low coronal densities is probably not adequate to explain quantitatively the observed plasma velocities in high speed streams. It stressed that, in order to account for both these large plasma velocities and the low densities found in coronal holes (from which most high speed streams are believed to emanate), extended heating by itself will not suffice. One needs a nonthermal mechanism to provide the bulk acceleration of the high wind plasma close to the sun, and the most likely candidate at present is direct addition of the momentum carried by outward-propagating waves to the expanding corona. Some form of momentum addition appears to be absolutely necessary if one hopes to build quantitatively self-consistent models of coronal holes and high speed solar wind streams

  6. The AMPTE program's contribution to studies of the solar wind-magnetosphere-ionosphere interaction

    International Nuclear Information System (INIS)

    Sibeck, D.G.

    1990-01-01

    The Active Magnetospheric Particle Tracer Explorers (AMPTE) program provided important information on the behavior of clouds of plasma artificially injected into the solar wind and the earth's magnetosphere. Now that the releases are over, data from the satellites are being analyzed to investigate the processes by which the ambient solar wind mass, momentum, and energy are transferred to the magnetosphere. Work in progress at APL indicates that the solar wind is much more inhomogeneous than previously believed, that the solar wind constantly buffets the magnetosphere, and that ground observers may remotely sense these interactions as geomagnetic pulsations. 8 refs

  7. The sun, the solar wind, and the heliosphere

    CERN Document Server

    Miralles, Mari Paz

    2011-01-01

    This volume presents a concise, up-to-date overview of current research on the observations, theoretical interpretations, and empirical and physical descriptions of the Sun, the Solar Wind, and the Heliosphere, from the solar interior outward to the planets.

  8. Three-fluid, three-dimensional magnetohydrodynamic solar wind model with eddy viscosity and turbulent resistivity

    Energy Technology Data Exchange (ETDEWEB)

    Usmanov, Arcadi V.; Matthaeus, William H. [Department of Physics and Astronomy, University of Delaware, Newark, DE 19716 (United States); Goldstein, Melvyn L., E-mail: arcadi.usmanov@nasa.gov [Code 672, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

    2014-06-10

    We have developed a three-fluid, three-dimensional magnetohydrodynamic solar wind model that incorporates turbulence transport, eddy viscosity, turbulent resistivity, and turbulent heating. The solar wind plasma is described as a system of co-moving solar wind protons, electrons, and interstellar pickup protons, with separate energy equations for each species. Numerical steady-state solutions of Reynolds-averaged solar wind equations coupled with turbulence transport equations for turbulence energy, cross helicity, and correlation length are obtained by the time relaxation method in the corotating with the Sun frame of reference in the region from 0.3 to 100 AU (but still inside the termination shock). The model equations include the effects of electron heat conduction, Coulomb collisions, photoionization of interstellar hydrogen atoms and their charge exchange with the solar wind protons, turbulence energy generation by pickup protons, and turbulent heating of solar wind protons and electrons. The turbulence transport model is based on the Reynolds decomposition and turbulence phenomenologies that describe the conversion of fluctuation energy into heat due to a turbulent cascade. In addition to using separate energy equations for the solar wind protons and electrons, a significant improvement over our previous work is that the turbulence model now uses an eddy viscosity approximation for the Reynolds stress tensor and the mean turbulent electric field. The approximation allows the turbulence model to account for driving of turbulence by large-scale velocity gradients. Using either a dipole approximation for the solar magnetic field or synoptic solar magnetograms from the Wilcox Solar Observatory for assigning boundary conditions at the coronal base, we apply the model to study the global structure of the solar wind and its three-dimensional properties, including embedded turbulence, heating, and acceleration throughout the heliosphere. The model results are

  9. The "FIP Effect" and the Origins of Solar Energetic Particles and of the Solar Wind

    Science.gov (United States)

    Reames, Donald V.

    2018-03-01

    We find that the element abundances in solar energetic particles (SEPs) and in the slow solar wind (SSW), relative to those in the photosphere, show different patterns as a function of the first ionization potential (FIP) of the elements. Generally, the SEP and SSW abundances reflect abundance samples of the solar corona, where low-FIP elements, ionized in the chromosphere, are more efficiently conveyed upward to the corona than high-FIP elements that are initially neutral atoms. Abundances of the elements, especially C, P, and S, show a crossover from low to high FIP at {≈} 10 eV in the SEPs but {≈} 14 eV for the solar wind. Naively, this seems to suggest cooler plasma from sunspots beneath active regions. More likely, if the ponderomotive force of Alfvén waves preferentially conveys low-FIP ions into the corona, the source plasma that eventually will be shock-accelerated as SEPs originates in magnetic structures where Alfvén waves resonate with the loop length on closed magnetic field lines. This concentrates FIP fractionation near the top of the chromosphere. Meanwhile, the source of the SSW may lie near the base of diverging open-field lines surrounding, but outside of, active regions, where such resonance does not exist, allowing fractionation throughout the chromosphere. We also find that energetic particles accelerated from the solar wind itself by shock waves at corotating interaction regions, generally beyond 1 AU, confirm the FIP pattern of the solar wind.

  10. Interaction of the plasma tail of comet Bradfield 1979L on 1980 February 6 with a possibly flare-generated solar-wind disturbance

    International Nuclear Information System (INIS)

    Niedner, M.B. Jr.; Brandt, J.C.; Zwickl, R.D.; Bame, S.J.

    1982-01-01

    Solar-wind plasma data from the ISEE-3 and Helios 2 spacecraft have been examined in order to explain a uniquely rapid 10 0 turning of the plasma tail of comet Bradfield 1979L on 1980 February 6. An earlier study conducted before the availability of in situ solar-wind data (Brandt et al., 1980) suggested that the tail position angle change occurred in response to a solar-wind velocity shear across which the polar component changed by approx. 50 km s - 1 . The present contribution confirms this result and further suggests that the comet-tail activity was caused by non-corotating, disturbed plasma flows probably associated with an Importance 1B solar flare

  11. Decay of Solar Wind Turbulence behind Interplanetary Shocks

    Energy Technology Data Exchange (ETDEWEB)

    Pitňa, Alexander; Šafránková, Jana; Němeček, Zdeněk [Charles University, Faculty of Mathematics and Physics, V Holesovickach 2, Prague, CZ-18000 (Czech Republic); Franci, Luca, E-mail: offelius@gmail.com [Dipartimento di Fisica e Astronomia, Universita degli Studi di Firenze, I-50125 Firenze (Italy)

    2017-07-20

    We investigate the decay of magnetic and kinetic energies behind IP shocks with motivation to find a relaxation time when downstream turbulence reaches a usual solar wind value. We start with a case study that introduces computation techniques and quantifies a contribution of kinetic fluctuations to the general energy balance. This part of the study is based on high-time (31 ms) resolution plasma data provided by the Spektr-R spacecraft. On the other hand, a statistical part is based on 92 s Wind plasma and magnetic data and its results confirm theoretically established decay laws for kinetic and magnetic energies. We observe the power-law behavior of the energy decay profiles and we estimated the power-law exponents of both kinetic and magnetic energy decay rates as −1.2. We found that the decay of MHD turbulence does not start immediately after the IP shock ramp and we suggest that the proper decay of turbulence begins when a contribution of the kinetic processes becomes negligible. We support this suggestion with a detailed analysis of the decay of turbulence at the kinetic scale.

  12. Decay of Solar Wind Turbulence behind Interplanetary Shocks

    International Nuclear Information System (INIS)

    Pitňa, Alexander; Šafránková, Jana; Němeček, Zdeněk; Franci, Luca

    2017-01-01

    We investigate the decay of magnetic and kinetic energies behind IP shocks with motivation to find a relaxation time when downstream turbulence reaches a usual solar wind value. We start with a case study that introduces computation techniques and quantifies a contribution of kinetic fluctuations to the general energy balance. This part of the study is based on high-time (31 ms) resolution plasma data provided by the Spektr-R spacecraft. On the other hand, a statistical part is based on 92 s Wind plasma and magnetic data and its results confirm theoretically established decay laws for kinetic and magnetic energies. We observe the power-law behavior of the energy decay profiles and we estimated the power-law exponents of both kinetic and magnetic energy decay rates as −1.2. We found that the decay of MHD turbulence does not start immediately after the IP shock ramp and we suggest that the proper decay of turbulence begins when a contribution of the kinetic processes becomes negligible. We support this suggestion with a detailed analysis of the decay of turbulence at the kinetic scale.

  13. Vestas Power Plant Solutions Integrating Wind, Solar PV and Energy Storage

    DEFF Research Database (Denmark)

    Petersen, Lennart; Hesselbæk, Bo; Martinez, Antonio

    2018-01-01

    This paper addresses a value proposition and feasible system topologies for hybrid power plant solutions integrating wind, solar PV and energy storage and moreover provides insights into Vestas hybrid power plant projects. Seen from the perspective of a wind power plant developer, these hybrid...... solutions provide a number of benefits that could potentially reduce the Levelized Cost of Energy and enable entrance to new markets for wind power and facilitate the transition to a more sustainable energy mix. First, various system topologies are described in order to distinguish the generic concepts...... for the electrical infrastructure of hybrid power plants. Subsequently, the benefits of combining wind and solar PV power as well as the advantages of combining variable renewable energy sources with energy storage are elaborated. Finally, the world’s first utility-scale hybrid power plant combining wind, solar PV...

  14. Three-dimensional structure of the coronal magnetic field and the solar wind speed distribution projected on the photosphere in 1974

    International Nuclear Information System (INIS)

    Hakamada, K.

    1987-01-01

    Since the solar wind and coronal holes were relatively steady in 1974, the average distribution of the solar wind speed on the source surface and that of the line-of-sight component of the photospheric magnetic fields (B 1 ) can be constructed, with fair accuracy, by the superposed epoch analysis. The three-dimensional structure of the coronal magnetic fields is then computed from this average map of B 1 based on the potential model. The average distribution of the solar wind speed on the source surface, obtained from interplanetary scintillation observations, is then projected onto the photosphere along the open field lines in the corona. The high-speed regions thus projected are compared with the He I (1083 nm) coronal holes and are found to have a similar geometry. The results are also suggestive that the solar wind does not blow out uniformly from the vicinity of a coronal hole and that the speed is higher at the east side in that region than at the west side. The slower speed regions on the source surface have a sinusoidal structure in heliographic latitude-longitude coordinates and are similar to the brightness distribution of the K corona and the structure of closed field line regions projected onto the photosphere. copyrightAmerican Geophysical Union 1987

  15. On Electron-Scale Whistler Turbulence in the Solar Wind

    Science.gov (United States)

    Narita, Y.; Nakamura, R.; Baumjohann, W.; Glassmeier, K.-H.; Motschmann, U.; Giles, B.; Magnes, W.; Fischer, D.; Torbert, R. B.; Russell, C. T.

    2016-01-01

    For the first time, the dispersion relation for turbulence magnetic field fluctuations in the solar wind is determined directly on small scales of the order of the electron inertial length, using four-point magnetometer observations from the Magnetospheric Multiscale mission. The data are analyzed using the high-resolution adaptive wave telescope technique. Small-scale solar wind turbulence is primarily composed of highly obliquely propagating waves, with dispersion consistent with that of the whistler mode.

  16. Time Delay Between Dst Index and Magnetic Storm Related Structure in the Solar Wind

    Science.gov (United States)

    Osherovich, Vladimir A.; Fainberg, Joseph

    2015-01-01

    Benson et al. (2015, this volume) selected 10 large magnetic storms, with associated Dst minimum values less than or equal to -100 nT, for which high-latitude topside ionospheric electron density profiles are available from topside-sounder satellites. For these 10 storms, we performed a superposition of Dst and interplanetary parameters B, v, N(sub p) and T(sub p). We have found that two interplanetary parameters, namely B and v, are sufficient to reproduce Dst with correlation coefficient cc approximately 0.96 provided that the interplanetary parameter times are taken 0.15 days earlier than the associated Dst times. Thus we have found which part of the solar wind is responsible for each phase of the magnetic storm. This result is also verified for individual storms as well. The total duration of SRS (storm related structure in the solar wind) is 4 - 5 days which is the same as the associated Dst interval of the magnetic storm.

  17. Dependence of Substorm Evolution on Solar Wind Condition: Simulation Study

    Science.gov (United States)

    Kamiyoshikawa, N.; Ebihara, Y.; Tanaka, T.

    2017-12-01

    A substorm is one of the remarkable disturbances occurring in the magnetosphere. It is known that the substorm occurs frequently when IMF is southward and solar wind speed is high. However, the physical process to determine substorm scale is not well understood. We reproduced substorms by using global MHD simulation, calculated auroral electrojet (ionospheric Hall current) flowing in the ionosphere to investigate the dependence of substorm evolution on solar wind condition. Solar wind speed of 372.4 km/s and IMF Bz of 5.0 nT were imposed to, obtain the quasi-stationary state of the magnetosphere. Then the solar wind parameters were changed as a step function. For the solar wind speed, we assumed 300 km/s, 500 km/s and 700 km/s. For IMF, we assumed -1.0 nT, -3.0 nT, -5.0 nT, -7.0 nT and -9.0 nT. In total, 15 simulation runs were performed. In order to objectively evaluate the substorm, the onset was identified with the method based on the one proposed by Newell et al. (2011). This method uses the SME index that is an extension of the AE index. In this study, the geomagnetic variation induced by the ionospheric Hall current was obtained every 1 degree from the magnetic latitude 40 degrees to 80 degrees and in every 0.5 hours in the magnetic region direction. The upper and the lower envelopes of the geomagnetic variation are regarded as SMU index and SML index, respectively. The larger the solar wind speed, the larger the southward IMF, the more the onset tends to be faster. This tendency is consistent with the onset occurrence probability indicated by Newell et al. (2016). Moreover, the minimum value of the SML index within 30 minutes from the beginning of the onset tends to decrease with the solar wind speed and the magnitude of the southward IMF. A rapid decrease of the SML index can be explained by a rapid increase in the field-aligned currents flowing in and out of the nightside ionosphere. This means that electromagnetic energies flowing into the ionosphere

  18. Invited article: Electric solar wind sail: toward test missions.

    Science.gov (United States)

    Janhunen, P; Toivanen, P K; Polkko, J; Merikallio, S; Salminen, P; Haeggström, E; Seppänen, H; Kurppa, R; Ukkonen, J; Kiprich, S; Thornell, G; Kratz, H; Richter, L; Krömer, O; Rosta, R; Noorma, M; Envall, J; Lätt, S; Mengali, G; Quarta, A A; Koivisto, H; Tarvainen, O; Kalvas, T; Kauppinen, J; Nuottajärvi, A; Obraztsov, A

    2010-11-01

    The electric solar wind sail (E-sail) is a space propulsion concept that uses the natural solar wind dynamic pressure for producing spacecraft thrust. In its baseline form, the E-sail consists of a number of long, thin, conducting, and centrifugally stretched tethers, which are kept in a high positive potential by an onboard electron gun. The concept gains its efficiency from the fact that the effective sail area, i.e., the potential structure of the tethers, can be millions of times larger than the physical area of the thin tethers wires, which offsets the fact that the dynamic pressure of the solar wind is very weak. Indeed, according to the most recent published estimates, an E-sail of 1 N thrust and 100 kg mass could be built in the rather near future, providing a revolutionary level of propulsive performance (specific acceleration) for travel in the solar system. Here we give a review of the ongoing technical development work of the E-sail, covering tether construction, overall mechanical design alternatives, guidance and navigation strategies, and dynamical and orbital simulations.

  19. The interactions of the HELIOS probe with the solar wind plasma

    International Nuclear Information System (INIS)

    Voigt, G.H.; Isensee, U.; Maassberg, H.

    1981-08-01

    HELIOS solar probe disturbs the solar wind plasma in the near vicinity. Around the probe, a space charge cloud is formed due to strong photoelectron emission and fade out of solar wind particles. The conducting and isolating parts of the surface are differently charged. These effects result in a very complex potential structure in the vicinity of the probe and on the surface. The interactions of the HELIOS probe with the solar wind plasma are described by models based on kinetic theory of plasma. The combination of these models yields an entire and consistent representation of the spacecraft charging and the potential structure. Electron spectra measured by plasma experiment E1 are analysed and compared with results of the theoretical models. (orig.) [de

  20. Study of the solar wind coupling to the time difference horizontal geomagnetic field

    Directory of Open Access Journals (Sweden)

    P. Wintoft

    2005-07-01

    Full Text Available The local ground geomagnetic field fluctuations (Δ B are dominated by high frequencies and 83% of the power is located at periods of 32 min or less. By forming 10-min root-mean-square (RMS of Δ B a major part of this variation is captured. Using measured geomagnetic induced currents (GIC, from a power grid transformer in Southern Sweden, it is shown that the 10-min standard deviation GIC may be computed from a linear model using the RMS Δ X and Δ Y at Brorfelde (BFE: 11.67° E, 55.63° N, Denmark, and Uppsala (UPS: 17.35° E, 59.90° N, Sweden, with a correlation of 0.926±0.015. From recurrent neural network models, that are driven by solar wind data, it is shown that the log RMS Δ X and Δ Y at the two locations may be predicted up to 30 min in advance with a correlation close to 0.8: 0.78±0.02 for both directions at BFE; 0.81±0.02 and 0.80±0.02 in the X- and Y-directions, respectively, at UPS. The most important inputs to the models are the 10-min averages of the solar wind magnetic field component Bz and velocity V, and the 10-min standard deviation of the proton number density σn. The average proton number density n has no influence.

    Keywords. Magnetospheric physics (Solar wind - magnetosphere interactions – Geomagnetism and paleomagnetism (Rapid time variations

  1. Forecasting Kp from solar wind data: input parameter study using 3-hour averages and 3-hour range values

    Science.gov (United States)

    Wintoft, Peter; Wik, Magnus; Matzka, Jürgen; Shprits, Yuri

    2017-11-01

    We have developed neural network models that predict Kp from upstream solar wind data. We study the importance of various input parameters, starting with the magnetic component Bz, particle density n, and velocity V and then adding total field B and the By component. As we also notice a seasonal and UT variation in average Kp we include functions of day-of-year and UT. Finally, as Kp is a global representation of the maximum range of geomagnetic variation over 3-hour UT intervals we conclude that sudden changes in the solar wind can have a big effect on Kp, even though it is a 3-hour value. Therefore, 3-hour solar wind averages will not always appropriately represent the solar wind condition, and we introduce 3-hour maxima and minima values to some degree address this problem. We find that introducing total field B and 3-hour maxima and minima, derived from 1-minute solar wind data, have a great influence on the performance. Due to the low number of samples for high Kp values there can be considerable variation in predicted Kp for different networks with similar validation errors. We address this issue by using an ensemble of networks from which we use the median predicted Kp. The models (ensemble of networks) provide prediction lead times in the range 20-90 min given by the time it takes a solar wind structure to travel from L1 to Earth. Two models are implemented that can be run with real time data: (1) IRF-Kp-2017-h3 uses the 3-hour averages of the solar wind data and (2) IRF-Kp-2017 uses in addition to the averages, also the minima and maxima values. The IRF-Kp-2017 model has RMS error of 0.55 and linear correlation of 0.92 based on an independent test set with final Kp covering 2 years using ACE Level 2 data. The IRF-Kp-2017-h3 model has RMSE = 0.63 and correlation = 0.89. We also explore the errors when tested on another two-year period with real-time ACE data which gives RMSE = 0.59 for IRF-Kp-2017 and RMSE = 0.73 for IRF-Kp-2017-h3. The errors as function

  2. Solar wind velocity and geomagnetic moment variations

    International Nuclear Information System (INIS)

    Kalinin, Yu.D.; Rozanova, T.S.

    1982-01-01

    The mean year values of the solar wind velocity have been calculated from the mean-year values of a geomagnetic activity index am according to the Svalgard equation of regression for the pe-- riod from 1930 to 1960. For the same years the values of the geomagnetic moment M and separately of its ''inner'' (causes of which'' are inside the Earth) and ''external'' (causes of which are outside the Earth) parts have been calculated from the mean year data of 12 magnetic observatories. The proof of the presence of the 11-year variation in the moment M has been obtained. It is concluded that the 11-year variations in M result from the variations of the solar wind velocity

  3. Coupling of the solar wind to measures of magnetic activity

    International Nuclear Information System (INIS)

    McPherron, R.L.; Fay, R.A.; Garrity, C.R.; Bargatze, L.F.; Baker, D.N.; Clauer, C.R.; Searls, C.

    1984-01-01

    The technique of linear prediction filtering has been used to generate empirical response functions relating the solar wind electric field to the most frequently used magnetic indices, AL, AU, Dst and ASYM. Two datasets, one from 1967-1968 and one from 1973-1974, provided the information needed to calculate the empirical response functions. These functions have been convolved with solar wind observations obtained during the IMS to predict the indices. These predictions are compared with the observed indices during two, three-day intervals studied extensively by participants in the CDAW-6 workshop. Differences between the observed and predicted indices are discussed in terms of the linear assumption and in terms of physical processes other than direct solar wind-magnetosphere interaction

  4. Solar wind-magnetosphere coupling during intense magnetic storms (1978-1979)

    Science.gov (United States)

    Gonzalez, Walter D.; Gonzalez, Alicia L. C.; Tsurutani, Bruce T.; Smith, Edward J.; Tang, Frances

    1989-01-01

    The solar wind-magnetosphere coupling problem during intense magnetic storms was investigated for ten intense magnetic storm events occurring between August 16, 1978 to December 28, 1979. Particular attention was given to the dependence of the ring current energization on the ISEE-measured solar-wind parameters and the evolution of the ring current during the main phase of the intense storms. Several coupling functions were tested as energy input, and several sets of the ring current decay time-constant were searched for the best correlation with the Dst response. Results indicate that a large-scale magnetopause reconnection operates during an intense storm event and that the solar wind ram pressure plays an important role in the energization of the ring current.

  5. A Study of the Solar Wind-Magnetosphere Coupling Using Neural Networks

    Science.gov (United States)

    Wu, Jian-Guo; Lundstedt, Henrik

    1996-12-01

    The interaction between solar wind plasma and interplanetary magnetic field (IMF) and Earth's magnetosphere induces geomagnetic activity. Geomagnetic storms can cause many adverse effects on technical systems in space and on the Earth. It is therefore of great significance to accurately predict geomagnetic activity so as to minimize the amount of disruption to these operational systems and to allow them to work as efficiently as possible. Dynamic neural networks are powerful in modeling the dynamics encoded in time series of data. In this study, we use partially recurrent neural networks to study the solar wind-magnetosphere coupling by predicting geomagnetic storms (as measured by the Dstindex) from solar wind measurements. The solar wind, the IMF and the geomagnetic index Dst data are hourly averaged and read from the National Space Science Data Center's OMNI database. We selected these data from the period 1963 to 1992, which cover 10552h and contain storm time periods 9552h and quiet time periods 1000h. The data are then categorized into three data sets: a training set (6634h), across-validation set (1962h), and a test set (1956h). The validation set is used to determine where the training should be stopped whereas the test set is used for neural networks to get the generalization capability (the out-of-sample performance). Based on the correlation analysis between the Dst index and various solar wind parameters (including various combinations of solar wind parameters), the best coupling functions can be found from the out-of-sample performance of trained neural networks. The coupling functions found are then used to forecast geomagnetic storms one to several hours in advance. The comparisons are made on iterating the single-step prediction several times and on making a non iterated, direct prediction. Thus, we will present the best solar wind-magnetosphere coupling functions and the corresponding prediction results. Interesting Links: Lund Space Weather and AI

  6. Elsaesser variable analysis of fluctuations in the ion foreshock and undisturbed solar wind

    Science.gov (United States)

    Labelle, James; Treumann, Rudolf A.; Marsch, Eckart

    1994-01-01

    Magnetohydrodynamics (MHD) fluctuations in the solar wind have been investigated previously by use of Elsaesser variables. In this paper, we present a comparison of the spectra of Elsaesser variables in the undisturbed solar wind at 1 AU and in the ion foreshock in front of the Earth. Both observations take place under relatively strong solar wind flow speed conditions (approximately equal 600 km/s). In the undisturbed solar wind we find that outward propagating Alfven waves dominate, as reported by other observers. In the ion foreshock the situation is more complex, with neither outward nor inward propagation dominating over the entire range investigated (1-10 mHz). Measurements of the Poynting vectors associated with the fluctuations are consistent with the Elsaesser variable analysis. These results generally support interpretations of the Elsaesser variables which have been made based strictly on solar wind data and provide additional insight into the nature of the ion foreshock turbulence.

  7. Turbulence and Waves as Sources for the Solar Wind

    Science.gov (United States)

    Cranmer, S. R.

    2008-05-01

    Gene Parker's insights from 50 years ago provided the key causal link between energy deposition in the solar corona and the acceleration of solar wind streams. However, the community is still far from agreement concerning the actual physical processes that give rise to this energy. It is still unknown whether the solar wind is fed by flux tubes that remain open (and are energized by footpoint-driven wavelike fluctuations) or if mass and energy is input more intermittently from closed loops into the open-field regions. No matter the relative importance of reconnections and loop-openings, though, we do know that waves and turbulent motions are present everywhere from the photosphere to the heliosphere, and it is important to determine how they affect the mean state of the plasma. In this presentation, I will give a summary of wave/turbulence models that seem to succeed in explaining the time-steady properties of the corona (and the fast and slow solar wind). The coronal heating and solar wind acceleration in these models comes from anisotropic turbulent cascade, which is driven by the partial reflection of low-frequency Alfven waves propagating along the open magnetic flux tubes. Specifically, a 2D model of coronal holes and streamers at solar minimum reproduces the latitudinal bifurcation of slow and fast streams seen by Ulysses. The radial gradient of the Alfven speed affects where the waves are reflected and damped, and thus whether energy is deposited below or above Parker's critical point. As predicted by earlier studies, a larger coronal expansion factor gives rise to a slower and denser wind, higher temperature at the coronal base, less intense Alfven waves at 1 AU, and correlative trends for commonly measured ratios of ion charge states and FIP-sensitive abundances that are in general agreement with observations. Finally, I will outline the types of future observations that would be most able to test and refine these ideas.

  8. Solar Rotational Periodicities and the Semiannual Variation in the Solar Wind, Radiation Belt, and Aurora

    Science.gov (United States)

    Emery, Barbara A.; Richardson, Ian G.; Evans, David S.; Rich, Frederick J.; Wilson, Gordon R.

    2011-01-01

    The behavior of a number of solar wind, radiation belt, auroral and geomagnetic parameters is examined during the recent extended solar minimum and previous solar cycles, covering the period from January 1972 to July 2010. This period includes most of the solar minimum between Cycles 23 and 24, which was more extended than recent solar minima, with historically low values of most of these parameters in 2009. Solar rotational periodicities from S to 27 days were found from daily averages over 81 days for the parameters. There were very strong 9-day periodicities in many variables in 2005 -2008, triggered by recurring corotating high-speed streams (HSS). All rotational amplitudes were relatively large in the descending and early minimum phases of the solar cycle, when HSS are the predominant solar wind structures. There were minima in the amplitudes of all solar rotational periodicities near the end of each solar minimum, as well as at the start of the reversal of the solar magnetic field polarity at solar maximum (approx.1980, approx.1990, and approx. 2001) when the occurrence frequency of HSS is relatively low. Semiannual equinoctial periodicities, which were relatively strong in the 1995-1997 solar minimum, were found to be primarily the result of the changing amplitudes of the 13.5- and 27-day periodicities, where 13.5-day amplitudes were better correlated with heliospheric daily observations and 27-day amplitudes correlated better with Earth-based daily observations. The equinoctial rotational amplitudes of the Earth-based parameters were probably enhanced by a combination of the Russell-McPherron effect and a reduction in the solar wind-magnetosphere coupling efficiency during solstices. The rotational amplitudes were cross-correlated with each other, where the 27 -day amplitudes showed some of the weakest cross-correlations. The rotational amplitudes of the > 2 MeV radiation belt electron number fluxes were progressively weaker from 27- to 5-day periods

  9. The large scale and long term evolution of the solar wind speed distribution and high speed streams

    International Nuclear Information System (INIS)

    Intriligator, D.S.

    1977-01-01

    The spatial and temporal evolution of the solar wind speed distribution and of high speed streams in the solar wind are examined. Comparisons of the solar wind streaming speeds measured at Earth, Pioneer 11, and Pioneer 10 indicate that between 1 AU and 6.4 AU the solar wind speed distributions are narrower (i.e. the 95% value minus the 5% value of the solar wind streaming speed is less) at extended heliocentric distances. These observations are consistent with one exchange of momentum in the solar wind between high speed streams and low speed streams as they propagate outward from the Sun. Analyses of solar wind observations at 1 AU from mid 1964 through 1973 confirm the earlier results reported by Intriligator (1974) that there are statistically significant variations in the solar wind in 1968 and 1969, years of solar maximum. High speed stream parameters show that the number of high speed streams in the solar wind in 1968 and 1969 is considerably more than the predicted yearly average, and in 1965 and 1972 less. Histograms of solar wind speed from 1964 through 1973 indicate that in 1968 there was the highest percentage of elevated solar wind speeds and in 1965 and 1972 the lowest. Studies by others also confirm these results although the respective authors did not indicate this fact. The duration of the streams and the histograms for 1973 imply a shifting in the primary stream source. (Auth.)

  10. FADING CORONAL STRUCTURE AND THE ONSET OF TURBULENCE IN THE YOUNG SOLAR WIND

    Energy Technology Data Exchange (ETDEWEB)

    DeForest, C. E. [Southwest Research Institute, 1050 Walnut Street, Boulder, CO (United States); Matthaeus, W. H. [Bartol Research Institute, University of Delaware, Newark, DE 19716 (United States); Viall, N. M. [NASA/Goddard Space Flight Center, Mail Code 671, Greenbelt, MD 20771 (United States); Cranmer, S. R. [University of Colorado, Duane E226, Boulder, CO 80305 (United States)

    2016-09-10

    Above the top of the solar corona, the young, slow solar wind transitions from low- β , magnetically structured flow dominated by radial structures to high- β , less structured flow dominated by hydrodynamics. This transition, long inferred via theory, is readily apparent in the sky region close to 10° from the Sun in processed, background-subtracted solar wind images. We present image sequences collected by the inner Heliospheric Imager instrument on board the Solar-Terrestrial Relations Observatory ( STEREO /HI1) in 2008 December, covering apparent distances from approximately 4° to 24° from the center of the Sun and spanning this transition in the large-scale morphology of the wind. We describe the observation and novel techniques to extract evolving image structure from the images, and we use those data and techniques to present and quantify the clear textural shift in the apparent structure of the corona and solar wind in this altitude range. We demonstrate that the change in apparent texture is due both to anomalous fading of the radial striae that characterize the corona and to anomalous relative brightening of locally dense puffs of solar wind that we term “flocculae.” We show that these phenomena are inconsistent with smooth radial flow, but consistent with the onset of hydrodynamic or magnetohydrodynamic instabilities leading to a turbulent cascade in the young solar wind.

  11. Fading Coronal Structure and the Onset of Turbulence in the Young Solar Wind

    Science.gov (United States)

    DeForest, C. E.; Matthaeus, W. H.; Viall, N. M.; Cranmer, S. R.

    2016-01-01

    Above the top of the solar corona, the young, slow solar wind transitions from low-beta, magnetically structured flow dominated by radial structures to high-beta, less structured flow dominated by hydrodynamics. This transition, long inferred via theory, is readily apparent in the sky region close to 10deg from the Sun in processed, background-subtracted solar wind images. We present image sequences collected by the inner Heliospheric Imager instrument on board the Solar-Terrestrial Relations Observatory (STEREO/HI1) in 2008 December, covering apparent distances from approximately 4deg to 24deg from the center of the Sun and spanning this transition in the large-scale morphology of the wind. We describe the observation and novel techniques to extract evolving image structure from the images, and we use those data and techniques to present and quantify the clear textural shift in the apparent structure of the corona and solar wind in this altitude range. We demonstrate that the change in apparent texture is due both to anomalous fading of the radial striae that characterize the corona and to anomalous relative brightening of locally dense puffs of solar wind that we term "flocculae." We show that these phenomena are inconsistent with smooth radial flow, but consistent with the onset of hydrodynamic or magnetohydrodynamic instabilities leading to a turbulent cascade in the young solar wind.

  12. Early time interaction of lithium ions with the solar wind in the AMPTE mission

    International Nuclear Information System (INIS)

    Lui, A.T.Y.; Goodrich, C.C.; Mankofsky, A.; Papadopoulos, K.

    1986-01-01

    The early time interaction of an artificially injected lithium cloud with the solar wind is simulated with a one-dimensional hybrid code. Simulation results indicate that the lithium cloud presents an obstacle to the solar wind flow, forming a shock-like interaction region. Several notable features are found: (1) The magnetic field is enhanced up to a factor of about 6 followed by a magnetic cavity downstream. (2) Solar wind ions are slowed down inside the lithium cloud, with substantial upstream reflection. (3) Most of the lithium ions gradually pick up the velocity of the solar wind and move downstream. (4) Intense and short-wavelength electric fields exist ahead of the interaction region. (5) Strong electron heating occurs within the lithium clouds. (6) The convection electric field in the in the solar wind is modulated in the interaction region. The simulation results are in remarkable agreement with in situ spacecraft measurements made during lithium releases in the solar wind by the AMPTE (Active magnetospheric Particle Tracer Explorers) Program

  13. Wind and IMP 8 Solar Wind, Magnetosheath and Shock Data

    Science.gov (United States)

    2004-01-01

    The purpose of this project was to provide the community access to magnetosheath data near Earth. We provided 27 years of IMP 8 magnetosheath proton velocities, densities, and temperatures with our best (usually 1-min.) time resolution. IMP 8 crosses the magnetosheath twice each 125 day orbit, and we provided magnetosheath data for the roughly 27 years of data for which magnetometer data are also available (which are needed to reliably pick boundaries). We provided this 27 years of IMP 8 magnetosheath data to the NSSDC; this data is now integrated with the IMP 8 solar wind data with flags indicating whether each data point is in the solar wind, magnetosheath, or at the boundary between the two regions. The plasma speed, density, and temperature are provided for each magnetosheath point. These data are also available on the MIT web site ftp://space .mit.edu/pub/plasma/imp/www/imp.html. We provide ASCII time-ordered rows of data giving the observation time, the spacecraft position in GSE, the velocity is GSE, the density and temperature for protons. We also have analyzed and archived on our web site the Wind magnetosheath plasma parameters. These consist of ascii files of the proton and alpha densities, speeds, and thermal speeds. These data are available at ftp://space.mit.edu/pub/plasma/wind/sheath These are the two products promised in the work statement and they have been completed in full.

  14. Depletion of solar wind plasma near a planetary boundary

    International Nuclear Information System (INIS)

    Zwan, B.J.; Wolf, R.A.

    1976-01-01

    A mathematical model is presented that describes the squeezing of solar wind plasma out along interplanetary magnetic field lines in the region between the bow shock and the effective planetary boundary (in the case of the earth, the magnetopause). In the absence of local magnetic merging the squeezing process should create a 'depletion layer,' a region of very low plasma density just outside the magnetopause. Numerical solutions are obtained for the dimensionless magnetohydrodynamic equations describing this depletion process for the case where the solar wind magnetic field is perpendicular to the solar wind flow direction. For the case of the earth with a magnetopause standoff distance of 10 R/subE/, the theory predicts that the density should be reduced by a factor > or =2 in a layer about 700--1300 km thick if M/subA/, the Alfven Mach number in the solar wind, is equal to 8. The layer thickness should vary as M/subA/ -2 and should be approximately uniform for a large area of the magnetopause around the subsolar point. Computed layer thicknesses are somewhat smaller than those derived from Lees' axisymmetric model. Depletion layers should develop fully only where magnetic merging is locally unimportant. Scaling of the model calculations to Venus and Mars suggest layer thicknesses about 1/10 and 1/15 those of the earth, respectively, neglecting diffusion and ionospheric effects

  15. Solar wind stream interaction regions throughout the heliosphere

    Science.gov (United States)

    Richardson, Ian G.

    2018-01-01

    This paper focuses on the interactions between the fast solar wind from coronal holes and the intervening slower solar wind, leading to the creation of stream interaction regions that corotate with the Sun and may persist for many solar rotations. Stream interaction regions have been observed near 1 AU, in the inner heliosphere (at ˜ 0.3-1 AU) by the Helios spacecraft, in the outer and distant heliosphere by the Pioneer 10 and 11 and Voyager 1 and 2 spacecraft, and out of the ecliptic by Ulysses, and these observations are reviewed. Stream interaction regions accelerate energetic particles, modulate the intensity of Galactic cosmic rays and generate enhanced geomagnetic activity. The remote detection of interaction regions using interplanetary scintillation and white-light imaging, and MHD modeling of interaction regions will also be discussed.

  16. MODELING THE SOLAR WIND AT THE ULYSSES , VOYAGER , AND NEW HORIZONS SPACECRAFT

    Energy Technology Data Exchange (ETDEWEB)

    Kim, T. K.; Pogorelov, N. V.; Zank, G. P. [Center for Space Plasma and Aeronomic Research, University of Alabama in Huntsville, Huntsville, AL 35805 (United States); Elliott, H. A.; McComas, D. J. [Southwest Research Institute, San Antonio, TX 78238 (United States)

    2016-11-20

    The outer heliosphere is a dynamic region shaped largely by the interaction between the solar wind and the interstellar medium. While interplanetary magnetic field and plasma observations by the Voyager spacecraft have significantly improved our understanding of this vast region, modeling the outer heliosphere still remains a challenge. We simulate the three-dimensional, time-dependent solar wind flow from 1 to 80 astronomical units (au), where the solar wind is assumed to be supersonic, using a two-fluid model in which protons and interstellar neutral hydrogen atoms are treated as separate fluids. We use 1 day averages of the solar wind parameters from the OMNI data set as inner boundary conditions to reproduce time-dependent effects in a simplified manner which involves interpolation in both space and time. Our model generally agrees with Ulysses data in the inner heliosphere and Voyager data in the outer heliosphere. Ultimately, we present the model solar wind parameters extracted along the trajectory of the New Horizons spacecraft. We compare our results with in situ plasma data taken between 11 and 33 au and at the closest approach to Pluto on 2015 July 14.

  17. Modeling the Solar Wind at the Ulysses, Voyager, and New Horizons Spacecraft

    Science.gov (United States)

    Kim, T. K.; Pogorelov, N. V.; Zank, G. P.; Elliott, H. A.; McComas, D. J.

    2016-11-01

    The outer heliosphere is a dynamic region shaped largely by the interaction between the solar wind and the interstellar medium. While interplanetary magnetic field and plasma observations by the Voyager spacecraft have significantly improved our understanding of this vast region, modeling the outer heliosphere still remains a challenge. We simulate the three-dimensional, time-dependent solar wind flow from 1 to 80 astronomical units (au), where the solar wind is assumed to be supersonic, using a two-fluid model in which protons and interstellar neutral hydrogen atoms are treated as separate fluids. We use 1 day averages of the solar wind parameters from the OMNI data set as inner boundary conditions to reproduce time-dependent effects in a simplified manner which involves interpolation in both space and time. Our model generally agrees with Ulysses data in the inner heliosphere and Voyager data in the outer heliosphere. Ultimately, we present the model solar wind parameters extracted along the trajectory of the New Horizons spacecraft. We compare our results with in situ plasma data taken between 11 and 33 au and at the closest approach to Pluto on 2015 July 14.

  18. MODELING THE SOLAR WIND AT THE ULYSSES , VOYAGER , AND NEW HORIZONS SPACECRAFT

    International Nuclear Information System (INIS)

    Kim, T. K.; Pogorelov, N. V.; Zank, G. P.; Elliott, H. A.; McComas, D. J.

    2016-01-01

    The outer heliosphere is a dynamic region shaped largely by the interaction between the solar wind and the interstellar medium. While interplanetary magnetic field and plasma observations by the Voyager spacecraft have significantly improved our understanding of this vast region, modeling the outer heliosphere still remains a challenge. We simulate the three-dimensional, time-dependent solar wind flow from 1 to 80 astronomical units (au), where the solar wind is assumed to be supersonic, using a two-fluid model in which protons and interstellar neutral hydrogen atoms are treated as separate fluids. We use 1 day averages of the solar wind parameters from the OMNI data set as inner boundary conditions to reproduce time-dependent effects in a simplified manner which involves interpolation in both space and time. Our model generally agrees with Ulysses data in the inner heliosphere and Voyager data in the outer heliosphere. Ultimately, we present the model solar wind parameters extracted along the trajectory of the New Horizons spacecraft. We compare our results with in situ plasma data taken between 11 and 33 au and at the closest approach to Pluto on 2015 July 14.

  19. SOLAR WIND PROTONS AT 1 AU: TRENDS AND BOUNDS, CONSTRAINTS AND CORRELATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Hellinger, Petr; Trávníček, Pavel M., E-mail: petr.hellinger@asu.cas.cz [Astronomical Institute, AS CR, Bocni II/1401,CZ-14100 Prague (Czech Republic)

    2014-03-20

    The proton temperature anisotropy in the solar wind exhibits apparent bounds which are compatible with the theoretical constraints imposed by temperature-anisotropy-driven kinetic instabilities. Recent statistical analyses based on conditional averaging indicate that near these theoretical constraints the solar wind protons typically have enhanced temperatures and a weaker collisionality. Here we carefully analyze the solar wind data and show that these results are a consequence of superposition of multiple correlations in the solar wind, namely, they mostly result from the correlation between the proton temperature and the solar wind velocity and from the superimposed anti-correlation between the proton temperature anisotropy and the proton parallel beta in the fast solar wind. Colder and more collisional data are distributed around temperature isotropy whereas hotter and less collisional data have a wider range of the temperature anisotropy anti-correlated with the proton parallel beta with signatures of constraints owing to the temperature-anisotropy-driven instabilities. However, most of the hot and weakly collisional data, including the hottest and least collisional ones, lies far from the marginal stability regions. Consequently, we conclude that there is no clear relation between the enhanced temperatures and instability constraints and that the conditional averaging used for these analyses must be used carefully and need to be well tested.

  20. Momentum flux of the solar wind near planetary magnetospheres: a comparative study

    International Nuclear Information System (INIS)

    Perez de Tejada, H.

    1985-01-01

    A study of the velocity profiles of the shocked solar wind exterior to the magnetospheres of the Earth, Mars and Venus is presented. A characteristic difference exists between the conditions present in planets with and without a strong intrinsic magnetic field. In a strongly magnetized planet (as it is the case in the earth), the velocity of the solar wind near the magnetopause remains nearly constant along directions normal to that boundary. In weakly magnetized planets (Venus, Mars), on the other hand, the velocity profile near the magnetopause/ionopause exhibits a transverse gradient which implies decreased values of the momentum flux of the solar wind in those regions. The implications of the different behavior of the shocked solar wind are discussed in connection with the nature of the interaction process that takes place in each case. (author)

  1. Solar minimum Lyman alpha sky background observations from Pioneer Venus orbiter ultraviolet spectrometer - Solar wind latitude variation

    Science.gov (United States)

    Ajello, J. M.

    1990-01-01

    Measurements of interplanetary H I Lyman alpha over a large portion of the celestial sphere were made at the recent solar minimum by the Pioneer Venus orbiter ultraviolet spectrometer. These measurements were performed during a series of spacecraft maneuvers conducted to observe Halley's comet in early 1986. Analysis of these data using a model of the passage of interstellar wind hydrogen through the solar system shows that the rate of charge exchange with solar wind protons is 30 percent less over the solar poles than in the ecliptic. This result is in agreement with a similar experiment performed with Mariner 10 at the previous solar minimum.

  2. A Model fot the Sources of the Slow Solar Wind

    Science.gov (United States)

    Antiochos, S. K.; Mikic, Z.; Titov, V. S.; Lionello, R.; Linker, J. A.

    2011-01-01

    Models for the origin of the slow solar wind must account for two seemingly contradictory observations: the slow wind has the composition of the closed-field corona, implying that it originates from the continuous opening and closing of flux at the boundary between open and closed field. On the other hand, the slow wind also has large angular width, up to approx.60deg, suggesting that its source extends far from the open-closed boundary. We propose a model that can explain both observations. The key idea is that the source of the slow wind at the Sun is a network of narrow (possibly singular) open-field corridors that map to a web of separatrices and quasi-separatrix layers in the heliosphere. We compute analytically the topology of an open-field corridor and show that it produces a quasi-separatrix layer in the heliosphere that extends to angles far from the heliospheric current sheet. We then use an MHD code and MDI/SOHO observations of the photospheric magnetic field to calculate numerically, with high spatial resolution, the quasi-steady solar wind, and magnetic field for a time period preceding the 2008 August 1 total solar eclipse. Our numerical results imply that, at least for this time period, a web of separatrices (which we term an S-web) forms with sufficient density and extent in the heliosphere to account for the observed properties of the slow wind. We discuss the implications of our S-web model for the structure and dynamics of the corona and heliosphere and propose further tests of the model. Key words: solar wind - Sun: corona - Sun: magnetic topology

  3. 26 CFR 31.3121(b)(8)-2 - Services in employ of religious, charitable, educational, or certain other organizations exempt...

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Services in employ of religious, charitable, educational, or certain other organizations exempt from income tax. 31.3121(b)(8)-2 Section 31.3121(b)(8)-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) EMPLOYMENT TAXES AND...

  4. Perturbation of the solar wind in a model terrestrial foreshock

    International Nuclear Information System (INIS)

    Skadron, G.; Holdaway, R.D.; Scholer, M.

    1986-01-01

    We analyze the perturbation of the solar wind in the earth's foreshock. The foreshock is modulated as a planar magnetic flux tube having a 15 R/sub E/ half width. Within the flux tube the upstream energetic particle pressure is assumed to fall monotonically to zero at the flux tube boundary and decline in the upstream direction with a scale length of 8 R/sub E/. The incident solar wind is assumed to flow uniformly with a velocity of 400 km s -1 , a density of 8 cm -3 , a pressure of 50 eV cm -3 , and a magnetic field of 4γ directed parallel to the flow. The solar wind density, velocity, and magnetic field within the foreshock are described by the steady state ideal MHD equations. We find that (1) the vector solar wind velocity perturbation rotates from the sunward to the transverse direction with increasing distance from the axis of the flux tube, (2) the peak solar wind deflection is located --3R/sub E/ within the flux tube boundary, (3) a central upstream pressure of 200 eV cm -3 produces a maxium deceleration of 6 km s -1 and a maximum deflection of 1.3 0 , (4) a central upstream pressure of 600 eV cm -3 produces a maximum deceleration of 19 km s -1 and a maximum deflection of 3.6 0 , and (5) the deflection and deceleration are accompanied by perturbations of the solar wind density and magnetic field. These perturbations are largest near the flux tube boundary where both form spikes having a width of --2R/sub E/. For a 600 eV cm -3 central pressure those spikes have amplitudes of 2 cm -3 and lγ, respectively. We have analyzed the linearized flow problem analytically and reduced the solutions to quadrature. These solutions are found to be good approximations to the numerical nonlinear solutions for moderate values of the upstream particle pressure

  5. Harmonic analysis and suppression in hybrid wind & PV solar system

    Science.gov (United States)

    Gupta, Tripti; Namekar, Swapnil

    2018-04-01

    The growing demand of electricity has led to produce power through non-conventional source of energy such as solar energy, wind energy, hydro power, energy through biogas and biomass etc. Hybrid system is taken to complement the shortcoming of either sources of energy. The proposed system is grid connected hybrid wind and solar system. A 2.1 MW Doubly fed Induction Generator (DFIG) has been taken for analysis of wind farm whose rotor part is connected to two back-to-back converters. A 250 KW Photovoltaic (PV) array taken to analyze solar farm where inverter is required to convert power from DC to AC since electricity generated through solar PV is in the form of DC. Stability and reliability of the system is very important when the system is grid connected. Harmonics is the major Power quality issue which degrades the quality of power at load side. Harmonics in hybrid system arise through the use of power conversion unit. The other causes of harmonics are fluctuation in wind speed and solar irradiance. The power delivered to grid must be free from harmonics and within the limits specified by Indian grid codes. In proposed work, harmonic analysis of the hybrid system is performed in Electrical Transient Analysis program (ETAP) and single tuned harmonic filter is designed to maintain the utility grid harmonics within limits.

  6. Solar wind control of stratospheric temperatures in Jupiter's auroral regions?

    Science.gov (United States)

    Sinclair, James Andrew; Orton, Glenn; Kasaba, Yasumasa; Sato, Takao M.; Tao, Chihiro; Waite, J. Hunter; Cravens, Thomas; Houston, Stephen; Fletcher, Leigh; Irwin, Patrick; Greathouse, Thomas K.

    2017-10-01

    Auroral emissions are the process through which the interaction of a planet’s atmosphere and its external magnetosphere can be studied. Jupiter exhibits auroral emission at a multitude of wavelengths including the X-ray, ultraviolet and near-infrared. Enhanced emission of CH4 and other stratospheric hydrocarbons is also observed coincident with Jupiter’s shorter-wavelength auroral emission (e.g. Caldwell et al., 1980, Icarus 44, 667-675, Kostiuk et al., 1993, JGR 98, 18823). This indicates that auroral processes modify the thermal structure and composition of the auroral stratosphere. The exact mechanism responsible for this auroral-related heating of the stratosphere has however remained elusive (Sinclair et al., 2017a, Icarus 292, 182-207, Sinclair et al., 2017b, GRL, 44, 5345-5354). We will present an analysis of 7.8-μm images of Jupiter measured by COMICS (Cooled Mid-Infrared Camera and Spectrograph, Kataza et al., 2000, Proc. SPIE(4008), 1144-1152) on the Subaru telescope. These images were acquired on January 11th, 12th, 13th, 14th, February 4, 5th and May 17th, 18th, 19th and 20th in 2017, allowing the daily variability of Jupiter’s auroral-related stratospheric heating to be tracked. Preliminary results suggest lower stratospheric temperatures are directly forced by the solar wind dynamical pressure. The southern auroral hotspot exhibited a significant increase in brightness temperature over a 24-hour period. Over the same time period, a solar wind propagation model (Tao et al. 2005, JGR 110, A11208) predicts a strong increase in the solar wind dynamical pressure at Jupiter.

  7. Signature of open magnetic field lines in the extended solar corona and of solar wind acceleration

    Science.gov (United States)

    Antonucci, E.; Giordano, S.; Benna, C.; Kohl, J. L.; Noci, G.; Michels, J.; Fineschi, S.

    1997-01-01

    The observations carried out with the ultraviolet coronagraph spectrometer onboard the Solar and Heliospheric Observatory (SOHO) are discussed. The purpose of the observations was to determine the line of sight and radial velocity fields in coronal regions with different magnetic topology. The results showed that the regions where the high speed solar wind flows along open field lines are characterized by O VI 1032 and HI Lyman alpha 1216 lines. The global coronal maps of the line of sight velocity were reconstructed. The corona height, where the solar wind reaches 100 km/s, was determined.

  8. Kinetic instabilities in the solar wind: A short review

    Energy Technology Data Exchange (ETDEWEB)

    Matteini, Lorenzo, E-mail: l.matteini@imperial.ac.uk [Imperial College London, London SW7 2AZ (United Kingdom)

    2016-03-25

    We know from in situ measurements that solar wind plasma is far from thermal equilibrium. Distribution functions of its main constituents -electrons, protons, and alpha particles-show several departures from Maxwellian, including temperature anisotropy, relative drifts and secondary populations streaming along the local magnetic field. We present a short review of recent solar wind observations of these non-thermal features and associated signatures of wave-particle interactions. Several kinetic instabilities are expected to be at work in the solar wind during its expansion, playing a role in the continuous shaping of particle distributions with distance, and regulating the macroscopic behavior of the plasma. Over the past years, modeling of these processes by means of numerical simulations has been successful in reproducing and explaining the observations; these include the evolution of the plasma due to radial expansion and the response of individual species to different kinetic instabilities. Finally, the impact of local inhomogeneities, like current sheets and turbulence, on the development of kinetic instabilities is also discussed.

  9. A desalination plant with solar and wind energy

    International Nuclear Information System (INIS)

    Chen, H; Ye, Z; Gao, W

    2013-01-01

    The shortage of freshwater resources has become a worldwide problem. China has a water shortage, although the total amount of water resources is the sixth in the world, the per capita water capacity is the 121th (a quarter of the world's per capita water capacity), and the United Nations considers China one of the poorest 13 countries in the world in terms of water. In order to increase the supply of fresh water, a realistic way is to make full use of China's long and narrow coastline for seawater desalination. This paper discusses a sea water desalination device, the device adopts distillation, uses the greenhouse effect principle and wind power heating principle, and the two-type start is used to solve the problem of vertical axis wind turbine self-starting. Thrust bearings are used to ensure the stability of the device, and to ensure absorbtion of wind energy and solar energy, and to collect evaporation of water to achieve desalination. The device can absorb solar and wind energy instead of input energy, so it can be used in ship, island and many kinds of environment. Due to the comprehensive utilization of wind power and solar power, the efficiency of the device is more than other passive sea water desalting plants, the initial investment and maintenance cost is lower than active sea water desalting plant. The main part of the device cannot only be used in offshore work, but can also be used in deep sea floating work, so the device can utilise deep sea energy. In order to prove the practicability of the device, the author has carried out theory of water production calculations. According to the principle of conservation of energy, the device ais bsorbing solar and wind power, except loose lost part which is used for water temperature rise and phase transition. Assume the inflow water temperature is 20 °C, outflow water temperature is 70 °C, the energy utilization is 60%, we can know that the water production quantity is 8 kg/ m 2 per hour. Comparing

  10. ROSAT Observations of Solar Wind Charge Exchange with the Lunar Exosphere

    Science.gov (United States)

    Collier, Michael R.; Snowden, S. L.; Benna, M.; Carter, J. A.; Cravens, T. E.; Hills, H. Kent; Hodges, R. R.; Kuntz, K. D.; Porter, F. Scott; Read, A.; hide

    2012-01-01

    We analyze the ROSAT PSPC soft X-ray image of the Moon taken on 29 June 1990 by examining the radial profile of the count rate in three wedges, two wedges (one north and one south) 13-32 degrees off (19 degrees wide) the terminator towards the dark side and one wedge 38 degrees wide centered on the anti-solar direction. The radial profiles of both the north and the south wedges show substantial limb brightening that is absent in the 38 degree wide antisolar wedge. An analysis of the count rate increase associated with the limb brightening shows that its magnitude is consistent with that expected due to solar wind charge exchange (SWCX) with the tenuous lunar atmosphere. Along with Mars, Venus, and Earth, the Moon represents another solar system body at which solar wind charge exchange has been observed. This technique can be used to explore the solar wind-lunar interaction.

  11. The Solar Wind from Pseudostreamers and their Environs: Opportunities for Observations with Parker Solar Probe and Solar Orbiter

    Science.gov (United States)

    Panasenco, O.; Velli, M.; Panasenco, A.; Lionello, R.

    2017-12-01

    The solar dynamo and photospheric convection lead to three main types of structures extending from the solar surface into the corona - active regions, solar filaments (prominences when observed at the limb) and coronal holes. These structures exist over a wide range of scales, and are interlinked with each other in evolution and dynamics. Active regions can form clusters of magnetic activity and the strongest overlie sunspots. In the decay of active regions, the boundaries separating opposite magnetic polarities (neutral lines) develop specific structures called filament channels above which filaments form. In the presence of flux imbalance decaying active regions can also give birth to lower latitude coronal holes. The accumulation of magnetic flux at coronal hole boundaries also creates conditions for filament formation: polar crown filaments are permanently present at the boundaries of the polar coronal holes. Mid-latitude and equatorial coronal holes - the result of active region evolution - can create pseudostreamers if other coronal holes of the same polarity are present. While helmet streamers form between open fields of opposite polarities, the pseudostreamer, characterized by a smaller coronal imprint, typically shows a more prominent straight ray or stalk extending from the corona. The pseudostreamer base at photospheric heights is multipolar; often one observes tripolar magnetic configurations with two neutral lines - where filaments can form - separating the coronal holes. Here we discuss the specific role of filament channels on pseudostreamer topology and on solar wind properties. 1D numerical analysis of pseudostreamers shows that the properties of the solar wind from around PSs depend on the presence/absence of filament channels, number of channels and chirality at thepseudostreamer base low in the corona. We review and model possible coronal magnetic configurations and solar wind plasma properties at different distances from the solar surface that

  12. Janus: Graphical Software for Analyzing In-Situ Measurements of Solar-Wind Ions

    Science.gov (United States)

    Maruca, B.; Stevens, M. L.; Kasper, J. C.; Korreck, K. E.

    2016-12-01

    In-situ observations of solar-wind ions provide tremendous insights into the physics of space plasmas. Instrument on spacecraft measure distributions of ion energies, which can be processed into scientifically useful data (e.g., values for ion densities and temperatures). This analysis requires a strong, technical understanding of the instrument, so it has traditionally been carried out by the instrument teams using automated software that they had developed for that purpose. The automated routines are optimized for typical solar-wind conditions, so they can fail to capture the complex (and scientifically interesting) microphysics of transient solar-wind - such as coronal mass ejections (CME's) and co-rotating interaction regions (CIR's) - which are often better analyzed manually.This presentation reports on the ongoing development of Janus, a new software package for processing in-situ measurement of solar-wind ions. Janus will provide user with an easy-to-use graphical user interface (GUI) for carrying out highly customized analyses. Transparent to the user, Janus will automatically handle the most technical tasks (e.g., the retrieval and calibration of measurements). For the first time, users with only limited knowledge about the instruments (e.g., non-instrumentalists and students) will be able to easily process measurements of solar-wind ions. Version 1 of Janus focuses specifically on such measurements from the Wind spacecraft's Faraday Cups and is slated for public release in time for this presentation.

  13. 3D Anisotropy of Solar Wind Turbulence, Tubes, or Ribbons?

    Science.gov (United States)

    Verdini, Andrea; Grappin, Roland; Alexandrova, Olga; Lion, Sonny

    2018-01-01

    We study the anisotropy with respect to the local magnetic field of turbulent magnetic fluctuations at magnetofluid scales in the solar wind. Previous measurements in the fast solar wind obtained axisymmetric anisotropy, despite that the analysis method allows nonaxisymmetric structures. These results are probably contaminated by the wind expansion that introduces another symmetry axis, namely, the radial direction, as indicated by recent numerical simulations. These simulations also show that while the expansion is strong, the principal fluctuations are in the plane perpendicular to the radial direction. Using this property, we separate 11 yr of Wind spacecraft data into two subsets characterized by strong and weak expansion and determine the corresponding turbulence anisotropy. Under strong expansion, the small-scale anisotropy is consistent with the Goldreich & Sridhar critical balance. As in previous works, when the radial symmetry axis is not eliminated, the turbulent structures are field-aligned tubes. Under weak expansion, we find 3D anisotropy predicted by the Boldyrev model, that is, turbulent structures are ribbons and not tubes. However, the very basis of the Boldyrev phenomenology, namely, a cross-helicity increasing at small scales, is not observed in the solar wind: the origin of the ribbon formation is unknown.

  14. Analysis of Ion Charge States in Solar Wind and CMEs Arati ...

    Indian Academy of Sciences (India)

    states of various elements observed in situ in the solar wind and CMEs. The competing processes of ionization and recombination lead to depar- tures from collision ionization equilibrium. The use of this as a diagnostic of acceleration and heating processes of the solar wind and CMEs is sensi- tive to the accuracy of the ...

  15. Economic viability of wind and solar energy for industrial use

    International Nuclear Information System (INIS)

    Lashkari, Z.F.

    1994-01-01

    Non conventional energy sources have begun to move from fringes of technological possibility towards commercial viability. Out of the four sources, i e. solar, wind, biogas and minimicro hydel the first two viz. wind and solar energy are of relevance for industries in western region of India. This has to be seen in the context of developments in technology and hence economics both worldwide and in India. (author)

  16. On the nature of obstacles braking solar wind near Mars and Venera planets and on specific features of the interaction between solar wind and atmospheres of these planets

    International Nuclear Information System (INIS)

    Breus, T.K.; Gringauz, K.I.

    1980-01-01

    Discussed is the nature of obstacles braking solar wind near Mars and Venera according to the data of soviet measurements at ''Mars'' and ''Venera'' series automatic interplanetary stations. It is shown that alongside with essential similarity there exist differences among the zones of flow-around of Venera and Mars by solar wind. Such differences include, particularly, smaller dimensions of the obstacle of Venera as compared with Mars, and correspondingly less remote position of the shock wave front from the planet, different peculiarities of property changes of day-time ionosphere depending on the Sun zenith angle and other. The analysis of the experimental data permits to conclude that ionosphere and correspondingly the induced magnetic field of Venera play a determining role in the formation of the shock wave and the picture of planet flow-around by solar wind, while the determining role in the obstacle formation braking solar wind of Mars is played by the eigen planet field

  17. Energy Cascade Rate in Compressible Fast and Slow Solar Wind Turbulence

    Energy Technology Data Exchange (ETDEWEB)

    Hadid, L. Z.; Sahraoui, F.; Galtier, S., E-mail: lina.hadid@lpp.polytechnique.fr [LPP, CNRS, Ecole Polytechnique, UPMC Univ Paris 06, Univ. Paris-Sud, Observatoire de Paris, Université Paris-Saclay, Sorbonne Universités, PSL Research University, F-91128 Palaiseau (France)

    2017-03-20

    Estimation of the energy cascade rate in the inertial range of solar wind turbulence has been done so far mostly within incompressible magnetohydrodynamics (MHD) theory. Here, we go beyond that approximation to include plasma compressibility using a reduced form of a recently derived exact law for compressible, isothermal MHD turbulence. Using in situ data from the THEMIS / ARTEMIS spacecraft in the fast and slow solar wind, we investigate in detail the role of the compressible fluctuations in modifying the energy cascade rate with respect to the prediction of the incompressible MHD model. In particular, we found that the energy cascade rate (1) is amplified particularly in the slow solar wind; (2) exhibits weaker fluctuations in spatial scales, which leads to a broader inertial range than the previous reported ones; (3) has a power-law scaling with the turbulent Mach number; (4) has a lower level of spatial anisotropy. Other features of solar wind turbulence are discussed along with their comparison with previous studies that used incompressible or heuristic (nonexact) compressible MHD models.

  18. Energy Cascade Rate in Compressible Fast and Slow Solar Wind Turbulence

    International Nuclear Information System (INIS)

    Hadid, L. Z.; Sahraoui, F.; Galtier, S.

    2017-01-01

    Estimation of the energy cascade rate in the inertial range of solar wind turbulence has been done so far mostly within incompressible magnetohydrodynamics (MHD) theory. Here, we go beyond that approximation to include plasma compressibility using a reduced form of a recently derived exact law for compressible, isothermal MHD turbulence. Using in situ data from the THEMIS / ARTEMIS spacecraft in the fast and slow solar wind, we investigate in detail the role of the compressible fluctuations in modifying the energy cascade rate with respect to the prediction of the incompressible MHD model. In particular, we found that the energy cascade rate (1) is amplified particularly in the slow solar wind; (2) exhibits weaker fluctuations in spatial scales, which leads to a broader inertial range than the previous reported ones; (3) has a power-law scaling with the turbulent Mach number; (4) has a lower level of spatial anisotropy. Other features of solar wind turbulence are discussed along with their comparison with previous studies that used incompressible or heuristic (nonexact) compressible MHD models.

  19. Non-Extensive Statistical Analysis of Solar Wind Electric, Magnetic Fields and Solar Energetic Particle time series.

    Science.gov (United States)

    Pavlos, G. P.; Malandraki, O.; Khabarova, O.; Livadiotis, G.; Pavlos, E.; Karakatsanis, L. P.; Iliopoulos, A. C.; Parisis, K.

    2017-12-01

    In this work we study the non-extensivity of Solar Wind space plasma by using electric-magnetic field data obtained by in situ spacecraft observations at different dynamical states of solar wind system especially in interplanetary coronal mass ejections (ICMEs), Interplanetary shocks, magnetic islands, or near the Earth Bow shock. Especially, we study the energetic particle non extensive fractional acceleration mechanism producing kappa distributions as well as the intermittent turbulence mechanism producing multifractal structures related with the Tsallis q-entropy principle. We present some new and significant results concerning the dynamics of ICMEs observed in the near Earth at L1 solar wind environment, as well as its effect in Earth's magnetosphere as well as magnetic islands. In-situ measurements of energetic particles at L1 are analyzed, in response to major solar eruptive events at the Sun (intense flares, fast CMEs). The statistical characteristics are obtained and compared for the Solar Energetic Particles (SEPs) originating at the Sun, the energetic particle enhancements associated with local acceleration during the CME-driven shock passage over the spacecraft (Energetic Particle Enhancements, ESPs) as well as the energetic particle signatures observed during the passage of the ICME. The results are referred to Tsallis non-extensive statistics and in particular to the estimation of Tsallis q-triplet, (qstat, qsen, qrel) of electric-magnetic field and the kappa distributions of solar energetic particles time series of the ICME, magnetic islands, resulting from the solar eruptive activity or the internal Solar Wind dynamics. Our results reveal significant differences in statistical and dynamical features, indicating important variations of the magnetic field dynamics both in time and space domains during the shock event, in terms of rate of entropy production, relaxation dynamics and non-equilibrium meta-stable stationary states.

  20. Solar wind heavy ions from energetic coronal events

    International Nuclear Information System (INIS)

    Bame, S.J.

    1978-01-01

    Ions heavier than those of He can be resolved in the solar wind with electrostatic E/q analyzers when the local thermal temperatures are low. Ordinarily this condition prevails in the low speed solar wind found between high speed streams, i.e. the interstream, IS, solar wind. Various ions of O, Si and Fe are resolved in IS heavy ion spectra. Relative ion peak intensities indicate that the O ionization state is established in the IS coronal source regions at approx. 2.1 x 10 6 K while the state of Fe is frozen in at approx. 1.5 x 10 6 K farther out. Occasionally, anomalous spectra are observed in which the usually third most prominent ion peak, O 8+ , is depressed as are the Fe peaks ranging from Fe 12+ to Fe 7+ . A prominent peak in the usual Si 8+ position of IS spectra is self-consistently shown to be Fe 16+ . These features demonstrate that the ionization states were frozen in at higher than usual coronal temperatures. The source regions of these hot heavy ion spectra are identified as energetic coronal events including flares and nonflare coronal mass ejections. 24 references

  1. Solar Wind Proton Temperature Anisotropy: Linear Theory and WIND/SWE Observations

    Science.gov (United States)

    Hellinger, P.; Travnicek, P.; Kasper, J. C.; Lazarus, A. J.

    2006-01-01

    We present a comparison between WIND/SWE observations (Kasper et al., 2006) of beta parallel to p and T perpendicular to p/T parallel to p (where beta parallel to p is the proton parallel beta and T perpendicular to p and T parallel to p are the perpendicular and parallel proton are the perpendicular and parallel proton temperatures, respectively; here parallel and perpendicular indicate directions with respect to the ambient magnetic field) and predictions of the Vlasov linear theory. In the slow solar wind, the observed proton temperature anisotropy seems to be constrained by oblique instabilities, by the mirror one and the oblique fire hose, contrary to the results of the linear theory which predicts a dominance of the proton cyclotron instability and the parallel fire hose. The fast solar wind core protons exhibit an anticorrelation between beta parallel to c and T perpendicular to c/T parallel to c (where beta parallel to c is the core proton parallel beta and T perpendicular to c and T parallel to c are the perpendicular and parallel core proton temperatures, respectively) similar to that observed in the HELIOS data (Marsch et al., 2004).

  2. Self consistent MHD modeling of the solar wind from coronal holes with distinct geometries

    Science.gov (United States)

    Stewart, G. A.; Bravo, S.

    1995-01-01

    Utilizing an iterative scheme, a self-consistent axisymmetric MHD model for the solar wind has been developed. We use this model to evaluate the properties of the solar wind issuing from the open polar coronal hole regions of the Sun, during solar minimum. We explore the variation of solar wind parameters across the extent of the hole and we investigate how these variations are affected by the geometry of the hole and the strength of the field at the coronal base.

  3. A study on evaluating the power generation of solar-wind hybrid systems in Izmir, Turkey

    Energy Technology Data Exchange (ETDEWEB)

    Ulgen, K. [Ege Univ., Solar Energy Inst., Izmir (Turkey); Hepbasli, A. [Ege Univ., Dept. of Mechanical Engineering, Izmir (Turkey)

    2003-03-15

    Turkey is abundant in terms of renewable energy resources. Residential and industrial utilization of solar energy started in the 1980s, while the first Build-Operate-Transfer (BOT) windmill park, located at Alacati, Izmir, was commissioned in 1998. Additionally, power generation through solar-wind hybrid systems has recently appeared on the Turkish market. This study investigates the wind and solar thermal power availability in Izmir, located in the western part of Turkey. Simple models were developed to determine wind, solar, and hybrid power resources per unit area. Experimental data, consisting of hourly records over a 5 yr period, 1995-1999, were measured in the Solar/Wind Meteorological Station of the Solar Energy Institute at Ege University. Correlations between solar and wind power data were carried out on an hourly, a daily, and a monthly basis. It can be concluded that possible applications of hybrid systems could be considered for the efficient utilization of these resources. (Author)

  4. Data Assimilation in the Solar Wind: Challenges and First Results.

    Science.gov (United States)

    Lang, Matthew; Browne, Philip; van Leeuwen, Peter Jan; Owens, Mathew

    2017-11-01

    Data assimilation (DA) is used extensively in numerical weather prediction (NWP) to improve forecast skill. Indeed, improvements in forecast skill in NWP models over the past 30 years have directly coincided with improvements in DA schemes. At present, due to data availability and technical challenges, DA is underused in space weather applications, particularly for solar wind prediction. This paper investigates the potential of advanced DA methods currently used in operational NWP centers to improve solar wind prediction. To develop the technical capability, as well as quantify the potential benefit, twin experiments are conducted to assess the performance of the Local Ensemble Transform Kalman Filter (LETKF) in the solar wind model ENLIL. Boundary conditions are provided by the Wang-Sheeley-Arge coronal model and synthetic observations of density, temperature, and momentum generated every 4.5 h at 0.6 AU. While in situ spacecraft observations are unlikely to be routinely available at 0.6 AU, these techniques can be applied to remote sensing of the solar wind, such as with Heliospheric Imagers or interplanetary scintillation. The LETKF can be seen to improve the state at the observation location and advect that improvement toward the Earth, leading to an improvement in forecast skill in near-Earth space for both the observed and unobserved variables. However, sharp gradients caused by the analysis of a single observation in space resulted in artificial wavelike structures being advected toward Earth. This paper is the first attempt to apply DA to solar wind prediction and provides the first in-depth analysis of the challenges and potential solutions.

  5. A Review of Hybrid Solar PV and Wind Energy System

    Directory of Open Access Journals (Sweden)

    Rashid Al Badwawi

    2015-07-01

    Full Text Available Due to the fact that solar and wind power is intermittent and unpredictable in nature, higher penetration of their types in existing power system could cause and create high technical challenges especially to weak grids or stand-alone systems without proper and enough storage capacity. By integrating the two renewable resources into an optimum combination, the impact of the variable nature of solar and wind resources can be partially resolved and the overall system becomes more reliable and economical to run. This paper provides a review of challenges and opportunities / solutions of hybrid solar PV and wind energy integration systems. Voltage and frequency fluctuation, and harmonics are major power quality issues for both grid-connected and stand-alone systems with bigger impact in case of weak grid. This can be resolved to a large extent by having proper design, advanced fast response control facilities, and good optimization of the hybrid systems. The paper gives a review of the main research work reported in the literature with regard to optimal sizing design, power electronics topologies and control. The paper presents a review of the state of the art of both grid-connected and stand-alone hybrid solar and wind systems.

  6. Analysis of Solar Wind Precipitation on Mars Using MAVEN/SWIA Observations of Spacecraft-Scattered Ions

    Science.gov (United States)

    Lue, C.; Halekas, J. S.

    2017-12-01

    Particle sensors on the MAVEN spacecraft (SWIA, SWEA, STATIC) observe precipitating solar wind ions during MAVEN's periapsis passes in the Martian atmosphere (at 120-250 km altitude). The signature is observed as positive and negative particles at the solar wind energy, traveling away from the Sun. The observations can be explained by the solar wind penetrating the Martian magnetic barrier in the form of energetic neutral atoms (ENAs) due to charge-exchange with the Martian hydrogen corona, and then being reionized in positive or negative form upon impact with the atmosphere (1). These findings have elucidated solar wind precipitation dynamics at Mars, and can also be used to monitor the solar wind even when MAVEN is at periapsis (2). In the present study, we focus on a SWIA instrument background signal that has been interpreted as spacecraft/instrument-scattered ions (2). We aim to model and subtract the scattered ion signal from the observations including those of reionized solar wind. We also aim to use the scattered ion signal to track hydrogen ENAs impacting the spacecraft above the reionization altitude. We characterize the energy spectrum and directional scattering function for solar wind scattering off the SWIA aperture structure, the radome and the spacecraft body. We find a broad scattered-ion energy spectrum up to the solar wind energy, displaying increased energy loss and reduced flux with increasing scattering angle, allowing correlations with the solar wind direction, energy, and flux. We develop models that can be used to predict the scattered signal based on the direct solar wind observations or to infer the solar wind properties based on the observed scattered signal. We then investigate deviations to the models when the spacecraft is in the Martian atmosphere and evaluate the plausibility of that these are caused by ENAs. We also perform SIMION modeling of the scattering process and the resulting signal detection by SWIA, to study the results from

  7. Predicting geomagnetic storms from solar-wind data using time-delay neural networks

    Directory of Open Access Journals (Sweden)

    H. Gleisner

    1996-07-01

    Full Text Available We have used time-delay feed-forward neural networks to compute the geomagnetic-activity index Dst one hour ahead from a temporal sequence of solar-wind data. The input data include solar-wind density n, velocity V and the southward component Bz of the interplanetary magnetic field. Dst is not included in the input data. The networks implement an explicit functional relationship between the solar wind and the geomagnetic disturbance, including both direct and time-delayed non-linear relations. In this study we especially consider the influence of varying the temporal size of the input-data sequence. The networks are trained on data covering 6600 h, and tested on data covering 2100 h. It is found that the initial and main phases of geomagnetic storms are well predicted, almost independent of the length of the input-data sequence. However, to predict the recovery phase, we have to use up to 20 h of solar-wind input data. The recovery phase is mainly governed by the ring-current loss processes, and is very much dependent on the ring-current history, and thus also the solar-wind history. With due consideration of the time history when optimizing the networks, we can reproduce 84% of the Dst variance.

  8. Effects of electrons on the solar wind proton temperature anisotropy

    International Nuclear Information System (INIS)

    Michno, M. J.; Lazar, M.; Schlickeiser, R.; Yoon, P. H.

    2014-01-01

    Among the kinetic microinstabilities, the firehose instability is one of the most efficient mechanisms to restrict the unlimited increase of temperature anisotropy in the direction of an ambient magnetic field as predicted by adiabatic expansion of collision-poor solar wind. Indeed, the solar wind proton temperature anisotropy detected near 1 AU shows that it is constrained by the marginal firehose condition. Of the two types of firehose instabilities, namely, parallel and oblique, the literature suggests that the solar wind data conform more closely to the marginal oblique firehose condition. In the present work, however, it is shown that the parallel firehose instability threshold is markedly influenced by the presence of anisotropic electrons, such that under some circumstances, the cumulative effects of both electron and proton anisotropies could describe the observation without considering the oblique firehose mode.

  9. Average properties of cosmic ray diffusion in solar wind streams

    International Nuclear Information System (INIS)

    Morfill, G.; Richter, A.K.; Scholer, M.

    1979-01-01

    Applying a superposed epoch analysis to the Mariner 5 plasma and magnetic field observations of 13 corotating high speed solar wind streams, we obtain the average azimuthal distribution of all relevant parameters of the background interplanetary medium, as well as those of superimposed Alfven waves. Using these measurements in model calculations allows us to determine the radial and azimuthal variation of the background and fluctuation parameters between 1 and 5 AU, and thus to calculate the cosmic ray diffusion coefficient kappa from the plasma and field properties. The calculation of kappa assumes that quasi-linear wave-particle interaction theory is applicable, and that the Alfven waves responsible for the scattering are propagating in the azimuthally varying solar wind according to geometrical optics. The consequences of these calculations regarding the occurrence of solar wind stream associated Forbush decreases are discussed

  10. Temporal and radial variation of the solar wind temperature-speed relationship

    Science.gov (United States)

    Elliott, H. A.; Henney, C. J.; McComas, D. J.; Smith, C. W.; Vasquez, B. J.

    2012-09-01

    The solar wind temperature (T) and speed (V) are generally well correlated at ˜1 AU, except in Interplanetary Coronal Mass Ejections where this correlation breaks down. We perform a comprehensive analysis of both the temporal and radial variation in the temperature-speed (T-V) relationship of the non-transient wind, and our analysis provides insight into both the causes of the T-V relationship and the sources of the temperature variability. Often at 1 AU the speed-temperature relationship is well represented by a single linear fit over a speed range spanning both the slow and fast wind. However, at times the fast wind from coronal holes can have a different T-V relationship than the slow wind. A good example of this was in 2003 when there was a very large and long-lived outward magnetic polarity coronal hole at low latitudes that emitted wind with speeds as fast as a polar coronal hole. The long-lived nature of the hole made it possible to clearly distinguish that some holes can have a different T-V relationship. In an earlier ACE study, we found that both the compressions and rarefactions T-V curves are linear, but the compression curve is shifted to higher temperatures. By separating compressions and rarefactions prior to determining the radial profiles of the solar wind parameters, the importance of dynamic interactions on the radial evolution of the solar wind parameters is revealed. Although the T-V relationship at 1 AU is often well described by a single linear curve, we find that the T-V relationship continually evolves with distance. Beyond ˜2.5 AU the differences between the compressions and rarefactions are quite significant and affect the shape of the overall T-V distribution to the point that a simple linear fit no longer describes the distribution well. Since additional heating of the ambient solar wind outside of interaction regions can be associated with Alfvénic fluctuations and the turbulent energy cascade, we also estimate the heating rate

  11. Magnetosheath waves under very low solar wind dynamic pressure: Wind/Geotail observations

    Directory of Open Access Journals (Sweden)

    C. J. Farrugia

    2005-06-01

    Full Text Available The expanded bow shock on and around "the day the solar wind almost disappeared" (11 May 1999 allowed the Geotail spacecraft to make a practically uninterrupted 54-h-long magnetosheath pass near dusk (16:30-21:11 magnetic local time at a radial distance of 24 to 30 RE (Earth radii. During most of this period, interplanetary parameters varied gradually and in such a way as to give rise to two extreme magnetosheath structures, one dominated by magnetohydrodynamic (MHD effects and the other by gas dynamic effects. We focus attention on unusual features of electromagnetic ion wave activity in the former magnetosheath state, and compare these features with those in the latter. Magnetic fluctuations in the gas dynamic magnetosheath were dominated by compressional mirror mode waves, and left- and right-hand polarized electromagnetic ion cyclotron (EIC waves transverse to the background field. In contrast, the MHD magnetosheath, lasting for over one day, was devoid of mirror oscillations and permeated instead by EIC waves of weak intensity. The weak wave intensity is related to the prevailing low solar wind dynamic pressures. Left-hand polarized EIC waves were replaced by bursts of right-hand polarized waves, which remained for many hours the only ion wave activity present. This activity occurred when the magnetosheath proton temperature anisotropy (= became negative. This was because the weakened bow shock exposed the magnetosheath directly to the (negative temperature anisotropy of the solar wind. Unlike the normal case studied in the literature, these right-hand waves were not by-products of left-hand polarized waves but derived their energy source directly from the magnetosheath temperature anisotropy. Brief entries into the low latitude boundary layer (LLBL and duskside magnetosphere occurred under such inflated conditions that the magnetospheric magnetic pressure was insufficient to maintain pressure balance. In these crossings, the inner edge of

  12. DEPENDENCE OF SOLAR-WIND POWER SPECTRA ON THE DIRECTION OF THE LOCAL MEAN MAGNETIC FIELD

    International Nuclear Information System (INIS)

    Podesta, J. J.

    2009-01-01

    Wavelet analysis can be used to measure the power spectrum of solar-wind fluctuations along a line in any direction (θ, φ) with respect to the local mean magnetic field B 0 . This technique is applied to study solar-wind turbulence in high-speed streams in the ecliptic plane near solar minimum using magnetic field measurements with a cadence of eight vectors per second. The analysis of nine high-speed streams shows that the reduced spectrum of magnetic field fluctuations (trace power) is approximately azimuthally symmetric about B 0 in both the inertial range and dissipation range; in the inertial range the spectra are characterized by a power-law exponent that changes continuously from 1.6 ± 0.1 in the direction perpendicular to the mean field to 2.0 ± 0.1 in the direction parallel to the mean field. The large uncertainties suggest that the perpendicular power-law indices 3/2 and 5/3 are both consistent with the data. The results are similar to those found by Horbury et al. at high heliographic latitudes. Comparisons between solar-wind observations and the theories of strong incompressible MHD turbulence developed by Goldreich and Sridhar and Boldyrev are not rigorously justified because these theories only apply to turbulence with vanishing cross-helicity although the normalized cross-helicity of solar-wind turbulence is not negligible. Assuming these theories can be generalized in such a way that the three-dimensional wavevector spectra have similar functional forms when the cross-helicity is nonzero, then for the interval of Ulysses data analyzed by Horbury et al. the ratio of the spectra perpendicular and parallel to B 0 is more consistent with the Goldreich and Sridhar scaling P perpendicular /P || ∝ ν 1/3 than with the Boldyrev scaling ν 1/2 . The analysis of high-speed streams in the ecliptic plane does not yield a reliable measurement of this scaling law. The transition from a turbulent MHD-scale energy cascade to a kinetic Alfven wave (KAW

  13. Observations of the solar wind speed near the sun

    International Nuclear Information System (INIS)

    Grall, R. R.; Coles, Wm. A.; Klinglesmith, M. T.

    1996-01-01

    Two-antenna scintillation (IPS) observations can provide accurate measurements of the velocity with which electron density fluctuations drift past the line of sight. These fluctuations can be used as tracers for the solar plasma and allow us to estimate the solar wind velocity near the Sun where spacecraft have not yet penetrated. We present recent IPS measurements made with the EISCAT and VLBA arrays. We have found that by using baselines which are several times the scale size of the diffraction pattern we are able to partially deconvolve the line of sight integration which affects remote sensing data. The long baselines allow the fast and slow components of the solar wind to be separated and their velocities estimated individually. In modeling IPS it is important that the scattering be 'weak' because the model then requires only 1 spatial parameter instead of 3. EISCAT can only operate near 933MHz which limits the observation to outside of 18R · , however the VLBA has higher frequency receivers which allow it to observe inside of 15R · . The density variance δN e 2 in the fast wind is a factor of 10-15 less than in the slow (Coles et al., 1995) making it necessary to consider the entire line of sight, particularly when the fast wind occupies the center portion. Using the point of closest approach and the average velocity to characterize the observation can lead to an incorrect interpretation of the data. We have compared our IPS observations with maps made from the Yohkoh soft X ray, HAO's white-light electron density, and Stanford magnetic field measurements as well as with the IMP8 and Ulysses spacecraft data to assist in placing the fast and slow wind. Here we have selected those observation from 1994 which were dominated by the southern coronal hole and have estimated a velocity acceleration profile for the fast solar wind between 7 and 100R · which is presented in Figure 1. The observations suggest that the fast solar wind is fully developed by ≅7R

  14. SOHO celebrates its first year in space with new results on the solar wind

    Science.gov (United States)

    1996-12-01

    degrees, in contrast with the temperature of less than 6000 degrees C of the visible surface. Acronyms : CDS : Coronal Diagnostic Spectrometer (PI : R. Harrison, RAL, England) CELIAS : Charge, Element and Isotope Analysis System (PI : P. Bochsler, Bern University, Switzerland) COSTEP : Comprehensive SupraThermal and Energetic Particle analyser (PI : H. Kunow, University of Kiel, Germany) EIT : Extreme-ultraviolet Imaging Telescope (PI : J.P. Delaboudini[re, IAS Orsay, France) ERNE : Energetic and Relativistic Nuclei and Electron experiment (PI : J. Torsti, University of Turku, Finland) GOLF : Global Oscillations at Low Frequencies (PI: A. Gabriel, IAS Orsay, France) LASCO : Large Angle Spectroscopic Coronagraph (PI: G. Brueckner, NRL Washington, USA) MDI : Michelson Doppler Imager (PI : P. Scherrer, Stanford University, USA) SUMER : Solar Ultraviolet Measurements of Emitted Radiation (PI : K. Wilhelm, MPAe Lindau, Germany) SWAN : Solar Wind Anisotropies (PI : J.L. Bertaux, SA Verri[res le Buisson, France) UVCS : UltraViolet Coronagraph Spectrometer (PI: J. Kohl, SAO, Cambridge, USA) VIRGO : Variability of solar Irradiance and Gravity Oscillations (PI: C. Froehlich, PMOD/WRC Davos, Switzerland) SOHO : Solar and Heliospheric Observatory Figure: The Sun's outer atmosphere Photo credits : SOHO : (UVCS and EIT consortia) : ESA, NASA UVCS : Smithsonian Astrophysical Observatory, University of Florence and Agenzia Spaziale Italiana (Italy) EIT : Institut d'Astrophysique Spatiale, Orsay, France, Centre Spatial de Li[ge, Belgium, Naval Research Laboratory, Goddard Space Flight Center SOHO is a project of international cooperation between ESA and NASA

  15. A data mining approach: Analyzing wind speed and insolation period data in Turkey for installations of wind and solar power plants

    International Nuclear Information System (INIS)

    Colak, Ilhami; Sagiroglu, Seref; Demirtas, Mehmet; Yesilbudak, Mehmet

    2013-01-01

    Highlights: ► Wind speed and insolation period data were analyzed using a data mining approach. ► Most of the studies in the literature were based on Weibull and Rayleigh models. ► Nearest and farest neighbor algorithms were used with different distance metrics. ► Many inferences were achieved in efficient limits for wind and solar farm analyses. - Abstract: Wind and solar power plant installations have been recently increased rapidly with respect to the depletion of fossil-based fuels all over the world. Due to stochastic nature of meteorological conditions, wind and solar energies have a non-schedulable nature and they require several installation analyses to determine the location and the capacities of wind and solar power to be produced. This paper focuses on the similarity, feasibility and numerical analyses of 75 cities in Turkey based on the monthly average wind speed and insolation period data. The nearest and the farest neighbor algorithms are used as agglomerative hierarchical clustering methods with Euclidean, Manhattan and Minkowski distance metrics in the stage of making the similarity and feasibility analyses. The maximum cophenetic correlation coefficient is achieved by the nearest neighbor algorithm with the Minkowski distance metric in the similarity and feasibility analyses. On the other hand, graphical representations of the monthly average wind speed and insolation period data are utilized for making the numerical analysis. The highest annual average wind speed and insolation period are obtained as 3.88 m/s and 8.45 h/day, respectively. Overall, many inferences were achieved in acceptable and efficient limits for wind and solar energy.

  16. Wind and Solar Energy Role in the Achievement of EU Climate Policy After 2020

    International Nuclear Information System (INIS)

    Knezevic, S.

    2016-01-01

    This paper grades the possible role of solar and wind energy in the generation of electricity after 2020. The development of those energy sources will be defined by the climate policy implemented based on the last year's Paris Climate Agreement, but also by the existing initiatives of the European Commission (2030 climate and energy framework and 2050 low-carbon economy). Additionally, electricity generation from RES is observed through the decrease of dependency on the import of fossil fuels outside of the EU. According to the report of the International Renewable Energy Agency (IRENA), the biggest share of RES power plants, after hydro power plants, in EU are wind and solar power plants. Both wind and sun are constantly available resources, but with variable specific power, which makes the maximal generation dependent on the time of day and/or weather (wind, clouds). Future increase of wind and solar energy has to be observed from various perspectives as to properly grade it for the next period, until 2020. Therefore, this paper considers the following, intertwined aspects: Maturity of wind and solar technologies and future trends, Price of electricity generation from wind and solar power plants, with an analysis of price decreasing trends; Possibilities of power energy system and measures for the acceptance of wind and solar power plants; Integrative approach to all forms and transformations of electricity; Market integration of RES - aspirations towards free trade(author).

  17. Solar and wind potentialities in Mauritania. Presentation of pumping

    International Nuclear Information System (INIS)

    Adell, A.; Fagel, L.

    1996-01-01

    The programs of rural hydraulics based upon the use of renewable energies, either solar or wind, have gained in importance in Africa during the last decade; particularly in Mauritania, a Sahelian country, which is extending widely beyond the western edge of Sahara. This country has been hardly affected by the prolonged droughts which have recently struck this region. Water is a major problem here. Important projects appeared concerning the pumping of water with the help of solar photovoltaic systems and wind mechanical pumps; other processes are being studied: pumping with aero-generators, sea water desalinating... Today Mauritania is at the top of countries of the subregion concerning the number of installations of wind mechanical pumps. The meteorological conditions are in fact favourable to such realizations. A technical and economic comparative study of the results of functioning obtained on the field with a photovoltaic pumping installation and a wind pumping installation, is presented: better technical performances and greater reliability for the photovoltaic pump, lower cost and technological mastery for the wind pump. (author). 9 refs., 8 figs

  18. Global aspects of stream evolution in the solar wind

    International Nuclear Information System (INIS)

    Gosling, J.T.

    1984-01-01

    A spatially variable coronal expansion, when coupled with solar rotation, leads to the formation of high speed solar wind streams which evolve considerably with increasing heliocentric distance. Initially the streams steepen for simple kinematic reasons, but this steepening is resisted by pressure forces, leading eventually to the formation of forward-reverse shock pairs in the distant heliosphere. The basic physical processes responsible for stream steepening an evolution are explored and model calculations are compared with actual spacecraft observations of the process. The solar wind stream evolution problem is relatively well understood both observationally and theoretically. Tools developed in achieving this understanding should be applicable to other astrophysical systems where a spatially or temporally variable outflow is associated with a rotating object. 27 references, 13 figures

  19. Vortex, ULF wave and Aurora Observation after Solar Wind Dynamic Pressure Change

    Science.gov (United States)

    Shi, Q.

    2017-12-01

    Here we will summarize our recent study and show some new results on the Magnetosphere and Ionosphere Response to Dynamic Pressure Change/disturbances in the Solar Wind and foreshock regions. We study the step function type solar wind dynamic pressure change (increase/decrease) interaction with the magnetosphere using THEMIS satellites at both dayside and nightside in different geocentric distances. Vortices generated by the dynamic pressure change passing along the magnetopause are found and compared with model predictions. ULF waves and vortices are excited in the dayside and nightside plasma sheet when dynamic pressure change hit the magnetotail. The related ionospheric responses, such as aurora and TCVs, are also investigated. We compare Global MHD simulations with the observations. We will also show some new results that dayside magnetospheric FLRs might be caused by foreshock structures.Shi, Q. Q. et al. (2013), THEMIS observations of ULF wave excitation in the nightside plasma sheet during sudden impulse events, J. Geophys. Res. Space Physics, 118, doi:10.1029/2012JA017984. Shi, Q. Q. et al. (2014), Solar wind pressure pulse-driven magnetospheric vortices and their global consequences, J. Geophys. Res. Space Physics, 119, doi:10.1002/2013JA019551. Tian, A.M. et al.(2016), Dayside magnetospheric and ionospheric responses to solar wind pressure increase: Multispacecraft and ground observations, J. Geophys. Res., 121, doi:10.1002/2016JA022459. Shen, X.C. et al.(2015), Magnetospheric ULF waves with increasing amplitude related to solar wind dynamic pressure changes: THEMIS observations, J. Geophys. Res., 120, doi:10.1002/2014JA020913Zhao, H. Y. et al. (2016), Magnetospheric vortices and their global effect after a solar wind dynamic pressure decrease, J. Geophys. Res. Space Physics, 121, doi:10.1002/2015JA021646. Shen, X. C., et al. (2017), Dayside magnetospheric ULF wave frequency modulated by a solar wind dynamic pressure negative impulse, J. Geophys. Res

  20. Contribution to the study of the wind and solar radiation over Guadeloupe

    International Nuclear Information System (INIS)

    Bertin, A.; Frangi, J.P.

    2013-01-01

    Highlights: • We study wind and solar resource in Guadeloupe (FWI). • Weibull distributions reveal a nocturnal radiative layer blocking wind at airport. • We provide monthly and annual irradiations, horizontal and tilted, for four sites. • Five Linke turbidity coefficient calculation methods are reviewed and compared. - Abstract: Guadeloupean archipelago must reach energy autonomy in 2030 and include at least 50% of renewables in 2020, where wind and photovoltaics can play a significant role. Still, Guadeloupe gathers a lot of landscapes having great impact on wind and solar resource. Study of three 10-years database and one 5-year database locates a nocturnal radiative layer above the airport meteorological station, drastically limiting the wind potential there, and gives all the irradiation components (monthly sums) and therefore key parameters for photovoltaic energy yield. This paper also points out the underestimation of Linke turbidity coefficient in the airport station with Solar Radiation Database (SoDa), compared to ground-based determination, and calculates the value of this coefficient for three stations across Guadeloupe. All those parameters are discussed, as being of importance to make fair predictions of statistical relationships involving preliminary assessment and modeling of wind and solar energy systems. These results can then be used in neighboring countries, Guadeloupe having various meteorological conditions retrieved in Caribbean

  1. The most intense current sheets in the high-speed solar wind near 1 AU

    Science.gov (United States)

    Podesta, John J.

    2017-03-01

    Electric currents in the solar wind plasma are investigated using 92 ms fluxgate magnetometer data acquired in a high-speed stream near 1 AU. The minimum resolvable scale is roughly 0.18 s in the spacecraft frame or, using Taylor's "frozen turbulence" approximation, one proton inertial length di in the plasma frame. A new way of identifying current sheets is developed that utilizes a proxy for the current density J obtained from the derivatives of the three orthogonal components of the observed magnetic field B. The most intense currents are identified as 5σ events, where σ is the standard deviation of the current density. The observed 5σ events are characterized by an average scale size of approximately 3di along the flow direction of the solar wind, a median separation of around 50di or 100di along the flow direction of the solar wind, and a peak current density on the order of 0.5 pA/cm2. The associated current-carrying structures are consistent with current sheets; however, the planar geometry of these structures cannot be confirmed using single-point, single-spacecraft measurements. If Taylor's hypothesis continues to hold for the energetically dominant fluctuations at kinetic scales 1wind occur at electron scales, although the peak current densities at kinetic and electron scales are predicted to be nearly the same as those found in this study.

  2. Modeling Solar-Wind Heavy-Ions' Potential Sputtering of Lunar KREEP Surface

    Science.gov (United States)

    Barghouty, A. F.; Meyer, F. W.; Harris, R. P.; Adams, J. H., Jr.

    2012-01-01

    Recent laboratory data suggest that potential sputtering may be an important weathering mechanism that can affect the composition of both the lunar surface and its tenuous exosphere; its role and implications, however, remain unclear. Using a relatively simple kinetic model, we will demonstrate that solar-wind heavy ions induced sputtering of KREEP surfaces is critical in establishing the timescale of the overall solar-wind sputtering process of the lunar surface. We will also also show that potential sputtering leads to a more pronounced and significant differentiation between depleted and enriched surface elements. We briefly discuss the impacts of enhanced sputtering on the composition of the regolith and the exosphere, as well as of solar-wind sputtering as a source of hydrogen and water on the moon.

  3. Geometry of the solar wind transition region during the 11-year solar cycle

    International Nuclear Information System (INIS)

    Lotova, N.A.; Blums, D.F.

    1986-01-01

    Geometry of the solar wind transition region and its dynamics during the 11-year solar cycle is investigated. It is shown that the space geometry of the transition region suffers considerable changes. In the years of minimum of solar activity (1975-1977) the transition region has a form close to elliptical, shifts nearer to the Sun, while its width decreases. During the years of maximum of Solar activity (1979-1981) the form of the transition region becomes close to spherically symmetric, is located further from the Sun and its width is increased

  4. Polar and equatorial coronal hole winds at solar minima: From the heliosphere to the inner corona

    Energy Technology Data Exchange (ETDEWEB)

    Zhao, L.; Landi, E., E-mail: lzh@umich.edu [Department of Atmospheric, Oceanic, and Space Sciences, University of Michigan, Ann Arbor, MI 48105 (United States)

    2014-02-01

    Fast solar wind can be accelerated from at least two different sources: polar coronal holes and equatorial coronal holes. Little is known about the relationship between the wind coming from these two different latitudes and whether these two subcategories of fast wind evolve in the same way during the solar cycle. Nineteen years of Ulysses observations, from 1990 to 2009, combined with ACE observations from 1998 to the present provide us with in situ measurements of solar wind properties that span two entire solar cycles. These missions provide an ideal data set to study the properties and evolution of the fast solar wind originating from equatorial and polar holes. In this work, we focus on these two types of fast solar wind during the minima between solar cycles 22 and 23 and 23 and 24. We use data from SWICS, SWOOPS, and VHM/FGM on board Ulysses and SWICS, SWEPAM, and MAG on board ACE to analyze the proton kinetic, thermal, and dynamic characteristics, heavy ion composition, and magnetic field properties of these two fast winds. The comparison shows that: (1) their kinetic, thermal, compositional, and magnetic properties are significantly different at any time during the two minima and (2) they respond differently to the changes in solar activity from cycle 23 to 24. These results indicate that equatorial and polar fast solar wind are two separate subcategories of fast wind. We discuss the implications of these results and relate them to remote-sensing measurements of the properties of polar and equatorial coronal holes carried out in the inner corona during these two solar minima.

  5. Polar and equatorial coronal hole winds at solar minima: From the heliosphere to the inner corona

    International Nuclear Information System (INIS)

    Zhao, L.; Landi, E.

    2014-01-01

    Fast solar wind can be accelerated from at least two different sources: polar coronal holes and equatorial coronal holes. Little is known about the relationship between the wind coming from these two different latitudes and whether these two subcategories of fast wind evolve in the same way during the solar cycle. Nineteen years of Ulysses observations, from 1990 to 2009, combined with ACE observations from 1998 to the present provide us with in situ measurements of solar wind properties that span two entire solar cycles. These missions provide an ideal data set to study the properties and evolution of the fast solar wind originating from equatorial and polar holes. In this work, we focus on these two types of fast solar wind during the minima between solar cycles 22 and 23 and 23 and 24. We use data from SWICS, SWOOPS, and VHM/FGM on board Ulysses and SWICS, SWEPAM, and MAG on board ACE to analyze the proton kinetic, thermal, and dynamic characteristics, heavy ion composition, and magnetic field properties of these two fast winds. The comparison shows that: (1) their kinetic, thermal, compositional, and magnetic properties are significantly different at any time during the two minima and (2) they respond differently to the changes in solar activity from cycle 23 to 24. These results indicate that equatorial and polar fast solar wind are two separate subcategories of fast wind. We discuss the implications of these results and relate them to remote-sensing measurements of the properties of polar and equatorial coronal holes carried out in the inner corona during these two solar minima.

  6. Solar and Wind Site Screening Decision Trees

    Science.gov (United States)

    EPA and NREL created a decision tree to guide state and local governments and other stakeholders through a process for screening sites for their suitability for future redevelopment with solar photovoltaic (PV) energy and wind energy.

  7. A study of density modulation index in the inner heliospheric solar wind during solar cycle 23

    International Nuclear Information System (INIS)

    Bisoi, Susanta Kumar; Janardhan, P.; Ingale, M.; Subramanian, P.; Ananthakrishnan, S.; Tokumaru, M.; Fujiki, K.

    2014-01-01

    The ratio of the rms electron density fluctuations to the background density in the solar wind (density modulation index, ε N ≡ ΔN/N) is of vital importance for understanding several problems in heliospheric physics related to solar wind turbulence. In this paper, we have investigated the behavior of ε N in the inner heliosphere from 0.26 to 0.82 AU. The density fluctuations ΔN have been deduced using extensive ground-based observations of interplanetary scintillation at 327 MHz, which probe spatial scales of a few hundred kilometers. The background densities (N) have been derived using near-Earth observations from the Advanced Composition Explorer. Our analysis reveals that 0.001 ≲ ε N ≲ 0.02 and does not vary appreciably with heliocentric distance. We also find that ε N declines by 8% from 1998 to 2008. We discuss the impact of these findings on problems ranging from our understanding of Forbush decreases to the behavior of the solar wind dynamic pressure over the recent peculiar solar minimum at the end of cycle 23.

  8. Assessment of solar and wind energy potentials for three free economic and industrial zones of Iran

    International Nuclear Information System (INIS)

    Mohammadi, Kasra; Mostafaeipour, Ali; Sabzpooshani, Majid

    2014-01-01

    This paper aims to evaluate the potential of renewable energy sources of solar and wind in three free economic and industrial zones of Chabahar, Kish and Salafchegan in Iran. Feasibility of harnessing solar energy was investigated by using key solar parameters like monthly mean global, beam and diffuse solar radiation as well as clearness index. It was found that all locations had great potentials for utilizing different solar energy systems. Additionally, the monthly, seasonal, semi-yearly and yearly optimum tilt angles of south-facing solar surfaces were determined. For all zones, adjusting the tilt angle twice a year or in other words, the semi-yearly tilt adjustment for two periods of warm (April–September) and cold (October–March) were highly recommended, since it offers almost the same level of annual solar energy gain (SEG) as those of monthly and seasonal adjustments. Weibull Distribution Function (WDF) was performed for analyzing the wind potentials at different heights. It was found that Chabahar was not suitable for wind energy development, but Kish and Salafchegan with yearly wind powers of 111.28 W/m 2 and 114.34 W/m 2 , respectively ranked in class 2 which are considered marginal for wind power development. Three different wind turbine models were proposed for Kish and Salafchegan. - Highlights: • Feasibility of solar and wind energy for three locations of Iran was investigated. • All locations were suitable for solar energy utilization. • The optimum tilt angles of solar surfaces were determined. • Chabahar was unsuitable, but Kish and Salafchegan were marginal for wind purpose

  9. Techno-Economic Assessment of Concentrating Solar Power and Wind Hybridization in Jordan

    Directory of Open Access Journals (Sweden)

    Osama Ayadi

    2018-03-01

    A strong complementarity between wind and direct normal solar radiation was observed in the selected location in Jordan, which emphasizes the attractiveness of the selected hybrid system. The optimal configuration of the CSP-wind hybrid system was obtained with a solar field of a 2.6 solar multiple and a 5 hours energy storage. The achieved capacity factor was 94%, and the LCOE is lower than those resulted for standalone CSP plants.

  10. INFLUENCE OF THE AMBIENT SOLAR WIND FLOW ON THE PROPAGATION BEHAVIOR OF INTERPLANETARY CORONAL MASS EJECTIONS

    Energy Technology Data Exchange (ETDEWEB)

    Temmer, Manuela; Rollett, Tanja; Moestl, Christian; Veronig, Astrid M. [Kanzelhoehe Observatory-IGAM, Institute of Physics, University of Graz, Universitaetsplatz 5, A-8010 Graz (Austria); Vrsnak, Bojan [Hvar Observatory, Faculty of Geodesy, University of Zagreb, Kaciceva 26, HR-10000 Zagreb (Croatia); Odstrcil, Dusan [Cooperative Institute for Research in Environmental Sciences, University of Colorado at Boulder, Boulder, CO (United States)

    2011-12-20

    We study three coronal mass ejection (CME)/interplanetary coronal mass ejection (ICME) events (2008 June 1-6, 2009 February 13-18, and 2010 April 3-5) tracked from Sun to 1 AU in remote-sensing observations of Solar Terrestrial Relations Observatory Heliospheric Imagers and in situ plasma and magnetic field measurements. We focus on the ICME propagation in interplanetary (IP) space that is governed by two forces: the propelling Lorentz force and the drag force. We address the question: which heliospheric distance range does the drag become dominant and the CME adjust to the solar wind flow. To this end, we analyze speed differences between ICMEs and the ambient solar wind flow as a function of distance. The evolution of the ambient solar wind flow is derived from ENLIL three-dimensional MHD model runs using different solar wind models, namely, Wang-Sheeley-Arge and MHD-Around-A-Sphere. Comparing the measured CME kinematics with the solar wind models, we find that the CME speed becomes adjusted to the solar wind speed at very different heliospheric distances in the three events under study: from below 30 R{sub Sun }, to beyond 1 AU, depending on the CME and ambient solar wind characteristics. ENLIL can be used to derive important information about the overall structure of the background solar wind, providing more reliable results during times of low solar activity than during times of high solar activity. The results from this study enable us to obtain greater insight into the forces acting on CMEs over the IP space distance range, which is an important prerequisite for predicting their 1 AU transit times.

  11. INFLUENCE OF THE AMBIENT SOLAR WIND FLOW ON THE PROPAGATION BEHAVIOR OF INTERPLANETARY CORONAL MASS EJECTIONS

    International Nuclear Information System (INIS)

    Temmer, Manuela; Rollett, Tanja; Möstl, Christian; Veronig, Astrid M.; Vršnak, Bojan; Odstrčil, Dusan

    2011-01-01

    We study three coronal mass ejection (CME)/interplanetary coronal mass ejection (ICME) events (2008 June 1-6, 2009 February 13-18, and 2010 April 3-5) tracked from Sun to 1 AU in remote-sensing observations of Solar Terrestrial Relations Observatory Heliospheric Imagers and in situ plasma and magnetic field measurements. We focus on the ICME propagation in interplanetary (IP) space that is governed by two forces: the propelling Lorentz force and the drag force. We address the question: which heliospheric distance range does the drag become dominant and the CME adjust to the solar wind flow. To this end, we analyze speed differences between ICMEs and the ambient solar wind flow as a function of distance. The evolution of the ambient solar wind flow is derived from ENLIL three-dimensional MHD model runs using different solar wind models, namely, Wang-Sheeley-Arge and MHD-Around-A-Sphere. Comparing the measured CME kinematics with the solar wind models, we find that the CME speed becomes adjusted to the solar wind speed at very different heliospheric distances in the three events under study: from below 30 R ☉ , to beyond 1 AU, depending on the CME and ambient solar wind characteristics. ENLIL can be used to derive important information about the overall structure of the background solar wind, providing more reliable results during times of low solar activity than during times of high solar activity. The results from this study enable us to obtain greater insight into the forces acting on CMEs over the IP space distance range, which is an important prerequisite for predicting their 1 AU transit times.

  12. Save with Solar and Wind, Summer 2002 (Newsletter)

    Energy Technology Data Exchange (ETDEWEB)

    2002-07-01

    This newsletter is published by the Department of Energy's Federal Energy Management Program. It is intended for facility managers, contracting officials, energy specialists, and others involved in helping Federal agencies increase their use of cost-effective solar and wind energy systems at their facilities. Renewable energy systems ultimately save agencies money by reducing utility costs; they also help to lower the emissions associated with the use of fossil fuels. This issue describes a new strategy to achieve the Federal goal for renewable energy, as well as some new solar and wind systems installed at facilities of the Department of Defense, the U.S. Geological Survey, the U.S. Postal Service, the National Park Service, and other agencies.

  13. What is the Relationship between the Solar Wind and Storms/Substorms?

    Science.gov (United States)

    Fairfield, D. H.; Burlaga, L. F.

    1999-01-01

    The interplanetary magnetic field (IMF) carried past the Earth by the solar wind has long been known to be the principal quantity that controls geomagnetic storms and substorms. Intervals of strong southward IMF with durations of at least a significant fraction of a day produce storms, while more typical, shorter intervals of less-intense southward fields produce substorms. The strong, long-duration southward fields are generally associated with coronal mass ejections and magnetic clouds or else they are produced by interplanetary dynamics initiated by fast solar wind flows that compress preexisting southward fields. Smaller, short-duration southward fields that occur on most days are related to long period waves, turbulence, or random variations in the IMF. Southward IMF enhances dayside reconnection between the IMF and the Earth's dipole with the reconnected field lines supplementing open field lines of the geomagnetic tail and producing an expanded polar cap and increased tail energy. Although the frequent storage of solar wind energy and its release during substorms is the most common mode of solar wind/magnetosphere interaction, under certain circumstances, steady southward IMF seems to produce intervals of relatively steady magnetosphere convection without substorms. During these latter times, the inner magnetosphere remains in a stressed tail-like state while the more distant magnetotail has larger northward field and more dipolar-like field lines. Recent evidence suggests that enhanced magnetosphere particle densities associated with enhanced solar wind densities allow more particles to be accelerated for the ring current, thus creating larger storms.

  14. High-speed solar wind flow parameters at 1 AU

    International Nuclear Information System (INIS)

    Feldman, W.C.; Asbridge, J.R.; Bame, S.J.; Gosling, J.T.

    1976-01-01

    To develop a set of constraints for theories of solar wind high-speed streams, a detailed study was made of the fastest streams observed at 1 AU during the time period spanning March 1971 through July 1974. Streams were accepted for study only if (1) the maximum speed exceeded 650 km s -1 ; (2) effects of stream-stream dynamical interaction on the flow parameters could be safely separated from the intrinsic characteristics of the high-speed regions; (3) the full width at half maximum (FWHM) of the stream when mapped back to 20 solar radii by using a constant speed approximation was greater than 45degree in Carrington longitude; and (4) there were no obvious solar-activity-induced contaminating effects. Nineteen streams during this time interval satisfied these criteria. Average parameters at 1 AU for those portions of these streams above V=650 km s -1 are given.Not only is it not presently known why electrons are significantly cooler than the protons within high-speed regions, but also observed particle fluxes and convected energy fluxes for speed greater than 650 km s -1 are substantially larger than those values predicted by any of the existing theories of solar wind high-speed streams. More work is therefore needed in refining present solar wind models to see whether suitable modifications and/or combinations of existing theories based on reasonable coronal conditions can accommodate the above high-speed flow parameters

  15. Kinetic Properties of the Neutral Solar Wind

    International Nuclear Information System (INIS)

    Florinski, V.; Heerikhuisen, J.

    2017-01-01

    Charge-exchange collisions between the solar wind protons and interstellar hydrogen produce a distinctive population of neutral hydrogen streaming radially at nearly the solar-wind speed. This tenuous population, known as the neutral solar wind (NSW) is thought to play a key role in the appearance of the Interplanetary Boundary EXplorer ribbon, a bright circular band in the sky that is the source of neutral hydrogen with energies near 1 keV. According to the leading model of the ribbon, the velocity distribution of NSW hydrogen is imparted on the pickup ions (PUIs) generated via charge exchange with the interstellar protons beyond the heliopause, and in this way controls the stability of the resulting ring distribution of PUIs against hydromagnetic wave generation. In this paper, we examine the velocity distributions of the NSW atoms in the heliosphere and the outer heliosheath regions by following the phase-space trajectories of the Boltzmann equation. It is demonstrated that these distributions are highly anisotropic, with the parallel (radial) temperature greatly exceeding the perpendicular temperature. Ions picked up near 90° from the anisotropic NSW would form a stable ring distribution capable of generating the ribbon flux. We also discuss a second population of neutrals born in charge transfer collisions with interstellar PUIs, the so-called neutralized pickup ion (NPI) component. Their high thermal velocities translate into large parallel velocity spread of the daughter ribbon PUIs, which would adversely affect plasma stability in local interstellar space.

  16. Kinetic Properties of the Neutral Solar Wind

    Science.gov (United States)

    Florinski, V.; Heerikhuisen, J.

    2017-03-01

    Charge-exchange collisions between the solar wind protons and interstellar hydrogen produce a distinctive population of neutral hydrogen streaming radially at nearly the solar-wind speed. This tenuous population, known as the neutral solar wind (NSW) is thought to play a key role in the appearance of the Interplanetary Boundary EXplorer ribbon, a bright circular band in the sky that is the source of neutral hydrogen with energies near 1 keV. According to the leading model of the ribbon, the velocity distribution of NSW hydrogen is imparted on the pickup ions (PUIs) generated via charge exchange with the interstellar protons beyond the heliopause, and in this way controls the stability of the resulting ring distribution of PUIs against hydromagnetic wave generation. In this paper, we examine the velocity distributions of the NSW atoms in the heliosphere and the outer heliosheath regions by following the phase-space trajectories of the Boltzmann equation. It is demonstrated that these distributions are highly anisotropic, with the parallel (radial) temperature greatly exceeding the perpendicular temperature. Ions picked up near 90° from the anisotropic NSW would form a stable ring distribution capable of generating the ribbon flux. We also discuss a second population of neutrals born in charge transfer collisions with interstellar PUIs, the so-called neutralized pickup ion (NPI) component. Their high thermal velocities translate into large parallel velocity spread of the daughter ribbon PUIs, which would adversely affect plasma stability in local interstellar space.

  17. Spectral Analysis of Geomagnetic Activity Indices and Solar Wind Parameters

    Directory of Open Access Journals (Sweden)

    Jung-Hee Kim

    2014-06-01

    Full Text Available Solar variability is widely known to affect the interplanetary space and in turn the Earth’s electromagnetical environment on the basis of common periodicities in the solar and geomagnetic activity indices. The goal of this study is twofold. Firstly, we attempt to associate modes by comparing a temporal behavior of the power of geomagnetic activity parameters since it is barely sufficient searching for common peaks with a similar periodicity in order to causally correlate geomagnetic activity parameters. As a result of the wavelet transform analysis we are able to obtain information on the temporal behavior of the power in the velocity of the solar wind, the number density of protons in the solar wind, the AE index, the Dst index, the interplanetary magnetic field, B and its three components of the GSM coordinate system, BX, BY, BZ. Secondly, we also attempt to search for any signatures of influence on the space environment near the Earth by inner planets orbiting around the Sun. Our main findings are as follows: (1 Parameters we have investigated show periodicities of ~ 27 days, ~ 13.5 days, ~ 9 days. (2 The peaks in the power spectrum of BZ appear to be split due to an unknown agent. (3 For some modes powers are not present all the time and intervals showing high powers do not always coincide. (4 Noticeable peaks do not emerge at those frequencies corresponding to the synodic and/or sidereal periods of Mercury and Venus, which leads us to conclude that the Earth’s space environment is not subject to the shadow of the inner planets as suggested earlier.

  18. Decrease of the solar flare/solar wind flux ratio in the past several aeons from solar neon and tracks in lunar soil plagioclases

    International Nuclear Information System (INIS)

    Wieler, R.; Etique, Ph.; Signer, P.; Poupeau, G.

    1982-08-01

    The He, Ne, and Ar concentrations and isotopic compositions of mineral separates of six lunar subsurface samples and of two regolith breccias which were exposed to the sun as early as 2 - 3 billion years ago are determined. The results are compared with our noble gas data obtained previously on mineral separates of lunar surface soil samples most of which contain recently implanted solar gases. The mean solar flare track densities were determined on aliquots of several of the plagioclase separates analyzed for noble gases. Solar wind retentive mafic minerals and ilmenites show that a possible secular increase of the 20 Ne/ 22 Ne ratio in the solar wind during the last 2 - 3 Ga. is 20 Ne/ 22 Ne of approximately 11.3 - 11.8, reported for solar flare Ne retained in plagioclase separates from lunar soils. The solar flare track data and the Ne data independently show that plagioclases exposed to the sun over the last 10 8 years recorded a lower mean ratio of solar flare to solar wind intensities than samples exposed about 1 - 3 billion years ago. On the basis of track data these ratios are estimated to differ by a factor approximately 2. (Author) [pt

  19. Heliospheric pick-up ions influencing thermodynamics and dynamics of the distant solar wind

    Directory of Open Access Journals (Sweden)

    H. J. Fahr

    2002-01-01

    Full Text Available Neutral interstellar H-atoms penetrate into the inner heliosphere and upon the event of ionization are converted into pick-up ions (PUIs. The magnetized solar wind flow incorporates these ions into the plasma bulk and enforces their co-motion. By nonlinear interactions with wind-entrained Alfvén waves, these ions are then processed in the comoving velocity space. The complete pick-up process is connected with forces acting back to the original solar wind ion flow, thereby decelerating and heating the solar wind plasma. As we show here, the resulting deceleration cannot be treated as a pure loading effect, but requires adequate consideration of the action of the pressure of PUI-scattered waves operating by the PUI pressure gradient. Hereby, it is important to take into proper account the stochastic acceleration which PUIs suffer from at their convection out of the inner heliosphere by quasi-linear interactions with MHD turbulences. Only then can the presently reported VOYAGER observations of solar wind decelerations and heatings in the outer heliosphere be understood in view of the most likely values of interstellar gas parameters, such as an H-atom density of 0.12 cm-3 . Solar wind protons (SWPs appear to be globally heated in their motion to larger solar distances. Ascribing the needed heat transfer to the action of suprathermal PUIs, which drive MHD waves that are partly absorbed by SWPs, in order to establish the observed SWP polytropy, we can obtain a quantitative expression for the solar wind proton pressure as a function of solar distance. This expression clearly shows the change from an adiabatic to a quasi-polytropic SWP behaviour with a decreasing polytropic index at increasing distances. This also allows one to calculate the average percentage of initial pick-up energy fed into the thermal proton energy. In a first order evaluation of this expression, we can estimate that about 10% of the initial PUI injection energy is eventually

  20. On the signatures of magnetic islands and multiple X-lines in the solar wind as observed by ARTEMIS and WIND

    Science.gov (United States)

    Eriksson, S.; Newman, D. L.; Lapenta, G.; Angelopoulos, V.

    2014-06-01

    We report the first observation consistent with a magnetic reconnection generated magnetic island at a solar wind current sheet that was observed on 10 June 2012 by the two ARTEMIS satellites and the upstream WIND satellite. The evidence consists of a core magnetic field within the island which is formed by enhanced Hall magnetic fields across a solar wind reconnection exhaust. The core field at ARTEMIS displays a local dip coincident with a peak plasma density enhancement and a locally slower exhaust speed which differentiates it from a regular solar wind exhaust crossing. Further indirect evidence of magnetic island formation is presented in the form of a tripolar Hall magnetic field, which is supported by an observed electron velocity shear, and plasma density depletion regions which are in general agreement with multiple reconnection X-line signatures at the same current sheet on the basis of predicted signatures of magnetic islands as generated by a kinetic reconnection simulation for solar wind-like conditions. The combined ARTEMIS and WIND observations of tripolar Hall magnetic fields across the same exhaust and Grad-Shrafranov reconstructions of the magnetic field suggest that an elongated magnetic island was encountered which displayed a 4RE normal width and a 43RE extent along the exhaust between two neighboring X-lines.

  1. Charge state evolution in the solar wind. III. Model comparison with observations

    Energy Technology Data Exchange (ETDEWEB)

    Landi, E.; Oran, R.; Lepri, S. T.; Zurbuchen, T. H.; Fisk, L. A.; Van der Holst, B. [Department of Atmospheric, Oceanic and Space Sciences, University of Michigan, Ann Arbor, MI 48109 (United States)

    2014-08-01

    We test three theoretical models of the fast solar wind with a set of remote sensing observations and in-situ measurements taken during the minimum of solar cycle 23. First, the model electron density and temperature are compared to SOHO/SUMER spectroscopic measurements. Second, the model electron density, temperature, and wind speed are used to predict the charge state evolution of the wind plasma from the source regions to the freeze-in point. Frozen-in charge states are compared with Ulysses/SWICS measurements at 1 AU, while charge states close to the Sun are combined with the CHIANTI spectral code to calculate the intensities of selected spectral lines, to be compared with SOHO/SUMER observations in the north polar coronal hole. We find that none of the theoretical models are able to completely reproduce all observations; namely, all of them underestimate the charge state distribution of the solar wind everywhere, although the levels of disagreement vary from model to model. We discuss possible causes of the disagreement, namely, uncertainties in the calculation of the charge state evolution and of line intensities, in the atomic data, and in the assumptions on the wind plasma conditions. Last, we discuss the scenario where the wind is accelerated from a region located in the solar corona rather than in the chromosphere as assumed in the three theoretical models, and find that a wind originating from the corona is in much closer agreement with observations.

  2. Charge state evolution in the solar wind. III. Model comparison with observations

    International Nuclear Information System (INIS)

    Landi, E.; Oran, R.; Lepri, S. T.; Zurbuchen, T. H.; Fisk, L. A.; Van der Holst, B.

    2014-01-01

    We test three theoretical models of the fast solar wind with a set of remote sensing observations and in-situ measurements taken during the minimum of solar cycle 23. First, the model electron density and temperature are compared to SOHO/SUMER spectroscopic measurements. Second, the model electron density, temperature, and wind speed are used to predict the charge state evolution of the wind plasma from the source regions to the freeze-in point. Frozen-in charge states are compared with Ulysses/SWICS measurements at 1 AU, while charge states close to the Sun are combined with the CHIANTI spectral code to calculate the intensities of selected spectral lines, to be compared with SOHO/SUMER observations in the north polar coronal hole. We find that none of the theoretical models are able to completely reproduce all observations; namely, all of them underestimate the charge state distribution of the solar wind everywhere, although the levels of disagreement vary from model to model. We discuss possible causes of the disagreement, namely, uncertainties in the calculation of the charge state evolution and of line intensities, in the atomic data, and in the assumptions on the wind plasma conditions. Last, we discuss the scenario where the wind is accelerated from a region located in the solar corona rather than in the chromosphere as assumed in the three theoretical models, and find that a wind originating from the corona is in much closer agreement with observations.

  3. Ionospheric cusp flows pulsed by solar wind Alfvén waves

    Directory of Open Access Journals (Sweden)

    P. Prikryl

    2002-02-01

    Full Text Available Pulsed ionospheric flows (PIFs in the cusp foot-print have been observed by the SuperDARN radars with periods between a few minutes and several tens of minutes. PIFs are believed to be a consequence of the interplanetary magnetic field (IMF reconnection with the magnetospheric magnetic field on the dayside magnetopause, ionospheric signatures of flux transfer events (FTEs. The quasiperiodic PIFs are correlated with Alfvénic fluctuations observed in the upstream solar wind. It is concluded that on these occasions, the FTEs were driven by Alfvén waves coupling to the day-side magnetosphere. Case studies are presented in which the dawn-dusk component of the Alfvén wave electric field modulates the reconnection rate as evidenced by the radar observations of the ionospheric cusp flows. The arrival of the IMF southward turning at the magnetopause is determined from multipoint solar wind magnetic field and/or plasma measurements, assuming plane phase fronts in solar wind. The cross-correlation lag between the solar wind data and ground magnetograms that were obtained near the cusp footprint exceeded the estimated spacecraft-to-magnetopause propagation time by up to several minutes. The difference can account for and/or exceeds the Alfvén propagation time between the magnetopause and ionosphere. For the case of short period ( < 13 min PIFs, the onset times of the flow transients appear to be further delayed by at most a few more minutes after the IMF southward turning arrived at the magnetopause. For the case of long period (30 – 40 min PIFs, the observed additional delays were 10–20 min. We interpret the excess delay in terms of an intrinsic time scale for reconnection (Russell et al., 1997 which can be explained by the surface-wave induced magnetic reconnection mechanism (Uberoi et al., 1999. Here, surface waves with wavelengths larger than the thickness of the neutral layer induce a tearing-mode instability whose rise time explains the

  4. Seasonal optimal mix of wind and solar power in a future, highly renewable Europe

    Energy Technology Data Exchange (ETDEWEB)

    Heide, Dominik [Frankfurt Institute for Advanced Studies (FIAS) and Frankfurt International Graduate School for Science, Johann Wolfgang Goethe Universitaet, Ruth-Moufang-Strasse 1, D-60438 Frankfurt am Main (Germany); von Bremen, Lueder [ForWind - Center for Wind Energy Research, University of Oldenburg, Marie-Curie-Str. 1, D-26129 Oldenburg (Germany); Greiner, Martin [Corporate Research and Technology, Siemens AG, D-81730 Muenchen (Germany); Aarhus School of Engineering and Institute of Mathematical Sciences, Aarhus University, Ny Munkegade 118, 8000 Aarhus C (Denmark); Hoffmann, Clemens [Corporate Research and Technology, Siemens AG, D-81730 Muenchen (Germany); Speckmann, Markus; Bofinger, Stefan [Fraunhofer Institut fuer Windenergie und Energiesystemtechnik (IWES), Koenigstor 59, D-34119 Kassel (Germany)

    2010-11-15

    The renewable power generation aggregated across Europe exhibits strong seasonal behaviors. Wind power generation is much stronger in winter than in summer. The opposite is true for solar power generation. In a future Europe with a very high share of renewable power generation those two opposite behaviors are able to counterbalance each other to a certain extent to follow the seasonal load curve. The best point of counterbalancing represents the seasonal optimal mix between wind and solar power generation. It leads to a pronounced minimum in required stored energy. For a 100% renewable Europe the seasonal optimal mix becomes 55% wind and 45% solar power generation. For less than 100% renewable scenarios the fraction of wind power generation increases and that of solar power generation decreases. (author)

  5. Solar wind velocity and daily variation of cosmic rays

    International Nuclear Information System (INIS)

    Ahluwalia, H.S.; Riker, J.F.

    1985-01-01

    Recently parameters applicable to the solar wind and the interplanetary magnetic field (IMF) have become much better defined. Superior quality of data bases that are now available, particularly for the post-1971 period, make it possible to believe the long-term trends in the data. These data are correlated with the secular changes observed in the diurnal variation parameters obtained from neutron monitor data at Deep River and underground muon telescope data at Embudo (30 MEW) and Socorro (82 MWE). The annual mean amplitudes appear to have large values during the epochs of high speed solar wind streams. Results are discussed

  6. Sustainable business models for wind and solar energy in Romania

    Directory of Open Access Journals (Sweden)

    Nichifor Maria Alexandra

    2015-06-01

    Full Text Available Renewable energy has become a crucial element for the business environment as the need for new energy resources and the degree of climate change are increasing. As developed economies strive towards greater progress, sustainable business models are of the essence in order to maintain a balance between the triple bottom line: people, planet and profit. In recent years, European Union countries have installed important capacities of renewable energy, especially wind and solar energy to achieve this purpose. The objective of this article is to make a comparative study between the current sustainable business models implemented in companies that are active in the wind and solar energy sector in Romania. Both sectors underwent tremendous changes in the last two years due to changing support schemes which have had a significant influence on the mechanism of the renewable energy market, as well as on its development. Using the classical Delphi method, based on questionnaires and interviews with experts in the fields of wind and solar energy, this paper offers an overview of the sustainable business models of wind and solar energy companies, both sectors opting for the alternative of selling electricity to trading companies as a main source of revenue until 2013 and as the main future trend until 2020. Furthermore, the participating wind energy companies noted a pessimistic outlook of future investments due to legal instability that made them to reduce their projects in comparison to PV investments, which are expected to continue. The subject of the article is of interest to scientific literature because sustainable business models in wind and photovoltaic energy have been scarcely researched in previous articles and are essential in understanding the activity of the companies in these two fields of renewable energy.

  7. The small amplitude of density turbulence in the inner solar wind

    Directory of Open Access Journals (Sweden)

    S. R. Spangler

    2003-01-01

    Full Text Available Very Long Baseline Interferometer (VLBI observations were made of radio sources close to the Sun, whose lines of sight pass through the inner solar wind (impact parameters 16-26 RE. Power spectra were analyzed of the interferometer phase fluctuations due to the solar wind plasma. These power spectra provide information on the level of plasma density fluctuations on spatial scales of roughly one hundred to several thousand kilometers. By specifying an outer scale to the turbulence spectrum, we can estimate the root-mean-square (rms amplitude of the density fluctuations. The data indicate that the rms fluctuation in density is only about 10% of the mean density. This value is low, and consistent with extrapolated estimates from more distant parts of the solar wind. Physical speculations based on this result are presented.

  8. Hybrid Model of Inhomogeneous Solar Wind Plasma Heating by Alfven Wave Spectrum: Parametric Studies

    Science.gov (United States)

    Ofman, L.

    2010-01-01

    Observations of the solar wind plasma at 0.3 AU and beyond show that a turbulent spectrum of magnetic fluctuations is present. Remote sensing observations of the corona indicate that heavy ions are hotter than protons and their temperature is anisotropic (T(sub perpindicular / T(sub parallel) >> 1). We study the heating and the acceleration of multi-ion plasma in the solar wind by a turbulent spectrum of Alfvenic fluctuations using a 2-D hybrid numerical model. In the hybrid model the protons and heavy ions are treated kinetically as particles, while the electrons are included as neutralizing background fluid. This is the first two-dimensional hybrid parametric study of the solar wind plasma that includes an input turbulent wave spectrum guided by observation with inhomogeneous background density. We also investigate the effects of He++ ion beams in the inhomogeneous background plasma density on the heating of the solar wind plasma. The 2-D hybrid model treats parallel and oblique waves, together with cross-field inhomogeneity, self-consistently. We investigate the parametric dependence of the perpendicular heating, and the temperature anisotropy in the H+-He++ solar wind plasma. It was found that the scaling of the magnetic fluctuations power spectrum steepens in the higher-density regions, and the heating is channeled to these regions from the surrounding lower-density plasma due to wave refraction. The model parameters are applicable to the expected solar wind conditions at about 10 solar radii.

  9. On a relation of geomagnetic activity, solar wind velocity and irregularity of daily rotation of the Earth

    International Nuclear Information System (INIS)

    Kalinin, Yu.D.; Kiselev, V.M.

    1980-01-01

    A possibility of the presence of statistic relation between the changes of the Earth rotation regime and the mean velocity of solar wind is discussed. The ratio between the solar wind velocity observed and planetary index of geomagnetic activity am is used to determine the annual average values of solar wind velocity beyond the twentieth cycle of solar activity. The restored changes of solar wind velocity are compared with solar conditioned variations of the Earth day duration and it is shown that the correspondence takes place only at frequencies lower the frequency of 11-year cycle [ru

  10. Use of meteorological information in the risk analysis of a mixed wind farm and solar

    Science.gov (United States)

    Mengelkamp, H.-T.; Bendel, D.

    2010-09-01

    Use of meteorological information in the risk analysis of a mixed wind farm and solar power plant portfolio H.-T. Mengelkamp*,** , D. Bendel** *GKSS Research Center Geesthacht GmbH **anemos Gesellschaft für Umweltmeteorologie mbH The renewable energy industry has rapidly developed during the last two decades and so have the needs for high quality comprehensive meteorological services. It is, however, only recently that international financial institutions bundle wind farms and solar power plants and offer shares in these aggregate portfolios. The monetary value of a mixed wind farm and solar power plant portfolio is determined by legal and technical aspects, the expected annual energy production of each wind farm and solar power plant and the associated uncertainty of the energy yield estimation or the investment risk. Building an aggregate portfolio will reduce the overall uncertainty through diversification in contrast to the single wind farm/solar power plant energy yield uncertainty. This is similar to equity funds based on a variety of companies or products. Meteorological aspects contribute to the diversification in various ways. There is the uncertainty in the estimation of the expected long-term mean energy production of the wind and solar power plants. Different components of uncertainty have to be considered depending on whether the power plant is already in operation or in the planning phase. The uncertainty related to a wind farm in the planning phase comprises the methodology of the wind potential estimation and the uncertainty of the site specific wind turbine power curve as well as the uncertainty of the wind farm effect calculation. The uncertainty related to a solar power plant in the pre-operational phase comprises the uncertainty of the radiation data base and that of the performance curve. The long-term mean annual energy yield of operational wind farms and solar power plants is estimated on the basis of the actual energy production and it

  11. Modeling 3-D solar wind structure

    Czech Academy of Sciences Publication Activity Database

    Odstrčil, Dušan

    2003-01-01

    Roč. 32, č. 4 (2003), s. 497-506 ISSN 0273-1177 R&D Projects: GA AV ČR IAA3003003; GA AV ČR IBS1003006 Institutional research plan: CEZ:AV0Z1003909 Keywords : solar wind * modeling Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics Impact factor: 0.483, year: 2003

  12. Comparative Validation of Realtime Solar Wind Forecasting Using the UCSD Heliospheric Tomography Model

    Science.gov (United States)

    MacNeice, Peter; Taktakishvili, Alexandra; Jackson, Bernard; Clover, John; Bisi, Mario; Odstrcil, Dusan

    2011-01-01

    The University of California, San Diego 3D Heliospheric Tomography Model reconstructs the evolution of heliospheric structures, and can make forecasts of solar wind density and velocity up to 72 hours in the future. The latest model version, installed and running in realtime at the Community Coordinated Modeling Center(CCMC), analyzes scintillations of meter wavelength radio point sources recorded by the Solar-Terrestrial Environment Laboratory(STELab) together with realtime measurements of solar wind speed and density recorded by the Advanced Composition Explorer(ACE) Solar Wind Electron Proton Alpha Monitor(SWEPAM).The solution is reconstructed using tomographic techniques and a simple kinematic wind model. Since installation, the CCMC has been recording the model forecasts and comparing them with ACE measurements, and with forecasts made using other heliospheric models hosted by the CCMC. We report the preliminary results of this validation work and comparison with alternative models.

  13. Do In Situ Observations Contain Signatures of Intermittent Fast Solar Wind Acceleration?

    Science.gov (United States)

    Matteini, L.; Horbury, T. S.; Stansby, D.

    2017-12-01

    Disentangling local plasma properties and Solar origin structures in in situ data is a crucial aspect for the understanding of solar wind acceleration and evolution. This is particularly challenging at 1 AU and beyond, where structures of various origin have had time to interact and merge, smoothing out their main characteristics. Observations of more pristine plasma closer to the Sun are therefore needed. In preparation of the forthcoming Solar Orbiter and Parker Solar Probe missions, Helios observations as close as to 0.3 AU - although old, not yet fully exploited - can be used to test our expectations and make new predictions. Recent observations (Matteini et al. 2014, 2015) have outlined the presence of intense (up to 1000km/s) and short-living velocity peaks that ubiquitously characterize the typical profile of the fast solar wind at 0.3 AU, suggesting that these features could be remnants of processes occurring in the Solar atmosphere and a signature of intermittent solar wind acceleration from coronal holes. We discuss results about statistics of these events, characterizing their physical properties and trying to link them with typical Solar temporal and spatial scales. Finally we also discuss how these velocity peaks will likely affect the future in situ exploration of the inner heliosphere by Solar Orbiter and the Parker Solar Probe.

  14. Solar wind-magnetosphere coupling during intense magnetic storms (1978--1979)

    International Nuclear Information System (INIS)

    Gonzalez, W.D.; Tsurutani, B.T.; Gonzalez, A.L.C.; Smith, E.J.; Tang, F.; Akasofu, S.

    1989-01-01

    The solar wind-magnetosphere coupling problem is investigated for the ten intense magnetic storms (Dst <-100 nT) that occurred during the 500 days (August 16, 1978 to December 28, 1979) studied by Gonzalez and Tsurutani [1987]. This investigation concentrates on the ring current energization in terms of solar wind parameters, in order to explain the | -Dst | growth observed during these storms. Thus several coupling functions are tested as energy input and several sets of the ring current decay time-constant τ are searched to find best correlations with the Dst response. From the fairly large correlation coefficients found in this study, there is strong evidence that large scale magnetopause reconnection operates during such intense storm events and that the solar wind ram pressure plays an important role in the ring current energization. Thus a ram pressure correction factor is suggested for expressions concerning the reconnection power during time intervals with large ram pressure variations

  15. Estimating random transverse velocities in the fast solar wind from EISCAT Interplanetary Scintillation measurements

    Directory of Open Access Journals (Sweden)

    A. Canals

    2002-09-01

    Full Text Available Interplanetary scintillation measurements can yield estimates of a large number of solar wind parameters, including bulk flow speed, variation in bulk velocity along the observing path through the solar wind and random variation in transverse velocity. This last parameter is of particular interest, as it can indicate the flux of low-frequency Alfvén waves, and the dissipation of these waves has been proposed as an acceleration mechanism for the fast solar wind. Analysis of IPS data is, however, a significantly unresolved problem and a variety of a priori assumptions must be made in interpreting the data. Furthermore, the results may be affected by the physical structure of the radio source and by variations in the solar wind along the scintillation ray path. We have used observations of simple point-like radio sources made with EISCAT between 1994 and 1998 to obtain estimates of random transverse velocity in the fast solar wind. The results obtained with various a priori assumptions made in the analysis are compared, and we hope thereby to be able to provide some indication of the reliability of our estimates of random transverse velocity and the variation of this parameter with distance from the Sun.Key words. Interplanetary physics (MHD waves and turbulence; solar wind plasma; instruments and techniques

  16. Estimating random transverse velocities in the fast solar wind from EISCAT Interplanetary Scintillation measurements

    Directory of Open Access Journals (Sweden)

    A. Canals

    Full Text Available Interplanetary scintillation measurements can yield estimates of a large number of solar wind parameters, including bulk flow speed, variation in bulk velocity along the observing path through the solar wind and random variation in transverse velocity. This last parameter is of particular interest, as it can indicate the flux of low-frequency Alfvén waves, and the dissipation of these waves has been proposed as an acceleration mechanism for the fast solar wind. Analysis of IPS data is, however, a significantly unresolved problem and a variety of a priori assumptions must be made in interpreting the data. Furthermore, the results may be affected by the physical structure of the radio source and by variations in the solar wind along the scintillation ray path. We have used observations of simple point-like radio sources made with EISCAT between 1994 and 1998 to obtain estimates of random transverse velocity in the fast solar wind. The results obtained with various a priori assumptions made in the analysis are compared, and we hope thereby to be able to provide some indication of the reliability of our estimates of random transverse velocity and the variation of this parameter with distance from the Sun.

    Key words. Interplanetary physics (MHD waves and turbulence; solar wind plasma; instruments and techniques

  17. The role of MEXART in the National Space Weather Laboratory of Mexico: Detection of solar wind, CMEs, ionosphere, active regions and flares.

    Science.gov (United States)

    Mejia-Ambriz, J.; Gonzalez-Esparza, A.; De la Luz, V.; Villanueva-Hernandez, P.; Andrade, E.; Aguilar-Rodriguez, E.; Chang, O.; Romero Hernandez, E.; Sergeeva, M. A.; Perez Alanis, C. A.; Reyes-Marin, P. A.

    2017-12-01

    The National Space Weather Laboratory - Laboratorio Nacional de Clima Espacial (LANCE) - of Mexico has different ground based instruments to study and monitor the space weather. One of these instruments is the Mexican Array Radio Telescope (MEXART) which is principally dedicated to remote sensing the solar wind and coronal mass ejections (CMEs) at 140 MHz, the instrument can detect solar wind densities and speeds from about 0.4 to 1 AU by modeling observations of interplanetary scintillation (IPS). MEXART is also able to detect ionospheric disturbances associated with transient space weather events by the analysis of ionospheric scintillation (IONS) . Additionally, MEXART has followed the Sun since the beginning of the current Solar Cycle 24 with records of 8 minutes per day, and occasionally, has partially detected the process of strong solar flares. Here we show the contributions of MEXART to the LANCE by reporting recent detections of CMEs by IPS, the arrive of transient events at Earth by IONS, the influence of active regions in the flux of the Sun at 140 MHz and the detection of a M6.5 class flare. Furthermore we report the status of a near real time analysis of IPS data for forecast purposes and the potential contribution to the Worldwide IPS Stations network (WIPSS), which is an effort to achieve a better coverage of the solar wind observations in the inner heliosphere.

  18. Coherent structures at ion scales in fast and slow solar wind: Cluster observations

    Science.gov (United States)

    Perrone, D.; Alexandrova, O.; Zouganelis, Y.; Roberts, O.; Lion, S.; Escoubet, C. P.; Walsh, A. P.; Maksimovic, M.; Lacombe, C.

    2017-12-01

    Spacecraft measurements generally reveal that solar wind electromagnetic fluctuations are in a state of fully-developed turbulence. Turbulence represents a very complex problem in plasmas since cross-scale coupling and kinetic effects are present. Moreover, the intermittency phenomenon, i.e. the manifestation of the non-uniform and inhomogeneous energy transfer and dissipation in a turbulent system, represents a very important aspect of the solar wind turbulent cascade. Here, we study coherent structures responsible for solar wind intermittency around ion characteristic scales. We find that, in fast solar wind, intermittency is due to Alfvén vortex-like structures and current sheets. In slow solar wind, we observe as well compressive structures like magnetic solitons, holes and shocks. By using high-time resolution magnetic field data of multi-point measurements of Cluster spacecraft, we characterize the observed coherent structures in terms of topology and propagation speed. We show that all structures around ion characteristic scales, both in fast and slow solar wind, are characterized by a strong wave-vector anisotropy in the perpendicular direction with respect to the local magnetic field. Moreover, some of them propagate in the plasma rest frame in the direction perpendicular to the local field. Finally, a further analysis on the electron and ion velocity distributions shows a high variability; in particular, close to coherent structures the electron and ion distribution functions appear strongly deformed and far from the thermodynamic equilibrium. Possible interpretations of the observed structures and their role in the heating process of the plasma are also discussed.

  19. Weaving the history of the solar wind with magnetic field lines

    Science.gov (United States)

    Alvarado Gomez, Julian

    2017-08-01

    Despite its fundamental role for the evolution of the solar system, our observational knowledge of the wind properties of the young Sun comes from a single stellar observation. This unexpected fact for a field such as astrophysics arises from the difficulty of detecting Sun-like stellar winds. Their detection relies on the appearance of an astrospheric signature (from the stellar wind-ISM interaction region), visible only with the aid of high-resolution HST Lyman-alpha spectra. However, observations and modelling of the present day Sun have revealed that magnetic fields constitute the main driver of the solar wind, providing guidance on how such winds would look like back in time. In this context we propose observations of four young Sun-like stars in order to detect their astrospheres and characterise their stellar winds. For all these objects we have recovered surface magnetic field maps using the technique of Zeeman Doppler Imaging, and developed detailed wind models based on these observed field distributions. Even a single detection would represent a major step forward for our understanding of the history of the solar wind, and the outflows in more active stars. Mass loss rate estimates from HST will be confronted with predictions from realistic models of the corona/stellar wind. In one of our objects the comparison would allow us to quantify the wind variability induced by the magnetic cycle of a star, other than the Sun, for the first time. Three of our targets are planet hosts, thus the HST spectra would also provide key information on the high-energy environment of these systems, guaranteeing their legacy value for the growing field of exoplanet characterisation.

  20. Recent Successes of Wave/Turbulence Driven Models of Solar Wind Acceleration

    Science.gov (United States)

    Cranmer, S. R.; Hollweg, J. V.; Chandran, B. D.; van Ballegooijen, A. A.

    2010-12-01

    A key obstacle in the way of producing realistic simulations of the Sun-heliosphere system is the lack of a first-principles understanding of coronal heating. Also, it is still unknown whether the solar wind is "fed" through flux tubes that remain open (and are energized by footpoint-driven wavelike fluctuations) or if mass and energy are input intermittently from closed loops into the open-field regions. In this presentation, we discuss self-consistent models that assume the energy comes from solar Alfven waves that are partially reflected, and then dissipated, by magnetohydrodynamic turbulence. These models have been found to reproduce many of the observed features of the fast and slow solar wind without the need for artificial "coronal heating functions" used by earlier models. For example, the models predict a variation with wind speed in commonly measured ratios of charge states and elemental abundances that agrees with observed trends. This contradicts a commonly held assertion that these ratios can only be produced by the injection of plasma from closed-field regions on the Sun. This presentation also reviews two recent comparisons between the models and empirical measurements: (1) The models successfully predict the amplitude and radial dependence of Faraday rotation fluctuations (FRFs) measured by the Helios probes for heliocentric distances between 2 and 15 solar radii. The FRFs are a particularly sensitive test of turbulence models because they depend not only on the plasma density and Alfven wave amplitude in the corona, but also on the turbulent correlation length. (2) The models predict the correct sense and magnitude of changes seen in the polar high-speed solar wind by Ulysses from the previous solar minimum (1996-1997) to the more recent peculiar minimum (2008-2009). By changing only the magnetic field along the polar magnetic flux tube, consistent with solar and heliospheric observations at the two epochs, the model correctly predicts that the

  1. Assessing the lifecycle greenhouse gas emissions from solar PV and wind energy

    DEFF Research Database (Denmark)

    Nugent, Daniel; Sovacool, Benjamin

    2014-01-01

    This paper critically screens 153 lifecycle studies covering a broad range of wind and solar photovoltaic (PV) electricity generation technologies to identify 41 of the most relevant, recent, rigorous, original, and complete assessments so that the dynamics of their greenhouse gas (GHG) emissions...... profiles can be determined. When viewed in a holistic manner, including initial materials extraction, manufacturing, use and disposal/decommissioning, these 41 studies show that both wind and solar systems are directly tied to and responsible for GHG emissions. They are thus not actually emissions free......, this article uncovers best practices in wind and solar design and deployment that can better inform climate change mitigation efforts in the electricity sector...

  2. A consistent thermodynamics of the MHD wave-heated two-fluid solar wind

    Directory of Open Access Journals (Sweden)

    I. V. Chashei

    Full Text Available We start our considerations from two more recent findings in heliospheric physics: One is the fact that the primary solar wind protons do not cool off adiabatically with distance, but appear to be heated. The other one is that secondary protons, embedded in the solar wind as pick-up ions, behave quasi-isothermal at their motion to the outer heliosphere. These two phenomena must be physically closely connected with each other. To demonstrate this we solve a coupled set of enthalpy flow conservation equations for the two-fluid solar wind system consisting of primary and secondary protons. The coupling of these equations comes by the heat sources that are relevant, namely the dissipation of MHD turbulence power to the respective protons at the relevant dissipation scales. Hereby we consider both the dissipation of convected turbulences and the dissipation of turbulences locally driven by the injection of new pick-up ions into an unstable mode of the ion distribution function. Conversion of free kinetic energy of freshly injected secondary ions into turbulence power is finally followed by partial reabsorption of this energy both by primary and secondary ions. We show solutions of simultaneous integrations of the coupled set of differential thermodynamic two-fluid equations and can draw interesting conclusions from the solutions obtained. We can show that the secondary proton temperature with increasing radial distance asymptotically attains a constant value with a magnitude essentially determined by the actual solar wind velocity. Furthermore, we study the primary proton temperature within this two-fluid context and find a polytropic behaviour with radially and latitudinally variable polytropic indices determined by the local heat sources due to dissipated turbulent wave energy. Considering latitudinally variable solar wind conditions, as published by McComas et al. (2000, we also predict latitudinal variations of primary proton temperatures at

  3. A consistent thermodynamics of the MHD wave-heated two-fluid solar wind

    Directory of Open Access Journals (Sweden)

    I. V. Chashei

    2003-07-01

    Full Text Available We start our considerations from two more recent findings in heliospheric physics: One is the fact that the primary solar wind protons do not cool off adiabatically with distance, but appear to be heated. The other one is that secondary protons, embedded in the solar wind as pick-up ions, behave quasi-isothermal at their motion to the outer heliosphere. These two phenomena must be physically closely connected with each other. To demonstrate this we solve a coupled set of enthalpy flow conservation equations for the two-fluid solar wind system consisting of primary and secondary protons. The coupling of these equations comes by the heat sources that are relevant, namely the dissipation of MHD turbulence power to the respective protons at the relevant dissipation scales. Hereby we consider both the dissipation of convected turbulences and the dissipation of turbulences locally driven by the injection of new pick-up ions into an unstable mode of the ion distribution function. Conversion of free kinetic energy of freshly injected secondary ions into turbulence power is finally followed by partial reabsorption of this energy both by primary and secondary ions. We show solutions of simultaneous integrations of the coupled set of differential thermodynamic two-fluid equations and can draw interesting conclusions from the solutions obtained. We can show that the secondary proton temperature with increasing radial distance asymptotically attains a constant value with a magnitude essentially determined by the actual solar wind velocity. Furthermore, we study the primary proton temperature within this two-fluid context and find a polytropic behaviour with radially and latitudinally variable polytropic indices determined by the local heat sources due to dissipated turbulent wave energy. Considering latitudinally variable solar wind conditions, as published by McComas et al. (2000, we also predict latitudinal variations of primary proton temperatures at

  4. Turbulence-driven coronal heating and improvements to empirical forecasting of the solar wind

    International Nuclear Information System (INIS)

    Woolsey, Lauren N.; Cranmer, Steven R.

    2014-01-01

    Forecasting models of the solar wind often rely on simple parameterizations of the magnetic field that ignore the effects of the full magnetic field geometry. In this paper, we present the results of two solar wind prediction models that consider the full magnetic field profile and include the effects of Alfvén waves on coronal heating and wind acceleration. The one-dimensional magnetohydrodynamic code ZEPHYR self-consistently finds solar wind solutions without the need for empirical heating functions. Another one-dimensional code, introduced in this paper (The Efficient Modified-Parker-Equation-Solving Tool, TEMPEST), can act as a smaller, stand-alone code for use in forecasting pipelines. TEMPEST is written in Python and will become a publicly available library of functions that is easy to adapt and expand. We discuss important relations between the magnetic field profile and properties of the solar wind that can be used to independently validate prediction models. ZEPHYR provides the foundation and calibration for TEMPEST, and ultimately we will use these models to predict observations and explain space weather created by the bulk solar wind. We are able to reproduce with both models the general anticorrelation seen in comparisons of observed wind speed at 1 AU and the flux tube expansion factor. There is significantly less spread than comparing the results of the two models than between ZEPHYR and a traditional flux tube expansion relation. We suggest that the new code, TEMPEST, will become a valuable tool in the forecasting of space weather.

  5. Turbulence-driven coronal heating and improvements to empirical forecasting of the solar wind

    Energy Technology Data Exchange (ETDEWEB)

    Woolsey, Lauren N.; Cranmer, Steven R. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States)

    2014-06-01

    Forecasting models of the solar wind often rely on simple parameterizations of the magnetic field that ignore the effects of the full magnetic field geometry. In this paper, we present the results of two solar wind prediction models that consider the full magnetic field profile and include the effects of Alfvén waves on coronal heating and wind acceleration. The one-dimensional magnetohydrodynamic code ZEPHYR self-consistently finds solar wind solutions without the need for empirical heating functions. Another one-dimensional code, introduced in this paper (The Efficient Modified-Parker-Equation-Solving Tool, TEMPEST), can act as a smaller, stand-alone code for use in forecasting pipelines. TEMPEST is written in Python and will become a publicly available library of functions that is easy to adapt and expand. We discuss important relations between the magnetic field profile and properties of the solar wind that can be used to independently validate prediction models. ZEPHYR provides the foundation and calibration for TEMPEST, and ultimately we will use these models to predict observations and explain space weather created by the bulk solar wind. We are able to reproduce with both models the general anticorrelation seen in comparisons of observed wind speed at 1 AU and the flux tube expansion factor. There is significantly less spread than comparing the results of the two models than between ZEPHYR and a traditional flux tube expansion relation. We suggest that the new code, TEMPEST, will become a valuable tool in the forecasting of space weather.

  6. OBSERVATION OF UNIVERSALITY IN THE GENERALIZED SIMILARITY OF EVOLVING SOLAR WIND TURBULENCE AS SEEN BY ULYSSES

    International Nuclear Information System (INIS)

    Chapman, S. C.; Nicol, R. M.; Leonardis, E.; Kiyani, K.; Carbone, V.

    2009-01-01

    We perform statistical analysis of the fluctuating magnetic field observed in-situ by the Ulysses spacecraft, from the perspective of quantitative characterization of the evolving magnetohydrodynamic (MHD) turbulence. We focus on two successive polar passes around solar minimum which provide extended intervals of quiet, fast solar wind at a range of radial distances and latitudes: the south polar pass of 1994 and the north polar pass of 1995. Fully developed inertial range turbulence has a characteristic statistical similarity property of quantities that characterize the flow, such as the magnetic field components B k (t), so that the pth moment of fluctuations has power-law dependence on scale τ such that k (t + τ) - B k (t)| p > ∼ τ ζ(p) . We instead find a generalized similarity k (t + τ) - B k (t)| p > ∼ g(τ/τ 0 ) ζ(p) consistent with extended self-similarity; and in particular all of these Ulysses observations, from both polar passes, share the same single function g(τ/τ 0 ). If these observations are indeed characteristic of MHD turbulence evolving in-situ, then this quantifies for the first time a key aspect of the universal nature of evolving MHD turbulence in a system of finite size, with implications both for theoretical development, and for our understanding of the evolving solar wind.

  7. Ion acoustic waves and related plasma observations in the solar wind

    International Nuclear Information System (INIS)

    Gurnett, D.A.; Marsch, E.; Pilipp, W.; Schwenn, R.; Rosenbauer, H.

    1979-01-01

    This paper presents an investigation of solar wind ion acoustic waves and their relationship to the macroscopic and microscopic characteristics of the solar wind plasma. Comparisons with the overall solar wind corotational structure show that the most intense ion acoustic waves usually occur in the low-velocity regions ahead of high-speed solar wind streams. Of the detailed plasma parameters investigated, the ion acoustic wave intensities are found to be most closely correlated with the electron to proton temperature ratio T/sub e//T/sub p/ and with the electron heat flux. Investigations of the detailed electron and proton distribution functions also show that the ion acoustic waves usually occur in regions with highly non-Maxwellian distributions characteristic of double-proton streams. The distribution functions for the double-proton streams are usually not resolved into two clearly defined peaks, but rather they appear as a broad shoulder on the main proton distribution. Two main mechanisms, an electron heat flux instability and a double-ion beam instability, are considered for generating the ion-acoustic-like waves observed in the solar wind. Both mechanisms have favorable and unfavorable features. The electron heat flux mechanism can account for the observed waves at moderate to large ratios of T/sub e//T/sub p/ but has problems when T/sub e//T/sub p/ is small, as sometimes occurs. The ion beam instability appears to provide more flexibility on the T/sub e//T/sub p/ ratio; however detailed comparisons using observed distribution functions indicate that the ion beam mode is usually stable. Possible resolutions of these difficulties are discussed

  8. Magnetosheath waves under very low solar wind dynamic pressure: Wind/Geotail observations

    Directory of Open Access Journals (Sweden)

    C. J. Farrugia

    2005-06-01

    Full Text Available The expanded bow shock on and around "the day the solar wind almost disappeared" (11 May 1999 allowed the Geotail spacecraft to make a practically uninterrupted 54-h-long magnetosheath pass near dusk (16:30-21:11 magnetic local time at a radial distance of 24 to 30 RE (Earth radii. During most of this period, interplanetary parameters varied gradually and in such a way as to give rise to two extreme magnetosheath structures, one dominated by magnetohydrodynamic (MHD effects and the other by gas dynamic effects. We focus attention on unusual features of electromagnetic ion wave activity in the former magnetosheath state, and compare these features with those in the latter. Magnetic fluctuations in the gas dynamic magnetosheath were dominated by compressional mirror mode waves, and left- and right-hand polarized electromagnetic ion cyclotron (EIC waves transverse to the background field. In contrast, the MHD magnetosheath, lasting for over one day, was devoid of mirror oscillations and permeated instead by EIC waves of weak intensity. The weak wave intensity is related to the prevailing low solar wind dynamic pressures. Left-hand polarized EIC waves were replaced by bursts of right-hand polarized waves, which remained for many hours the only ion wave activity present. This activity occurred when the magnetosheath proton temperature anisotropy (= $T_{p, perp}/T_{p, parallel}{-}1$ became negative. This was because the weakened bow shock exposed the magnetosheath directly to the (negative temperature anisotropy of the solar wind. Unlike the normal case studied in the literature, these right-hand waves were not by-products of left-hand polarized waves but derived their energy source directly from the magnetosheath temperature anisotropy. Brief entries into the

  9. Reliability and cost/worth evaluation of generating systems utilizing wind and solar energy

    Science.gov (United States)

    Bagen

    The utilization of renewable energy resources such as wind and solar energy for electric power supply has received considerable attention in recent years due to adverse environmental impacts and fuel cost escalation associated with conventional generation. At the present time, wind and/or solar energy sources are utilized to generate electric power in many applications. Wind and solar energy will become important sources for power generation in the future because of their environmental, social and economic benefits, together with public support and government incentives. The wind and sunlight are, however, unstable and variable energy sources, and behave far differently than conventional sources. Energy storage systems are, therefore, often required to smooth the fluctuating nature of the energy conversion system especially in small isolated applications. The research work presented in this thesis is focused on the development and application of reliability and economic benefits assessment associated with incorporating wind energy, solar energy and energy storage in power generating systems. A probabilistic approach using sequential Monte Carlo simulation was employed in this research and a number of analyses were conducted with regards to the adequacy and economic assessment of generation systems containing wind energy, solar energy and energy storage. The evaluation models and techniques incorporate risk index distributions and different operating strategies associated with diesel generation in small isolated systems. Deterministic and probabilistic techniques are combined in this thesis using a system well-being approach to provide useful adequacy indices for small isolated systems that include renewable energy and energy storage. The concepts presented and examples illustrated in this thesis will help power system planners and utility managers to assess the reliability and economic benefits of utilizing wind energy conversion systems, solar energy conversion

  10. Investigating the Correlation Between Wind and Solar Power Forecast Errors in the Western Interconnection: Preprint

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, J.; Hodge, B. M.; Florita, A.

    2013-05-01

    Wind and solar power generations differ from conventional energy generation because of the variable and uncertain nature of their power output. This variability and uncertainty can have significant impacts on grid operations. Thus, short-term forecasting of wind and solar generation is uniquely helpful for power system operations to balance supply and demand in an electricity system. This paper investigates the correlation between wind and solar power forecasting errors.

  11. Small Footprint Solar/Wind-powered CASTNET System Dataset

    Data.gov (United States)

    U.S. Environmental Protection Agency — In this Research Effort “Small Footprint Solar/Wind-Powered CASTNET System” there are two data sets. One data set contains atmospheric concentration measurements, at...

  12. Regional variations in the health, environmental, and climate benefits of wind and solar generation

    Science.gov (United States)

    Siler-Evans, Kyle; Azevedo, Inês Lima; Morgan, M. Granger; Apt, Jay

    2013-01-01

    When wind or solar energy displace conventional generation, the reduction in emissions varies dramatically across the United States. Although the Southwest has the greatest solar resource, a solar panel in New Jersey displaces significantly more sulfur dioxide, nitrogen oxides, and particulate matter than a panel in Arizona, resulting in 15 times more health and environmental benefits. A wind turbine in West Virginia displaces twice as much carbon dioxide as the same turbine in California. Depending on location, we estimate that the combined health, environmental, and climate benefits from wind or solar range from $10/MWh to $100/MWh, and the sites with the highest energy output do not yield the greatest social benefits in many cases. We estimate that the social benefits from existing wind farms are roughly 60% higher than the cost of the Production Tax Credit, an important federal subsidy for wind energy. However, that same investment could achieve greater health, environmental, and climate benefits if it were differentiated by region. PMID:23798431

  13. The Feasibility of Wind and Solar Energy Application for Oil and Gas Offshore Platform

    International Nuclear Information System (INIS)

    Tiong, Y K; Zahari, M A; Wong, S F; Dol, S S

    2015-01-01

    Renewable energy is an energy which is freely available in nature such as winds and solar energy. It plays a critical role in greening the energy sector as these sources of energy produce little or no pollution to environment. This paper will focus on capability of renewable energy (wind and solar) in generating power for offshore application. Data of wind speeds and solar irradiation that are available around SHELL Sabah Water Platform for every 10 minutes, 24 hours a day, for a period of one year are provided by SHELL Sarawak Sdn. Bhd. The suitable wind turbine and photovoltaic panel that are able to give a high output and higher reliability during operation period are selected by using the tabulated data. The highest power output generated using single wind energy application is equal to 492 kW while for solar energy application is equal to 20 kW. Using the calculated data, the feasibility of renewable energy is then determined based on the platform energy demand. (paper)

  14. Regional variations in the health, environmental, and climate benefits of wind and solar generation.

    Science.gov (United States)

    Siler-Evans, Kyle; Azevedo, Inês Lima; Morgan, M Granger; Apt, Jay

    2013-07-16

    When wind or solar energy displace conventional generation, the reduction in emissions varies dramatically across the United States. Although the Southwest has the greatest solar resource, a solar panel in New Jersey displaces significantly more sulfur dioxide, nitrogen oxides, and particulate matter than a panel in Arizona, resulting in 15 times more health and environmental benefits. A wind turbine in West Virginia displaces twice as much carbon dioxide as the same turbine in California. Depending on location, we estimate that the combined health, environmental, and climate benefits from wind or solar range from $10/MWh to $100/MWh, and the sites with the highest energy output do not yield the greatest social benefits in many cases. We estimate that the social benefits from existing wind farms are roughly 60% higher than the cost of the Production Tax Credit, an important federal subsidy for wind energy. However, that same investment could achieve greater health, environmental, and climate benefits if it were differentiated by region.

  15. Mirror Instability in the Turbulent Solar Wind

    Czech Academy of Sciences Publication Activity Database

    Hellinger, Petr; Landi, S.; Matteini, L.; Verdini, A.; Franci, L.

    2017-01-01

    Roč. 838, č. 2 (2017), 158/1-158/7 ISSN 0004-637X Institutional support: RVO:67985815 Keywords : instabilities * solar wind * waves Subject RIV: BN - Astronomy, Celestial Mechanics, Astrophysics OBOR OECD: Astronomy (including astrophysics,space science) Impact factor: 5.533, year: 2016

  16. Ulysses Observations of Tripolar Guide-Magnetic Field Perturbations Across Solar Wind Reconnection Exhausts

    Science.gov (United States)

    Eriksson, S.; Peng, B.; Markidis, S.; Gosling, J. T.; McComas, D. J.; Lapenta, G.; Newman, D. L.

    2014-12-01

    We report observations from 15 solar wind reconnection exhausts encountered along the Ulysses orbit beyond 4 AU in 1996-1999 and 2002-2005. The events, which lasted between 17 and 45 min, were found at heliospheric latitudes between -36o and 21o with one event detected as high as 58o. All events shared a common characteristic of a tripolar guide-magnetic field perturbation being detected across the observed exhausts. The signature consists of an enhanced guide field magnitude within the exhaust center and two regions of significantly depressed guide-fields adjacent to the center region. The events displayed magnetic field shear angles as low as 37o with a mean of 89o. This corresponds to a strong external guide field relative to the anti-parallel reconnecting component of the magnetic field with a mean ratio of 1.3 and a maximum ratio of 3.1. A 2-D kinetic reconnection simulation for realistic solar wind conditions reveals that tripolar guide fields form at current sheets in the presence of multiple X-lines as two magnetic islands interact with one another for such strong guide fields. The Ulysses observations are also compared with the results of a 3-D kinetic simulation of multiple flux ropes in a strong guide field.

  17. Solar PV resource for higher penetration through a combined spatial aggregation with wind

    CSIR Research Space (South Africa)

    Bischof-Niemz, ST

    2016-06-01

    Full Text Available between wind and solar PV and how these would be reflected in the power system. The benefits of spatial distribution of renewables are well understood, but the impact of the combined spatial aggregation of wind and solar PV is central to the design...

  18. Economic Dispatch for Power System Included Wind and Solar Thermal Energy

    Directory of Open Access Journals (Sweden)

    Saoussen BRINI

    2009-07-01

    Full Text Available With the fast development of technologies of alternative energy, the electric power network can be composed of several renewable energy resources. The energy resources have various characteristics in terms of operational costs and reliability. In this study, the problem is the Economic Environmental Dispatching (EED of hybrid power system including wind and solar thermal energies. Renewable energy resources depend on the data of the climate such as the wind speed for wind energy, solar radiation and the temperature for solar thermal energy. In this article it proposes a methodology to solve this problem. The resolution takes account of the fuel costs and reducing of the emissions of the polluting gases. The resolution is done by the Strength Pareto Evolutionary Algorithm (SPEA method and the simulations have been made on an IEEE network test (30 nodes, 8 machines and 41 lines.

  19. Physics-based Tests to Identify the Accuracy of Solar Wind Ion Measurements: A Case Study with the Wind Faraday Cups

    Science.gov (United States)

    Kasper, J. C.; Lazarus, A. J.; Steinberg, J. T.; Ogilvie, K. W.; Szabo, A.

    2006-01-01

    We present techniques for comparing measurements of velocity, temperature, and density with constraints imposed by the plasma physics of magnetized bi-Maxwellian ions. Deviations from these physics-based constraints are interpreted as arising from measurement errors. Two million ion spectra from the Solar Wind Experiment Faraday Cup instruments on the Wind spacecraft are used as a case study. The accuracy of velocity measurements is determined by the fact that differential flow between hydrogen and helium should be aligned with the ambient magnetic field. Modeling the breakdown of field alignment suggests velocity uncertainties are less than 0.16% in magnitude and 3deg in direction. Temperature uncertainty is found by examining the distribution of observed temperature anisotropies in high-beta solar wind intervals where the firehose, mirror, and cyclotron microinstabilities should drive the distribution to isotropy. The presence of a finite anisotropy at high beta suggests overall temperature uncertainties of 8%. Hydrogen and helium number densities are compared with the electron density inferred from observations of the local electron plasma frequency as a function of solar wind speed and year. We find that after accounting for the contribution of minor ions, the results are consistent with a systematic offset between the two instruments of 34%. The temperature and density methods are sensitive to non-Maxwellian features such as heat flux and proton beams and as a result are more suited to slow solar wind where these features are rare. These procedures are of general use in identifying the accuracy of observations from any solar wind ion instrument.

  20. Solar wind fluctuations at large scale - A comparison between low and high solar activity conditions

    Science.gov (United States)

    Bavassano, B.; Bruno, R.

    1991-02-01

    The influence of the sun's activity cycle on the solar wind fluctuations at time scales from 1 hour to 3 days in the inner heliosphere (0.3 to 1 AU) is investigated. Hourly averages of plasma and magnetic field data by Helios spacecraft are used. Since fluctuations behave quite differently with changing scale, the analysis is performed separately for two different ranges in time scale. Between 1 and 6 hours Alfvenic fluctuations and pressure-balanced structures are extensively observed. At low solar activity and close to 0.3 AU Alfvenic fluctuations are more frequent than pressure-balanced structures. This predominance, however, weakens for rising solar activity and radial distance, to the point that a role-exchange, in terms of occurrence rate, is found at the maximum of the cycle close to 1 AU. On the other hand, in all cases Alfvenic fluctuations have a larger amplitude than pressure-balanced structures. The Alfvenic contribution to the solar wind energy spectrum comes out to be dominant at all solar activity conditions. These findings support the conclusion that the solar cycle evolution of the large-scale velocity pattern is the factor governing the observed variations.

  1. Western Wind and Solar Integration Study Phase 3A: Low Levels of Synchronous Generation

    Energy Technology Data Exchange (ETDEWEB)

    Miller, Nicholas W. [GE Energy Management, Atlanta, GA (United States); Leonardi, Bruno [GE Energy Management, Atlanta, GA (United States); D' Aquila, Robert [GE Energy Management, Atlanta, GA (United States); Clark, Kara [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2015-11-17

    The stability of the North American electric power grids under conditions of high penetrations of wind and solar is a significant concern and possible impediment to reaching renewable energy goals. The 33% wind and solar annual energy penetration considered in this study results in substantial changes to the characteristics of the bulk power system. This includes different power flow patterns, different commitment and dispatch of existing synchronous generation, and different dynamic behavior from wind and solar generation. The Western Wind and Solar Integration Study (WWSIS), sponsored by the U.S. Department of Energy, is one of the largest regional solar and wind integration studies to date. In multiple phases, it has explored different aspects of the question: Can we integrate large amounts of wind and solar energy into the electric power system of the West? The work reported here focused on the impact of low levels of synchronous generation on the transient stability performance in one part of the region in which wind generation has displaced synchronous thermal generation under highly stressed, weak system conditions. It is essentially an extension of WWSIS-3. Transient stability, the ability of the power system to maintain synchronism among all elements following disturbances, is a major constraint on operations in many grids, including the western U.S. and Texas systems. These constraints primarily concern the performance of the large-scale bulk power system. But grid-wide stability concerns with high penetrations of wind and solar are still not thoroughly understood. This work focuses on 'traditional' fundamental frequency stability issues, such as maintaining synchronism, frequency, and voltage. The objectives of this study are to better understand the implications of low levels of synchronous generation and a weak grid on overall system performance by: 1) Investigating the Western Interconnection under conditions of both high renewable

  2. Estimates of Sputter Yields of Solar-Wind Heavy Ions of Lunar Regolith Materials

    Science.gov (United States)

    Barghouty, Abdulmasser F.; Adams, James H., Jr.

    2008-01-01

    At energies of approximately 1 keV/amu, solar-wind protons and heavy ions interact with the lunar surface materials via a number of microscopic interactions that include sputtering. Solar-wind induced sputtering is a main mechanism by which the composition of the topmost layers of the lunar surface can change, dynamically and preferentially. This work concentrates on sputtering induced by solar-wind heavy ions. Sputtering associated with slow (speeds the electrons speed in its first Bohr orbit) and highly charged ions are known to include both kinetic and potential sputtering. Potential sputtering enjoys some unique characteristics that makes it of special interest to lunar science and exploration. Unlike the yield from kinetic sputtering where simulation and approximation schemes exist, the yield from potential sputtering is not as easy to estimate. This work will present a preliminary numerical scheme designed to estimate potential sputtering yields from reactions relevant to this aspect of solar-wind lunar-surface coupling.

  3. The S-Web Model for the Sources of the Slow Solar Wind

    Science.gov (United States)

    Antiochos, Spiro K.; Karpen, Judith T.; DeVore, C. Richard

    2012-01-01

    Models for the origin of the slow solar wind must account for two seemingly contradictory observations: The slow wind has the composition of the closed-field corona, implying that it originates from the continuous opening and closing of flux at the boundary between open and closed field. On the other hand, the slow wind has large angular width, up to 60 degrees, suggesting that its source extends far from the open-closed boundary. We describe a model that can explain both observations. The key idea is that the source of the slow wind at the Sun is a network of narrow (possibly singular) open-field corridors that map to a web of separatrices (the S-Web) and quasi-separatrix layers in the heliosphere. We discuss the dynamics of the S-Web model and its implications for present observations and for the upcoming observations from Solar Orbiter and Solar Probe Plus.

  4. The influence of solar active region evolution on solar wind streams, coronal hole boundaries and geomagnetic storms

    Science.gov (United States)

    Gold, R. E.; Dodson-Prince, H. W.; Hedeman, E. R.; Roelof, E. C.

    1982-01-01

    Solar and interplanetary data are examined, taking into account the identification of the heliographic longitudes of the coronal source regions of high speed solar wind (SW) streams by Nolte and Roelof (1973). Nolte and Roelof have 'mapped' the velocities measured near earth back to the sun using the approximation of constant radial velocity. The 'Carrington carpet' for rotations 1597-1616 is shown in a graph. Coronal sources of high speed streams appear in the form of solid black areas. The contours of the stream sources are laid on 'evolutionary charts' of solar active region histories for the Southern and Northern Hemispheres. Questions regarding the interplay of active regions and solar wind are investigated, giving attention to developments during the years 1973, 1974, and 1975.

  5. Kinetic instabilities in the solar wind driven by temperature anisotropies

    Science.gov (United States)

    Yoon, Peter H.

    2017-12-01

    The present paper comprises a review of kinetic instabilities that may be operative in the solar wind, and how they influence the dynamics thereof. The review is limited to collective plasma instabilities driven by the temperature anisotropies. To limit the scope even further, the discussion is restricted to the temperature anisotropy-driven instabilities within the model of bi-Maxwellian plasma velocity distribution function. The effects of multiple particle species or the influence of field-aligned drift will not be included. The field-aligned drift or beam is particularly prominent for the solar wind electrons, and thus ignoring its effect leaves out a vast portion of important physics. Nevertheless, for the sake of limiting the scope, this effect will not be discussed. The exposition is within the context of linear and quasilinear Vlasov kinetic theories. The discussion does not cover either computer simulations or data analyses of observations, in any systematic manner, although references will be made to published works pertaining to these methods. The scientific rationale for the present analysis is that the anisotropic temperatures associated with charged particles are pervasively detected in the solar wind, and it is one of the key contemporary scientific research topics to correctly characterize how such anisotropies are generated, maintained, and regulated in the solar wind. The present article aims to provide an up-to-date theoretical development on this research topic, largely based on the author's own work.

  6. The solar and interplanetary causes of the recent minimum in geomagnetic activity (MGA23: a combination of midlatitude small coronal holes, low IMF BZ variances, low solar wind speeds and low solar magnetic fields

    Directory of Open Access Journals (Sweden)

    B. T. Tsurutani

    2011-05-01

    Full Text Available Minima in geomagnetic activity (MGA at Earth at the ends of SC23 and SC22 have been identified. The two MGAs (called MGA23 and MGA22, respectively were present in 2009 and 1997, delayed from the sunspot number minima in 2008 and 1996 by ~1/2–1 years. Part of the solar and interplanetary causes of the MGAs were exceptionally low solar (and thus low interplanetary magnetic fields. Another important factor in MGA23 was the disappearance of equatorial and low latitude coronal holes and the appearance of midlatitude coronal holes. The location of the holes relative to the ecliptic plane led to low solar wind speeds and low IMF (Bz variances (σBz2 and normalized variances (σBz2/B02 at Earth, with concomitant reduced solar wind-magnetospheric energy coupling. One result was the lowest ap indices in the history of ap recording. The results presented here are used to comment on the possible solar and interplanetary causes of the low geomagnetic activity that occurred during the Maunder Minimum.

  7. On the signatures of magnetic islands and multiple X-lines in the solar wind as observed by ARTEMIS and WIND

    International Nuclear Information System (INIS)

    Eriksson, S; Newman, D L; Lapenta, G; Angelopoulos, V

    2014-01-01

    We report the first observation consistent with a magnetic reconnection generated magnetic island at a solar wind current sheet that was observed on 10 June 2012 by the two ARTEMIS satellites and the upstream WIND satellite. The evidence consists of a core magnetic field within the island which is formed by enhanced Hall magnetic fields across a solar wind reconnection exhaust. The core field at ARTEMIS displays a local dip coincident with a peak plasma density enhancement and a locally slower exhaust speed which differentiates it from a regular solar wind exhaust crossing. Further indirect evidence of magnetic island formation is presented in the form of a tripolar Hall magnetic field, which is supported by an observed electron velocity shear, and plasma density depletion regions which are in general agreement with multiple reconnection X-line signatures at the same current sheet on the basis of predicted signatures of magnetic islands as generated by a kinetic reconnection simulation for solar wind-like conditions. The combined ARTEMIS and WIND observations of tripolar Hall magnetic fields across the same exhaust and Grad–Shrafranov reconstructions of the magnetic field suggest that an elongated magnetic island was encountered which displayed a 4R E normal width and a 43R E extent along the exhaust between two neighboring X-lines. (paper)

  8. Tropospheric weather influenced by solar wind through atmospheric vertical coupling downward control

    Science.gov (United States)

    Prikryl, Paul; Bruntz, Robert; Tsukijihara, Takumi; Iwao, Koki; Muldrew, Donald B.; Rušin, Vojto; Rybanský, Milan; Turňa, Maroš; Šťastný, Pavel

    2018-06-01

    Occurrence of severe weather in the context of solar wind coupling to the magnetosphere-ionosphere-atmosphere (MIA) system is investigated. It is observed that significant snowfall, wind and heavy rain, particularly if caused by low pressure systems in winter, tend to follow arrivals of high-speed solar wind. Previously published statistical evidence that explosive extratropical cyclones in the northern hemisphere tend to occur within a few days after arrivals of high-speed solar wind streams from coronal holes (Prikryl et al., 2009, 2016) is corroborated for the southern hemisphere. Cases of severe weather events are examined in the context of the magnetosphere-ionosphere-atmosphere (MIA) coupling. Physical mechanism to explain these observations is proposed. The leading edge of high-speed solar wind streams is a locus of large-amplitude magneto-hydrodynamic waves that modulate Joule heating and/or Lorentz forcing of the high-latitude lower thermosphere generating medium-scale atmospheric gravity waves that propagate upward and downward through the atmosphere. Simulations of gravity wave propagation in a model atmosphere using the Transfer Function Model (Mayr et al., 1990) reveal that propagating waves originating in the lower thermosphere can excite a spectrum of gravity waves in the lower atmosphere. In spite of significantly reduced amplitudes but subject to amplification upon reflection in the upper troposphere, these gravity waves can provide a lift of unstable air to release instabilities in the troposphere and initiate convection to form cloud/precipitation bands. It is primarily the energy provided by release of latent heat that leads to intensification of storms. These results indicate that vertical coupling in the atmosphere exerts downward control from solar wind to the lower atmospheric levels influencing tropospheric weather development.

  9. Solar wind effects on the outer ion coma of Comet Halley

    International Nuclear Information System (INIS)

    Flammer, K.R.

    1987-01-01

    A simple two-dimensional model is developed to examine the composition of the cometary ion coma in the region outside the ionopause which is strongly affected by the solar wind. Two-dimensional ion distributions are obtained assuming a cylindrically symmetric ion coma which accounts for the dynamic effects of the mass-loaded solar wind flow around the cometary ionosphere. The results of this model are discussed in the context of analyzing the GIOTTO ion data

  10. Relation between superheating and superacceleration of helium in the solar wind

    International Nuclear Information System (INIS)

    Neugebauer, M.M.; Feldman, W.C.

    1979-01-01

    Solar wind data obtained by the OGO-5 and IMP-6-8 Earth satellites show a positive correlation between the ratio of helium to hydrogen temperatures, Tsub(α)/Tsub(p), and the velocity difference between the two ions, vsub(α)-vsub(p). Although this result disagrees with the Prognoz-1 results reported earlier in this journal, it is consistent with the expected control by Coulomb collisions when the solar-wind density is high. (Auth.)

  11. ACE/SWICS OBSERVATIONS OF HEAVY ION DROPOUTS WITHIN THE SOLAR WIND

    Energy Technology Data Exchange (ETDEWEB)

    Weberg, Micah J. [PhD Candidate in Space and Planetary Physics, 2435 Space Research Building, 2455 Hayward Street, Ann Arbor, MI 48109-2143, USA. (United States); Zurbuchen, Thomas H. [Professor, Space Science and Aerospace Engineering, Associate Dean for Entrepreneurship, 2429 Space Research Building, 2455 Hayward Street, Ann Arbor, MI 48109-2143, USA. (United States); Lepri, Susan T., E-mail: mjweberg@umich.edu, E-mail: thomasz@umich.edu, E-mail: slepri@umich.edu [Associate Research Scientist, 2417 Space Research Building, 2455 Hayward Street, Ann Arbor, MI 48109-2143, USA. (United States)

    2012-11-20

    We present the first in situ observations of heavy ion dropouts within the slow solar wind, observed for select elements ranging from helium to iron. For iron, these dropouts manifest themselves as depletions of the Fe/H ratio by factors up to {approx}25. The events often exhibit mass-dependent fractionation and are contained in slow, unsteady wind found within a few days from known stream interfaces. We propose that such dropouts are evidence of gravitational settling within large coronal loops, which later undergo interchange reconnection and become source regions of slow, unsteady wind. Previously, spectroscopic studies by Raymond et al. in 1997 (and later Feldman et al. in 1999) have yielded strong evidence for gravitational settling within these loops. However, their expected in situ signature plasma with heavy elements fractionated by mass was not observed prior to this study. Using data from the SWICS instrument on board the Advanced Composition Explorer (ACE), we investigate the composition of the solar wind within these dropouts and explore long term trends over most of a solar cycle.

  12. ACE/SWICS OBSERVATIONS OF HEAVY ION DROPOUTS WITHIN THE SOLAR WIND

    International Nuclear Information System (INIS)

    Weberg, Micah J.; Zurbuchen, Thomas H.; Lepri, Susan T.

    2012-01-01

    We present the first in situ observations of heavy ion dropouts within the slow solar wind, observed for select elements ranging from helium to iron. For iron, these dropouts manifest themselves as depletions of the Fe/H ratio by factors up to ∼25. The events often exhibit mass-dependent fractionation and are contained in slow, unsteady wind found within a few days from known stream interfaces. We propose that such dropouts are evidence of gravitational settling within large coronal loops, which later undergo interchange reconnection and become source regions of slow, unsteady wind. Previously, spectroscopic studies by Raymond et al. in 1997 (and later Feldman et al. in 1999) have yielded strong evidence for gravitational settling within these loops. However, their expected in situ signature plasma with heavy elements fractionated by mass was not observed prior to this study. Using data from the SWICS instrument on board the Advanced Composition Explorer (ACE), we investigate the composition of the solar wind within these dropouts and explore long term trends over most of a solar cycle.

  13. On the Full-range β Dependence of Ion-scale Spectral Break in the Solar Wind Turbulence

    Science.gov (United States)

    Wang, Xin; Tu, Chuanyi; He, Jiansen; Wang, Linghua

    2018-04-01

    The power spectrum of magnetic fluctuations has a break at the high-frequency end of the inertial range. Beyond this break, the spectrum becomes steeper than the Kolmogorov law f ‑5/3. The break frequency was found to be associated with plasma beta (β). However, the full-range β dependence of the ion-scale spectral break has not been presented before in observational studies. Here we show the continuous variation of the break frequency on full-range β in the solar wind turbulence. By using measurements from the WIND and Ulysses spacecraft, we show the break frequency (f b ) normalized, respectively, by the frequencies corresponding to ion inertial length (f di ), ion gyroradius ({f}ρ i), and cyclotron resonance scale (f ri ) as a function of β for 1306 intervals. Their β values spread from 0.005 to 20, which nearly covers the full β range of the observed solar wind turbulence. It is found that {f}b/{f}{di} ({f}b/{f}ρ i) generally decreases (increases) with β, while {f}b/{f}{ri} is nearly a constant. We perform a linear fit on the statistical result, and obtain the empirical formulas {f}b/{f}{di}∼ {β }-1/4, {f}b/{f}ρ i∼ {β }1/4, and {f}b/{f}{ri}∼ 0.90 to describe the relation between f b and β. We also compare our observations with a numerical simulation and the prediction by ion cyclotron resonance theory. Our result favors the idea that the cyclotron resonance is an important mechanism for energy dissipation at the spectral break. When β ≪ 1 and β ≫ 1, the break at f di and {f}ρ i may also be associated with other processes.

  14. Turbulence in the solar wind: spectra from Voyager 2 data at 5 AU

    International Nuclear Information System (INIS)

    Fraternale, F; Gallana, L; Iovieno, M; Tordella, D; Opher, M; Richardson, J D

    2016-01-01

    Fluctuations in the flow velocity and magnetic fields are ubiquitous in the Solar System. These fluctuations are turbulent, in the sense that they are disordered and span a broad range of scales in both space and time. The study of solar wind turbulence is motivated by a number of factors all keys to the understanding of the Solar Wind origin and thermodynamics. The solar wind spectral properties are far from uniformity and evolve with the increasing distance from the sun. Most of the available spectra of solar wind turbulence were computed at 1 astronomical unit, while accurate spectra on wide frequency ranges at larger distances are still few. In this paper we consider solar wind spectra derived from the data recorded by the Voyager 2 mission during 1979 at about 5 AU from the sun. Voyager 2 data are an incomplete time series with a voids/signal ratio that typically increases as the spacecraft moves away from the sun (45% missing data in 1979), making the analysis challenging. In order to estimate the uncertainty of the spectral slopes, different methods are tested on synthetic turbulence signals with the same gap distribution as V2 data. Spectra of all variables show a power law scaling with exponents between −2.1 and −1.1, depending on frequency subranges. Probability density functions (PDFs) and correlations indicate that the flow has a significant intermittency. (invited comment)

  15. The solar wind and the earth

    International Nuclear Information System (INIS)

    Akasofu, I.; Kamide, Y.

    1987-01-01

    The sun constantly emits an enormous amount of radiation into space. This energy emission consists of three modes. Almost all the energy is emitted in the form of familiar sunlight but sun also emits X-rays, extreme ultraviolet (EUV), and UV radiation, which is absorbed above the earth's stratosphere, as a second mode of solar energy. The sun has made another important mode of energy emission in which the energy is carried out by charged particles. These particles have a bery wide range of energies, from less than 1 keV to more than 1 GeV. Because of this wide range, it is convenient to group them into two components: particles, with energies greater than 10 keV and the lower-energy particles. The former are generally referred to as solar portions or solar cosmic rays; their emission is associated with active features on the sun. Low-energy particles constitute plasma which is called the solar wind

  16. A Model for the Sources of the Slow Solar Wind

    Science.gov (United States)

    Antiochos, S. K.; Mikić, Z.; Titov, V. S.; Lionello, R.; Linker, J. A.

    2011-04-01

    Models for the origin of the slow solar wind must account for two seemingly contradictory observations: the slow wind has the composition of the closed-field corona, implying that it originates from the continuous opening and closing of flux at the boundary between open and closed field. On the other hand, the slow wind also has large angular width, up to ~60°, suggesting that its source extends far from the open-closed boundary. We propose a model that can explain both observations. The key idea is that the source of the slow wind at the Sun is a network of narrow (possibly singular) open-field corridors that map to a web of separatrices and quasi-separatrix layers in the heliosphere. We compute analytically the topology of an open-field corridor and show that it produces a quasi-separatrix layer in the heliosphere that extends to angles far from the heliospheric current sheet. We then use an MHD code and MDI/SOHO observations of the photospheric magnetic field to calculate numerically, with high spatial resolution, the quasi-steady solar wind, and magnetic field for a time period preceding the 2008 August 1 total solar eclipse. Our numerical results imply that, at least for this time period, a web of separatrices (which we term an S-web) forms with sufficient density and extent in the heliosphere to account for the observed properties of the slow wind. We discuss the implications of our S-web model for the structure and dynamics of the corona and heliosphere and propose further tests of the model.

  17. Modelling and Optimising the Value of a Hybrid Solar-Wind System

    Science.gov (United States)

    Nair, Arjun; Murali, Kartik; Anbuudayasankar, S. P.; Arjunan, C. V.

    2017-05-01

    In this paper, a net present value (NPV) approach for a solar hybrid system has been presented. The system, in question aims at supporting an investor by assessing an investment in solar-wind hybrid system in a given area. The approach follow a combined process of modelling the system, with optimization of major investment-related variables to maximize the financial yield of the investment. The consideration of solar wind hybrid supply presents significant potential for cost reduction. The investment variables concern the location of solar wind plant, and its sizing. The system demand driven, meaning that its primary aim is to fully satisfy the energy demand of the customers. Therefore, the model is a practical tool in the hands of investor to assess and optimize in financial terms an investment aiming at covering real energy demand. Optimization is performed by taking various technical, logical constraints. The relation between the maximum power obtained between individual system and the hybrid system as a whole in par with the net present value of the system has been highlighted.

  18. Dynamics of Intense Currents in the Solar Wind

    Science.gov (United States)

    Artemyev, Anton V.; Angelopoulos, Vassilis; Halekas, Jasper S.; Vinogradov, Alexander A.; Vasko, Ivan Y.; Zelenyi, Lev M.

    2018-06-01

    Transient currents in the solar wind are carried by various magnetic field discontinuities that contribute significantly to the magnetic field fluctuation spectrum. Internal instabilities and dynamics of these discontinuities are believed to be responsible for magnetic field energy dissipation and corresponding charged particle acceleration and heating. Accurate modeling of these phenomena requires detailed investigation of transient current formation and evolution. By examining such evolution using a unique data set compiled from observations of the same solar wind flow by two spacecraft at Earth’s and Mars’s orbits, we show that it consists of several processes: discontinuity thinning (decrease in thickness normalized by the ion inertial length), intensification of currents normalized to the proton thermal current (i.e., the product of proton charge, density, and thermal velocity), and increase in the compressional component of magnetic field variations across discontinuities. The significant proton temperature variation around most observed discontinuities indicates possible proton heating. Plasma velocity jumps across the discontinuities are well correlated with Alfvén velocity changes. We discuss possible explanations of the observed discontinuity evolution. We also compare the observed evolution with predictions of models describing discontinuity formation due to Alfvén wave steepening. Our results show that discontinuity modeling likely requires taking into account both the effects of nonlinear Alfvén wave dynamics and solar wind expansion.

  19. Solar Wind 0.1-1 keV Electrons in the Corotating Interaction Regions

    Science.gov (United States)

    Wang, L.; Tao, J.; Li, G.; Wimmer-Schweingruber, R. F.; Jian, L. K.; He, J.; Tu, C.; Tian, H.; Bale, S. D.

    2017-12-01

    Here we present a statistical study of the 0.1-1 keV suprathermal electrons in the undisturbed and compressed slow/fast solar wind, for the 71 corotating interaction regions (CIRs) with good measurements from the WIND 3DP and MFI instruments from 1995 to 1997. For each of these CIRs, we separate the strahl and halo electrons based on their different behaviors in pitch angle distributions in the undisturbed and compressed solar wind. We fit both the strahl and halo energy spectra to a kappa function with an index κ index and effective temperature Teff, and calculate the pitch-angle width at half-maximum (PAHM) of the strahl population. We also integrate the electron measurements between 0.1 and 1.0 keV to obtain the number density n and average energy Eavg for the strahl and halo populations. We find that for both the strahl and halo populations within and around these CIRs, the fitted κ index strongly correlates with Teff, similar to the quiet-time solar wind (Tao et al., ApJ, 2016). The number density of both the strahl and halo shows a strong positive correlation with the electron core temperature. The strahl number density ns is correlated with the magnitude of interplanetary magnetic field, and the strahl PAHM width is anti-correlated with the solar wind speed. These results suggest that the origin of strahl electrons from the solar corona is likely related to the electron core temperature and magnetic field strength, while the production of halo electrons in the interplanetary medium could depend on the solar wind velocity.

  20. Interaction of suprathermal solar wind electron fluxes with sheared whistler waves: fan instability

    Directory of Open Access Journals (Sweden)

    C. Krafft

    Full Text Available Several in situ measurements performed in the solar wind evidenced that solar type III radio bursts were some-times associated with locally excited Langmuir waves, high-energy electron fluxes and low-frequency electrostatic and electromagnetic waves; moreover, in some cases, the simultaneous identification of energetic electron fluxes, Langmuir and whistler waves was performed. This paper shows how whistlers can be excited in the disturbed solar wind through the so-called "fan instability" by interacting with energetic electrons at the anomalous Doppler resonance. This instability process, which is driven by the anisotropy in the energetic electron velocity distribution along the ambient magnetic field, does not require any positive slope in the suprathermal electron tail and thus can account for physical situations where plateaued reduced electron velocity distributions were observed in solar wind plasmas in association with Langmuir and whistler waves. Owing to linear calculations of growth rates, we show that for disturbed solar wind conditions (that is, when suprathermal particle fluxes propagate along the ambient magnetic field, the fan instability can excite VLF waves (whistlers and lower hybrid waves with characteristics close to those observed in space experiments.

    Key words. Space plasma physics (waves and instabilities – Radio Science (waves in plasma – Solar physics, astrophysics and astronomy (radio emissions

  1. Interaction of suprathermal solar wind electron fluxes with sheared whistler waves: fan instability

    Directory of Open Access Journals (Sweden)

    C. Krafft

    2003-07-01

    Full Text Available Several in situ measurements performed in the solar wind evidenced that solar type III radio bursts were some-times associated with locally excited Langmuir waves, high-energy electron fluxes and low-frequency electrostatic and electromagnetic waves; moreover, in some cases, the simultaneous identification of energetic electron fluxes, Langmuir and whistler waves was performed. This paper shows how whistlers can be excited in the disturbed solar wind through the so-called "fan instability" by interacting with energetic electrons at the anomalous Doppler resonance. This instability process, which is driven by the anisotropy in the energetic electron velocity distribution along the ambient magnetic field, does not require any positive slope in the suprathermal electron tail and thus can account for physical situations where plateaued reduced electron velocity distributions were observed in solar wind plasmas in association with Langmuir and whistler waves. Owing to linear calculations of growth rates, we show that for disturbed solar wind conditions (that is, when suprathermal particle fluxes propagate along the ambient magnetic field, the fan instability can excite VLF waves (whistlers and lower hybrid waves with characteristics close to those observed in space experiments.Key words. Space plasma physics (waves and instabilities – Radio Science (waves in plasma – Solar physics, astrophysics and astronomy (radio emissions

  2. Wind and solar energy resources on the 'Roof of the World'

    Science.gov (United States)

    Zandler, Harald; Morche, Thomas; Samimi, Cyrus

    2015-04-01

    The Eastern Pamirs of Tajikistan, often referred to as 'Roof of the World', are an arid high mountain plateau characterized by severe energy poverty that may have great potential for renewable energy resources due to the prevailing natural conditions. The lack of energetic infrastructure makes the region a prime target for decentralized integration of wind and solar power. However, up to date no scientific attempt to assess the regional potential of these resources has been carried out. In this context, it is particularly important to evaluate if wind and solar energy are able to provide enough power to generate thermal energy, as other thermal energy carriers are scarce or unavailable and the existing alternative, local harvest of dwarf shrubs, is unsustainable due to the slow regeneration in this environment. Therefore, this study examines the feasibility of using wind and solar energy as thermal energy sources. Financial frame conditions were set on a maximum amount of five million Euros. This sum provides a realistic scenario as it is based on the current budget of the KfW development bank to finance the modernization of the local hydropower plant in the regions only city, Murghab, with about 1500 households. The basis for resource assessment is data of four climate stations, erected for this purpose in 2012, where wind speed, wind direction, global radiation and temperature are measured at a half hourly interval. These measurements confirm the expectation of a large photovoltaic potential and high panel efficiency with up to 84 percent of extraterrestrial radiation reaching the surface and only 16 hours of temperatures above 25°C were measured in two years at the village stations on average. As these observations are only point measurements, radiation data and the ASTER GDEM was used to train a GIS based solar radiation model to spatially extrapolate incoming radiation. With mean validation errors ranging from 5% in July (minimum) to 15% in December (maximum

  3. Classification of solar wind with machine learning

    NARCIS (Netherlands)

    E. Camporeale (Enrico); A. Carè (Algo); J.E. Borovsky (Joseph)

    2017-01-01

    htmlabstractWe present a four-category classification algorithm for the solar wind, based on Gaussian Process. The four categories are the ones previously adopted in Xu and Borovsky (2015): ejecta, coronal hole origin plasma, streamer belt origin plasma, and sector reversal origin plasma. The

  4. Structure and sources of solar wind in the growing phase of 24th solar cycle

    Science.gov (United States)

    Slemzin, Vladimir; Goryaev, Farid; Shugay, Julia; Rodkin, Denis; Veselovsky, Igor

    2015-04-01

    We present analysis of the solar wind (SW) structure and its association with coronal sources during the minimum and rising phase of 24th solar cycle (2009-2011). The coronal sources prominent in this period - coronal holes, small areas of open magnetic fields near active regions and transient sources associated with small-scale solar activity have been investigated using EUV solar images and soft X-ray fluxes obtained by the CORONAS-Photon/TESIS/Sphinx, PROBA2/SWAP, Hinode/EIS and AIA/SDO instruments as well as the magnetograms obtained by HMI/SDO. It was found that at solar minimum (2009) velocity and magnetic field strength of high speed wind (HSW) and transient SW from small-scale flares did not differ significantly from those of the background slow speed wind (SSW). The major difference between parameters of different SW components was seen in the ion composition represented by the C6/C5, O7/O6, Fe/O ratios and the mean charge of Fe ions. With growing solar activity, the speed of HSW increased due to transformation of its sources - small-size low-latitude coronal holes into equatorial extensions of large polar holes. At that period, the ion composition of transient SW changed from low-temperature to high-temperature values, which was caused by variation of the source conditions and change of the recombination/ionization rates during passage of the plasma flow through the low corona. However, we conclude that criteria of separation of the SW components based on the ion ratios established earlier by Zhao&Fisk (2009) for higher solar activity are not applicable to the extremely weak beginning of 24th cycle. The research leading to these results has received funding from the European Commission's Seventh Framework Programme (FP7/2007-2013) under the grant agreement eHeroes (project n° 284461, www.eheroes.eu).

  5. Three-dimensional kinetic simulations of whistler turbulence in solar wind on parallel supercomputers

    Science.gov (United States)

    Chang, Ouliang

    The objective of this dissertation is to study the physics of whistler turbulence evolution and its role in energy transport and dissipation in the solar wind plasmas through computational and theoretical investigations. This dissertation presents the first fully three-dimensional (3D) particle-in-cell (PIC) simulations of whistler turbulence forward cascade in a homogeneous, collisionless plasma with a uniform background magnetic field B o, and the first 3D PIC simulation of whistler turbulence with both forward and inverse cascades. Such computationally demanding research is made possible through the use of massively parallel, high performance electromagnetic PIC simulations on state-of-the-art supercomputers. Simulations are carried out to study characteristic properties of whistler turbulence under variable solar wind fluctuation amplitude (epsilon e) and electron beta (betae), relative contributions to energy dissipation and electron heating in whistler turbulence from the quasilinear scenario and the intermittency scenario, and whistler turbulence preferential cascading direction and wavevector anisotropy. The 3D simulations of whistler turbulence exhibit a forward cascade of fluctuations into broadband, anisotropic, turbulent spectrum at shorter wavelengths with wavevectors preferentially quasi-perpendicular to B o. The overall electron heating yields T ∥ > T⊥ for all epsilone and betae values, indicating the primary linear wave-particle interaction is Landau damping. But linear wave-particle interactions play a minor role in shaping the wavevector spectrum, whereas nonlinear wave-wave interactions are overall stronger and faster processes, and ultimately determine the wavevector anisotropy. Simulated magnetic energy spectra as function of wavenumber show a spectral break to steeper slopes, which scales as k⊥lambda e ≃ 1 independent of betae values, where lambdae is electron inertial length, qualitatively similar to solar wind observations. Specific

  6. Anomalous particle diffusion and Levy random walk of magnetic field lines in three dimensional solar wind turbulence

    International Nuclear Information System (INIS)

    Zimbardo, G.

    2005-01-01

    Plasma transport in the presence of turbulence depends on a variety of parameters like the fluctuation level ? B/B0, the ratio between the particle Larmor radius and the turbulence correlation lengths, and the turbulence anisotropy. In this presentation, we review the results of numerical simulations of plasma and magnetic field line transport in the case of anisotropic magnetic turbulence, for parameter values close to those of the solar wind. We assume a uniform background magnetic field B0 = B0ez and a Fourier representation for magnetic fluctuations, with wavectors forming any angle with respect to B0. The energy density spectrum is a power law, and in k space the constant amplitude surfaces are ellipsoids, described by the correlation lengths lx, ly, lz, which quantify the anisotropy of turbulence. For magnetic field lines, we find that transport perpendicular to the background field depends on the Kubo number R = ? B B0 lz lx . For small Kubo numbers, R ? 1, we find anomalous, non Gaussian transport regimes (both sub and superdiffusive) which can be described as a Levy random walk. Increasing the Kubo number, i.e., the fluctuation level ? B/B0 and/or the ratio lz/lx, we find first a quasilinear and then a percolative regime, both corresponding to Gaussian diffusion. For particles, we find that transport parallel and perpendicular to the background magnetic field heavily depends on the turbulence anisotropy and on the particle Larmor radius. For turbulence levels typical of the solar wind, ? B/B0 ? 0.5 ?1, when the ratio between the particle Larmor radius and the turbulence correlation lengths is small, anomalous regimes are found in the case lz/lx ? 1, with Levy random walk (superdiffusion) along the magnetic field and subdiffusion in the perpendicular directions. Conversely, for lz/lx > 1 normal, Gaussian diffusion is found. Increasing the ratio between the particle Larmor radius and the turbulence correlation lengths, the parallel superdiffusion is

  7. Autocorrelation Study of Solar Wind Plasma and IMF Properties as Measured by the MAVEN Spacecraft

    Science.gov (United States)

    Marquette, Melissa L.; Lillis, Robert J.; Halekas, J. S.; Luhmann, J. G.; Gruesbeck, J. R.; Espley, J. R.

    2018-04-01

    It has long been a goal of the heliophysics community to understand solar wind variability at heliocentric distances other than 1 AU, especially at ˜1.5 AU due to not only the steepening of solar wind stream interactions outside 1 AU but also the number of missions available there to measure it. In this study, we use 35 months of solar wind and interplanetary magnetic field (IMF) data taken at Mars by the Mars Atmosphere and Volatile EvolutioN (MAVEN) spacecraft to conduct an autocorrelation analysis of the solar wind speed, density, and dynamic pressure, which is derived from the speed and density, as well as the IMF strength and orientation. We found that the solar wind speed is coherent, that is, has an autocorrelation coefficient above 1/e, over roughly 56 hr, while the density and pressure are coherent over smaller intervals of roughly 25 and 20 hr, respectively, and that the IMF strength is coherent over time intervals of approximately 20 hr, while the cone and clock angles are considerably less steady but still somewhat coherent up to time lags of roughly 16 hr. We also found that when the speed, density, pressure, or IMF strength is higher than average, the solar wind or IMF becomes uncorrelated more quickly, while when they are below average, it tends to be steadier. This analysis allows us to make estimates of the values of solar wind plasma and IMF parameters when they are not directly measured and provide an approximation of the error associated with that estimate.

  8. Power generation from wind turbines in a solar chimney

    Energy Technology Data Exchange (ETDEWEB)

    Foote, Tudor [Graduate Student, Department of Mechanical Engineering and Materials Science, Washington University in St. Louis, Jolley Hall, Campus Box 1185, One Brookings Drive, St. Louis, Missouri, 63130 (United States); Agarwal, Ramesh K. [William Palm Professor, Department of Mechanical Engineering and Materials Science, Washington University in St. Louis, Jolley Hall, Campus Box 1185, One Brookings Drive, St. Louis, Missouri, 63130 (United States)

    2013-07-01

    Recent studies have shown that shrouded wind turbines can generate greater power compared to bare turbines. A solar chimney generates an upward draft of wind inside a tower and a shroud around the wind turbine. There are numerous empty silos on farms in the U.S. that can be converted to solar chimneys with minor modifications at modest cost. The objective of this study is to determine the potential of these silos/chimneys for generating wind power. The study is conducted through analytical/computational approach by employing the commercial Computational Fluid Dynamics (CFD) software. Computations are performed for five different geometric configurations consisting of a turbine, a cylindrical silo, and/or a venturi and/or a diffuser using the dimensions of typical silos and assuming Class 3 wind velocity. The incompressible Navier-Stokes equations with the Boussinesq approximation and a two equation realizable {kappa}-{epsilon} model are employed in the calculations, and the turbine is modeled as an actuator disk. The power coefficient (Cp) and generated power are calculated for the five cases. Consistent with recent literature, it was found that the silos with diffusers increase the Cp beyond Betz’s limit significantly and thus the generated power. It should be noted that Cp is calculated by normalizing it by the turbine area swept by the wind. This study shows the potential of using abandoned silos in the mid-west and other parts of the country for localized wind power generation.

  9. Cosmic ray nucleonic intensity in low-amplitude days during the passage of high-speed solar wind streams

    International Nuclear Information System (INIS)

    Agarwal, R.; Mishra, R.K.; Tiwari, S.; or rm_jbp@yahoo.co.in

    2008-01-01

    One of the most striking features of solar wind is its organization into high- and low- speed streams. It is now well established that the passage over the Earth of high-speed solar wind streams leads to geomagnetic disturbances. The high-speed plasma streams are thus a key element in the complex chain of events that link geomagnetic activity to the solar activity and are therefore of great interest to the solar terrestrial physics. Two types of high-speed solar wind streams - coronal-hole-associated (or corotating) and flare-generated - were studied based on magnetic field and solar wind plasma parameters. In the work, the dependence was obtained for cosmic ray (CR) depressions due to high-speed solar wind streams during low-amplitude days. The CR nucleonic intensity data were subjected to the superposed epoch analysis with respect to the start time of high-speed solar wind streams. It was found that streams of both types produce significant deviations in the CR intensity during low-amplitude anisotropic wave train events. At the onset of such streams the CR intensity reaches its minimum during low-amplitude events and then increases statistically. (Authors)

  10. Magnetic reconnection physics in the solar wind with Voyager 2

    Science.gov (United States)

    Stevens, Michael L.

    2009-08-01

    Magnetic reconnection is the process by which the magnetic topology evolves in collisionless plasmas. This phenomenon is fundamental to a broad range of astrophysical processes such as stellar flares, magnetospheric substorms, and plasma accretion, yet it is poorly understood and difficult to observe in situ . In this thesis, the solar wind plasma permeating interplanetary space is treated as a laboratory for reconnection physics. I present an exhaustive statistical approach to the identification of reconnection outflow jets in turbulent plasma and magnetic field time series data. This approach has been automated and characterized so that the resulting reconnection survey can be put in context with other related studies. The algorithm is shown to perform similarly to ad hoc studies in the inner heliosphere. Based on this technique, I present a survey of 138 outflow jets for the Voyager 2 spacecraft mission, including the most distant in situ evidence of reconnection discovered to date. Reconnection in the solar wind is shown to be strongly correlated with stream interactions and with solar activity. The solar wind magnetic field is found to be reconnecting via large, quasi-steady slow- mode magnetohydrodynamic structures as far out as the orbit of Neptune. The role of slow-mode shocks is explored and, in one instance, a well-developed reconnection structure is shown to be in good agreement with the Petschek theory for fast reconnection. This is the first reported example of a reconnection exhaust that satisfies the full jump conditions for a stationary slow-mode shock pair. A complete investigation into corotating stream interactions over the Voyager 2 mission has revealed that detectable reconnection structure occurs in about 23% of forced, global-scale current sheets. Contrary to previous studies, I find that signatures of this kind are most likely to be observed for current sheets where the magnetic field shear and the plasma-b are high. Evidence has been found

  11. An Investigation of the Sources of Earth-directed Solar Wind during Carrington Rotation 2053

    Science.gov (United States)

    Fazakerley, A. N.; Harra, L. K.; van Driel-Gesztelyi, L.

    2016-06-01

    In this work we analyze multiple sources of solar wind through a full Carrington Rotation (CR 2053) by analyzing the solar data through spectroscopic observations of the plasma upflow regions and the in situ data of the wind itself. Following earlier authors, we link solar and in situ observations by a combination of ballistic backmapping and potential-field source-surface modeling. We find three sources of fast solar wind that are low-latitude coronal holes. The coronal holes do not produce a steady fast wind, but rather a wind with rapid fluctuations. The coronal spectroscopic data from Hinode’s Extreme Ultraviolet Imaging Spectrometer show a mixture of upflow and downflow regions highlighting the complexity of the coronal hole, with the upflows being dominant. There is a mix of open and multi-scale closed magnetic fields in this region whose (interchange) reconnections are consistent with the up- and downflows they generate being viewed through an optically thin corona, and with the strahl directions and freeze-in temperatures found in in situ data. At the boundary of slow and fast wind streams there are three short periods of enhanced-velocity solar wind, which we term intermediate based on their in situ characteristics. These are related to active regions that are located beside coronal holes. The active regions have different magnetic configurations, from bipolar through tripolar to quadrupolar, and we discuss the mechanisms to produce this intermediate wind, and the important role that the open field of coronal holes adjacent to closed-field active regions plays in the process.

  12. AN INVESTIGATION OF THE SOURCES OF EARTH-DIRECTED SOLAR WIND DURING CARRINGTON ROTATION 2053

    Energy Technology Data Exchange (ETDEWEB)

    Fazakerley, A. N.; Harra, L. K.; Van Driel-Gesztelyi, L., E-mail: a.fazakerley@ucl.ac.uk [Mullard Space Science Laboratory, University College London (United Kingdom)

    2016-06-01

    In this work we analyze multiple sources of solar wind through a full Carrington Rotation (CR 2053) by analyzing the solar data through spectroscopic observations of the plasma upflow regions and the in situ data of the wind itself. Following earlier authors, we link solar and in situ observations by a combination of ballistic backmapping and potential-field source-surface modeling. We find three sources of fast solar wind that are low-latitude coronal holes. The coronal holes do not produce a steady fast wind, but rather a wind with rapid fluctuations. The coronal spectroscopic data from Hinode ’s Extreme Ultraviolet Imaging Spectrometer show a mixture of upflow and downflow regions highlighting the complexity of the coronal hole, with the upflows being dominant. There is a mix of open and multi-scale closed magnetic fields in this region whose (interchange) reconnections are consistent with the up- and downflows they generate being viewed through an optically thin corona, and with the strahl directions and freeze-in temperatures found in in situ data. At the boundary of slow and fast wind streams there are three short periods of enhanced-velocity solar wind, which we term intermediate based on their in situ characteristics. These are related to active regions that are located beside coronal holes. The active regions have different magnetic configurations, from bipolar through tripolar to quadrupolar, and we discuss the mechanisms to produce this intermediate wind, and the important role that the open field of coronal holes adjacent to closed-field active regions plays in the process.

  13. Solar wind charge exchange emission in the Chandra deep field north

    Energy Technology Data Exchange (ETDEWEB)

    Slavin, Jonathan D.; Wargelin, Bradford J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Koutroumpa, Dimitra [LATMOS/IPSL, CNRS, Université Versailles Saint Quentin, 11 Boulevard d' Alembert, F-78280, Guyancourt (France)

    2013-12-10

    The diffuse soft X-ray background comes from distant galaxies, from hot Galactic gas, and from within the solar system. The latter emission arises from charge exchange between highly charged solar wind ions and neutral gas. This so-called solar wind charge exchange (SWCX) emission is spatially and temporally variable and interferes with our measurements of more distant cosmic emission while also providing important information on the nature of the solar wind-interstellar medium interaction. We present the results of our analysis of eight Chandra observations of the Chandra Deep Field North (CDFN) with the goal of measuring the cosmic and SWCX contributions to the X-ray background. Our modeling of both geocoronal and heliospheric SWCX emission is the most detailed for any observation to date. After allowing for ∼30% uncertainty in the SWCX emission and subtracting it from the observational data, we estimate that the flux of cosmic background for the CDFN in the O VII Kα, Kβ, and O VIII Lyα lines totals 5.8 ± 1.1 photons s{sup –1} cm{sup –2} sr{sup –1} (or LU). Heliospheric SWCX emission varied for each observation due to differences in solar wind conditions and the line of sight through the solar system, but was typically about half as strong as the cosmic background (i.e., one-third of the total) in those lines. The modeled geocoronal emission was 0.82 LU in one observation but averaged only 0.15 LU in the others. Our measurement of the cosmic background is lower than but marginally consistent with previous estimates based on XMM-Newton data.

  14. Solar wind charge exchange emission in the Chandra deep field north

    International Nuclear Information System (INIS)

    Slavin, Jonathan D.; Wargelin, Bradford J.; Koutroumpa, Dimitra

    2013-01-01

    The diffuse soft X-ray background comes from distant galaxies, from hot Galactic gas, and from within the solar system. The latter emission arises from charge exchange between highly charged solar wind ions and neutral gas. This so-called solar wind charge exchange (SWCX) emission is spatially and temporally variable and interferes with our measurements of more distant cosmic emission while also providing important information on the nature of the solar wind-interstellar medium interaction. We present the results of our analysis of eight Chandra observations of the Chandra Deep Field North (CDFN) with the goal of measuring the cosmic and SWCX contributions to the X-ray background. Our modeling of both geocoronal and heliospheric SWCX emission is the most detailed for any observation to date. After allowing for ∼30% uncertainty in the SWCX emission and subtracting it from the observational data, we estimate that the flux of cosmic background for the CDFN in the O VII Kα, Kβ, and O VIII Lyα lines totals 5.8 ± 1.1 photons s –1 cm –2 sr –1 (or LU). Heliospheric SWCX emission varied for each observation due to differences in solar wind conditions and the line of sight through the solar system, but was typically about half as strong as the cosmic background (i.e., one-third of the total) in those lines. The modeled geocoronal emission was 0.82 LU in one observation but averaged only 0.15 LU in the others. Our measurement of the cosmic background is lower than but marginally consistent with previous estimates based on XMM-Newton data.

  15. Implementation Strategy for a Global Solar and Wind Atlas

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2012-01-15

    In July 2009, Major Economies Forum leaders met to prepare for the COP 15 Copenhagen Conference that took place later that year. At this occasion the Major Economies Forum Global Partnership f or low carbon and climate-friendly technology was founded and Technology Action Plans (TAPs) for ten key low-carbon technologies were drafted. At that juncture Denmark, Germany and Spain took on the responsibility for drafting TAPs for Solar and Wind Energy Technologies. The TAPs were then consolidated and presented at COP 15 that would later take place in December in Copenhagen. Since then, countries that led the development of the Action Plans have started their implementation. During a first Clean Energy Ministerial (CEM) in July 2010 in Washington on the invitation of Steven Chu, US Secretary of Energy, several initiatives were launched. Denmark, Germany and Spain took the lead in the implementation of the TAPs for Solar and Wind Technologies and initiated the Multilateral Working Group on Solar and Wind Energy Technologies (MWGSW). Several countries joined the working group in Washington and afterwards. In two international workshops in Bonn (June 2010) and Madrid (November 2010) and in meetings during the first CEM in Washington (July 2010) and the second CEM in Abu Dhabi (April 2011) the Multilateral Working Group made substantial progress in the two initial fields of action: (1) the Development of a Global Solar and Wind Atlas; and (2) the Development of a Long-term Strategy on Joint Capacity Building. Discussion papers on the respective topics were elaborated involving the Working Group's member countries as well as various international institutions. This led to concrete proposals for several pilot activities in both fields of action. After further specifying key elements of the suggested projects in two expert workshops in spring 2011, the Multilateral Working Group convened for a third international workshop in Copenhagen, Denmark, to discuss the project

  16. Market to facilitate wind and solar energy integration in the bulk power supply

    Energy Technology Data Exchange (ETDEWEB)

    Milligan, Michael [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Soeder, Lennart [Royal Inst. of Tech., Stockholm (Sweden); Holttinen, Hannele [VTT Energy, Espoo (Finland); Clark, Charlton [U.S. Department of Energy Washington, DC (United States); Pineda, Ivan [European Wind Energy Association, Brussels (Belgium); Collaboration: IEA Task 25 collaboration

    2012-07-01

    Wind and solar power will give rise to challenges in electricity markets regarding flexibility, capacity adequacy, and the participation of wind and solar generators to markets. Large amounts of wind power will have impacts on bulk power system markets and electricity prices. If the markets respond to increased wind power by increasing investments in low-capital-cost/high-marginal-cost power, the average price may remain in the same range. However, the experiences so far from Denmark, Germany, Spain, and Ireland are that the average market prices decreased because of wind power. This reduction in price may result in additional revenue insufficiency, which may be corrected with a capacity market; however, capacity markets are difficult to design. Further, the flexibility attributes of the capacity need to be considered. Markets facilitating wind and solar integration will include possibilities for trading close to delivery (either by shorter gate closure times or intraday markets). Time steps chosen for markets can enable more flexibility to be assessed. Experience from 5- and 10-minute markets has been encouraging. (orig.)

  17. Solar wind and coronal structure near sunspot minimum: Pioneer and SMM observations from 1985-1987

    International Nuclear Information System (INIS)

    Mihalov, J.D.; Barnes, A.; Hundhausen, A.J.; Smith, E.J.

    1990-01-01

    The solar wind speeds observed in the outer heliosphere (20 to 40 AU heliocentric distance, approximately) by Pioneers 10 an 11, and at a heliocentric distance of 0.7 AU by the Pioneer Venus spacecraft, reveal a complex set of changes in the years near the recent sunspot minimum, 1985-1987. The pattern of recurrent solar wind streams, the long-term average speed, and the sector polarity of the interplanetary magnetic field all changed in a manner suggesting both a temporal variation, and a changing dependence on heliographic latitude. Coronal observations made from the Solar Maximum Mission spacecraft during the same epoch show a systematic variation in coronal structure and (by implication) the magnetic structure imposed on the expanding solar wind. These observations suggest interpretation of the solar wind speed variations in terms of the familiar model where the speed increases with distance from a nearly flat interplanetary current sheet (or with heliomagnetic latitude), and where this current sheet becomes aligned with the solar equatorial plane as sunspot minimum approaches, but deviates rapidly from that orientation after minimum. The authors confirm here that this basic organization of the solar wind speed persists in the outer heliosphere with an orientation of the neutral sheet consistent with that inferred at a heliocentric distance of a few solar radii, from the coronal observations

  18. ION HEATING IN INHOMOGENEOUS EXPANDING SOLAR WIND PLASMA: THE ROLE OF PARALLEL AND OBLIQUE ION-CYCLOTRON WAVES

    International Nuclear Information System (INIS)

    Ozak, N.; Ofman, L.; Viñas, A.-F.

    2015-01-01

    Remote sensing observations of coronal holes show that heavy ions are hotter than protons and their temperature is anisotropic. In-situ observations of fast solar wind streams provide direct evidence for turbulent Alfvén wave spectrum, left-hand polarized ion-cyclotron waves, and He ++ - proton drift in the solar wind plasma, which can produce temperature anisotropies by resonant absorption and perpendicular heating of the ions. Furthermore, the solar wind is expected to be inhomogeneous on decreasing scales approaching the Sun. We study the heating of solar wind ions in inhomogeneous plasma with a 2.5D hybrid code. We include the expansion of the solar wind in an inhomogeneous plasma background, combined with the effects of a turbulent wave spectrum of Alfvénic fluctuations and initial ion-proton drifts. We study the influence of these effects on the perpendicular ion heating and cooling and on the spectrum of the magnetic fluctuations in the inhomogeneous background wind. We find that inhomogeneities in the plasma lead to enhanced heating compared to the homogenous solar wind, and the generation of significant power of oblique waves in the solar wind plasma. The cooling effect due to the expansion is not significant for super-Alfvénic drifts, and is diminished further when we include an inhomogeneous background density. We reproduce the ion temperature anisotropy seen in observations and previous models, which is present regardless of the perpendicular cooling due to solar wind expansion. We conclude that small scale inhomogeneities in the inner heliosphere can significantly affect resonant wave ion heating

  19. Data of evolutionary structure change: 1B04B-3BAAA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1B04B-3BAAA 1B04 3BAA B A MDRQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDR...NLKTIRSLPLRLKEPVSLEARGEAFMPKASFLRLNEERKAR--ELFANPRNAAAGSLRQLDPKVAASRQLDLFVYGLADAEALGIASHSEALDYLQALGFKVNPERRR...DGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTV... 353 TYR CA 427 3BAA A 3BAAA...hain>A 3BAAA EREENGQDIFAN

  20. Observations of magnetic pumping in the solar wind using MMS data

    Science.gov (United States)

    Lichko, Emily; Egedal, Jan; Daughton, William; Kasper, Justin

    2017-10-01

    The turbulent cascade is believed to play an important role in the energization of the solar wind plasma. However, there are characteristics of the solar wind that are not readily explained by the cascade, such as the power-law distribution of the solar wind speed. Starting from the drift kinetic equation, we have derived a magnetic pumping model, similar to the magnetic pumping well-known in fusion research, that provides an explanation for these features. In this model, particles are heated by the largest scale turbulent fluctuations, providing a complementary heating mechanism to the turbulent cascade. We will present observations of this mechanism in the bow shock region using data from the Magnetospheric MultiScale mission. This research was conducted with support from National Defense Science and Engineering Graduate (NDSEG) Fellowship, 32 CFR 168, as well as from NSF Award 1404166 and NASA award NNX15AJ73G.

  1. Solar Wind Energy Input during Prolonged, Intense Northward Interplanetary Magnetic Fields: A New Coupling Function

    Science.gov (United States)

    Du, A. M.; Tsurutani, B. T.; Sun, W.

    2012-04-01

    Sudden energy release (ER) events in the midnight sector at auroral zone latitudes during intense (B > 10 nT), long-duration (T > 3 hr), northward (Bz > 0 nT = N) IMF magnetic clouds (MCs) during solar cycle 23 (SC23) have been examined in detail. The MCs with northward-then-southward (NS) IMFs were analyzed separately from MCs with southward-then-northward (SN) configurations. It is found that there is a lack of substorms during the N field intervals of NS clouds. In sharp contrast, ER events do occur during the N field portions of SN MCs. From the above two results it is reasonable to conclude that the latter ER events represent residual energy remaining from the preceding S portions of the SN MCs. We derive a new solar wind-magnetosphere coupling function during northward IMFs: ENIMF = α N-1/12V 7/3B1/2 + β V |Dstmin|. The first term on the right-hand side of the equation represents the energy input via "viscous interaction", and the second term indicates the residual energy stored in the magnetotail. It is empirically found that the magnetosphere/magnetotail can store energy for a maximum of ~ 4 hrs before it has dissipated away. This concept is defining one for ER/substorm energy storage. Our scenario indicates that the rate of solar wind energy injection into the magnetosphere/magnetotail determines the form of energy release into the magnetosphere/ionosphere. This may be more important than the dissipation mechanism itself (in understanding the form of the release). The concept of short-term energy storage is applied for the solar case. It is argued that it may be necessary to identify the rate of energy input into solar magnetic loop systems to be able to predict the occurrence of solar flares.

  2. Solar wind acceleration in a prescribed flow geometry

    International Nuclear Information System (INIS)

    Biernat, H.; Koemle, N.; Lichtenegger, H.

    1985-01-01

    It is known that the flow tubes above coronal holes diverge stronger than radial and that the magnetic field lines may be considerably curved near the border of the holes. The authors investigate the consequences of such a magnetic field geometry on the flow of the solar wind plasma in the vicinity of the Sun. For this purpose the one-dimensional conservation equations are solved along prescribed flow tubes. A temperature profile based on observational data (EUV rocket-observations) is used in the calculations. In an alternative approach the temperature is determined by a polytropic index, which is assumed to be variable. The authors study how both curvature and non-radial divergence of the flow tubes modify the velocity, the density, and the energy balance of the solar wind plasma. (Auth.)

  3. Latitude dependence of the solar wind speed: Influence of the coronal magnetic field geometry

    International Nuclear Information System (INIS)

    Pneuman, G.W.

    1976-01-01

    The dependence of solar wind speed on latitude as influenced by the magnetic field configuration of the inner corona is studied. It is found that in general, a dipolelike field geometry characteristic of a minimum-type corona tends to produce a solar wind speed distribution which increases with heliographic latitude, in accordance with observations. At very high coronal base densities and temperatures, however, this effect is minimal or even inverted. Physically, the field affects the wind speed through its area divergence, a larger divergence resulting in correspondingly lower speeds. During solar minimum, eclipse photographs suggest that the field divergence increases from pole to equator, a characteristic not apparent during solar maximum. Hence we expect the latitudinal increase in speed to be most pronounced at the minimum phase of solar activity

  4. Development of Chemical and Mechanical Cleaning Procedures for Genesis Solar Wind Samples

    Science.gov (United States)

    Schmeling, M.; Jurewicz, A. J. G.; Gonzalez, C.; Allums, K. K.; Allton, J. H.

    2018-01-01

    The Genesis mission was the only mission returning pristine solar material to Earth since the Apollo program. Unfortunately, the return of the spacecraft on September 8, 2004 resulted in a crash landing shattering the solar wind collectors into smaller fragments and exposing them to desert soil and other debris. Thorough surface cleaning is required for almost all fragments to allow for subsequent analysis of solar wind material embedded within. However, each collector fragment calls for an individual cleaning approach, as contamination not only varies by collector material but also by sample itself.

  5. Resistive instabilities of current sheets in the solar wind

    Energy Technology Data Exchange (ETDEWEB)

    Dobrowolny, M [CNR, Laboratorio per il Plasma nello Spazio, Frascati, Italy; Trussoni, E [CNR, Laboratorio di Cosmo-Geofisica, Turin, Italy

    1979-03-01

    Resistive magnetohydrodynamic instabilities are investigated numerically for non-antisymmetric magnetic field profiles similar to those indicated in spacecraft data on solar wind discontinuities. The eigenvalue problem derived for the growth rate of possible instabilities from dimensionless equations for velocity and magnetic field perturbations is solved starting from the outer regions where the plasma is frozen to the magnetic field. For an antisymmetric magnetic profile, calculations show only tearing modes to be present, with instabilities occurring only at long wavelengths, while for a non-antisymmetric magnetic profile resembling the observed solar wind, calculations indicate the presence of rippling modes driven by resistivity gradients, in addition to the tearing modes. Calculations of the scale lengths of variation of the reversing component based on a scaling law relating the maximum growth rate to the magnetic Reynolds number are found to agree with observed solar current sheet scale lengths.

  6. Substorm Occurrence and Intensity Associated With Three Types of Solar Wind Structure

    Science.gov (United States)

    Liou, Kan; Sotirelis, Thomas; Richardson, Ian

    2018-01-01

    This paper presents the results of a study of the characteristics of substorms that occurred during three distinct types of solar wind: coronal mass ejection (CME) associated, high-speed streams (HSS), and slow solar wind (SSW). A total number of 53,468 geomagnetic substorm onsets from 1983 to 2009 is used and sorted by the three solar wind types. It is found that the probability density function (PDF) of the intersubstorm time can be fitted by the combination of a dominant power law with an exponential cutoff component and a minor lognormal component, implying that substorms are associated with two distinctly different dynamical processes corresponding, perhaps, to the "externally driven" and "internally driven" processes, respectively. We compare substorm frequency and intensity associated with the three types of solar wind. It is found that the intersubstorm time is the longest during SSW and shortest during CME intervals. The averaged intersubstorm time for the internally driven substorms is 3.13, 3.15, and 7.96 h for CME, HSS, and SSW, respectively. The substorm intensity PDFs, as represented by the peak value of |SML| (the generalization of AL), can be fitted by two lognormal distribution functions. The averaged substorm intensity for either component is largest for CME (292 and 674 nT) and smallest for SSW (265 and 434 nT). We argue that the externally driven substorms are more intense than those driven internally. We conclude that the dynamical process of substorms is controlled mainly by the direct solar wind-magnetosphere coupling, whereas the internally driven process only plays a very modest minor role.

  7. Solar wind drivers of geomagnetic storms during more than four solar cycles

    Directory of Open Access Journals (Sweden)

    Richardson Ian G.

    2012-05-01

    Full Text Available Using a classification of the near-Earth solar wind into three basic flow types: (1 High-speed streams associated with coronal holes at the Sun; (2 Slow, interstream solar wind; and (3 Transient flows originating with coronal mass ejections (CMEs at the Sun, including interplanetary CMEs and the associated upstream shocks and post-shock regions, we determine the drivers of geomagnetic storms of various size ranges based on the Kp index and the NOAA “G” criteria since 1964, close to the beginning of the space era, to 2011, encompassing more than four solar cycles (20–23. We also briefly discuss the occurrence of storms since the beginning of the Kp index in 1932, in the minimum before cycle 17. We note that the extended low level of storm activity during the minimum following cycle 23 is without precedent in this 80-year interval. Furthermore, the “typical” numbers of storm days/cycle quoted in the standard NOAA G storm table appear to be significantly higher than those obtained from our analysis, except for the strongest (G5 storms, suggesting that they should be revised downward.

  8. On the relation between ionospheric winter anomalies and solar wind

    International Nuclear Information System (INIS)

    Rumi, G.C.

    2001-01-01

    There are two different winter anomalies. A small one that appears in connection with ionization at relatively low latitudes in the bottom of the D-region of the ionosphere. There, the electron densities in the winter happen to be less than should be expected. On the other hand, the classic winter anomaly is present when in the winter the upper D-region, again at relatively low latitudes, has more ionization than should be expected. Both these effects are due to the slant compression of the geomagnetic field produced by the solar wind in the wind in the winter season (which is, of course, the summer season when reference is made to events in the other hemisphere). It is shown that the small winter anomaly is a consequence of a hemispheric imbalance in the flux of galactic cosmic rays determined by the obliquely distorted geomagnetic field. It is shown that the standard winter anomaly can be ascribed to the influx of a super solar wind, which penetrates into the Earth's polar atmosphere down to E-region, heights and, duly concentrated through a funneling action at the winter pole of the distorted geomagnetic field, slows down the winter polar vortex. An equatorward motion of the polar air with its content of nitric oxide brings about the excess of ionization in the upper D-region at lower latitudes. The experimentally observed rhythmic recurrence of the upper winter anomaly is correlated to a possible rhythmic recurrence of the super solar wind. The actual detection of the upper winter anomaly could yield some information on the velocity of the basic solar wind. A by-product of the present analysis, the determination of Γ, the coefficient of collisional detachment of the electrons from the O 2 - ions, is presented in the Appendix

  9. On the relation between ionospheric winter anomalies and solar wind

    Energy Technology Data Exchange (ETDEWEB)

    Rumi, G.C. [Lecco, (Italy)

    2001-06-01

    There are two different winter anomalies. A small one that appears in connection with ionization at relatively low latitudes in the bottom of the D-region of the ionosphere. There, the electron densities in the winter happen to be less than should be expected. On the other hand, the classic winter anomaly is present when in the winter the upper D-region, again at relatively low latitudes, has more ionization than should be expected. Both these effects are due to the slant compression of the geomagnetic field produced by the solar wind in the wind in the winter season (which is, of course, the summer season when reference is made to events in the other hemisphere). It is shown that the small winter anomaly is a consequence of a hemispheric imbalance in the flux of galactic cosmic rays determined by the obliquely distorted geomagnetic field. It is shown that the standard winter anomaly can be ascribed to the influx of a super solar wind, which penetrates into the Earth's polar atmosphere down to E-region, heights and, duly concentrated through a funneling action at the winter pole of the distorted geomagnetic field, slows down the winter polar vortex. An equatorward motion of the polar air with its content of nitric oxide brings about the excess of ionization in the upper D-region at lower latitudes. The experimentally observed rhythmic recurrence of the upper winter anomaly is correlated to a possible rhythmic recurrence of the super solar wind. The actual detection of the upper winter anomaly could yield some information on the velocity of the basic solar wind. A by-product of the present analysis, the determination of {gamma}, the coefficient of collisional detachment of the electrons from the O{sub 2} {sup -} ions, is presented in the Appendix.

  10. Western Wind and Solar Integration Study: Hydropower Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Acker, T.; Pete, C.

    2012-03-01

    The U.S. Department of Energy's (DOE) study of 20% Wind Energy by 2030 was conducted to consider the benefits, challenges, and costs associated with sourcing 20% of U.S. energy consumption from wind power by 2030. This study found that with proactive measures, no insurmountable barriers were identified to meet the 20% goal. Following this study, DOE and the National Renewable Energy Laboratory (NREL) conducted two more studies: the Eastern Wind Integration and Transmission Study (EWITS) covering the eastern portion of the U.S., and the Western Wind and Solar Integration Study (WWSIS) covering the western portion of the United States. The WWSIS was conducted by NREL and research partner General Electric (GE) in order to provide insight into the costs, technical or physical barriers, and operational impacts caused by the variability and uncertainty of wind, photovoltaic, and concentrated solar power when employed to serve up to 35% of the load energy in the WestConnect region (Arizona, Colorado, Nevada, New Mexico, and Wyoming). WestConnect is composed of several utility companies working collaboratively to assess stakeholder and market needs to and develop cost-effective improvements to the western wholesale electricity market. Participants include the Arizona Public Service, El Paso Electric Company, NV Energy, Public Service of New Mexico, Salt River Project, Tri-State Generation and Transmission Cooperative, Tucson Electric Power, Xcel Energy and the Western Area Power Administration.

  11. Solar wind stream interfaces

    International Nuclear Information System (INIS)

    Gosling, J.T.; Asbridge, J.R.; Bame, S.J.; Feldman, W.C.

    1978-01-01

    Measurements aboard Imp 6, 7, and 8 reveal that approximately one third of all high-speed solar wind streams observed at 1 AU contain a sharp boundary (of thickness less than approx.4 x 10 4 km) near their leading edge, called a stream interface, which separates plasma of distinctly different properties and origins. Identified as discontinuities across which the density drops abruptly, the proton temperature increases abruptly, and the speed rises, stream interfaces are remarkably similar in character from one stream to the next. A superposed epoch analysis of plasma data has been performed for 23 discontinuous stream interfaces observed during the interval March 1971 through August 1974. Among the results of this analysis are the following: (1) a stream interface separates what was originally thick (i.e., dense) slow gas from what was originally thin (i.e., rare) fast gas; (2) the interface is the site of a discontinuous shear in the solar wind flow in a frame of reference corotating with the sun; (3) stream interfaces occur at speeds less than 450 km s - 1 and close to or at the maximum of the pressure ridge at the leading edges of high-speed streams; (4) a discontinuous rise by approx.40% in electron temperature occurs at the interface; and (5) discontinuous changes (usually rises) in alpha particle abundance and flow speed relative to the protons occur at the interface. Stream interfaces do not generally recur on successive solar rotations, even though the streams in which they are embedded often do. At distances beyond several astronomical units, stream interfaces should be bounded by forward-reverse shock pairs; three of four reverse shocks observed at 1 AU during 1971--1974 were preceded within approx.1 day by stream interfaces. Our observations suggest that many streams close to the sun are bounded on all sides by large radial velocity shears separating rapidly expanding plasma from more slowly expanding plasma

  12. The climate and air-quality benefits of wind and solar power in the United States

    Science.gov (United States)

    Millstein, Dev; Wiser, Ryan; Bolinger, Mark; Barbose, Galen

    2017-09-01

    Wind and solar energy reduce combustion-based electricity generation and provide air-quality and greenhouse gas emission benefits. These benefits vary dramatically by region and over time. From 2007 to 2015, solar and wind power deployment increased rapidly while regulatory changes and fossil fuel price changes led to steep cuts in overall power-sector emissions. Here we evaluate how wind and solar climate and air-quality benefits evolved during this time period. We find cumulative wind and solar air-quality benefits of 2015 US$29.7-112.8 billion mostly from 3,000 to 12,700 avoided premature mortalities, and cumulative climate benefits of 2015 US$5.3-106.8 billion. The ranges span results across a suite of air-quality and health impact models and social cost of carbon estimates. We find that binding cap-and-trade pollutant markets may reduce these cumulative benefits by up to 16%. In 2015, based on central estimates, combined marginal benefits equal 7.3 ¢ kWh-1 (wind) and 4.0 ¢ kWh-1 (solar).

  13. A Monte Carlo model for the exposure history of lunar dust grains in the ancient solar wind

    International Nuclear Information System (INIS)

    Borg, J.; Comstock, G.M.; Langevin, Y.; Maurette, M.; Jouffrey, B.; Jouret, C.

    1976-01-01

    The theoretical motion of the individual dust grains in the lunar regolith is analyzed by using a Monte Carlo statistical code where the variables are the mass and speed distribution of meteorites at the lunar surface and the geometrical shape of impact craters. From these computations the detailed irradiation history of the grains in the ancient solar wind is traced back, over a period of 4 billion years, as a function of the grain-size. Then by combining this irradiation scheme with the results of solar wind simulation experiments, the time and depth dependent accumulation of solar wind effects in the theoretical grains (solar wind maturation) is inferred. Finally, the validity of these predictions is tentatively checked by discussing a variety of physical and chemical solar wind effects which are registered in the surface layers of lunar dust grains. Therefore these studies give a tentative scenario for the 'maturation' of the lunar regolith with respect to solar wind effects, but they also reveal useful guidelines to deduce meaningful information from such effects. In particular, they suggest a 'lunar skin' sampling technique for extracting dust grains in lunar core tubes which could help in deciphering the past activity of the ancient solar wind over a time scale of several billion years. (Auth.)

  14. Efficient Scavenging of Solar and Wind Energies in a Smart City.

    Science.gov (United States)

    Wang, Shuhua; Wang, Xue; Wang, Zhong Lin; Yang, Ya

    2016-06-28

    To realize the sustainable energy supply in a smart city, it is essential to maximize energy scavenging from the city environments for achieving the self-powered functions of some intelligent devices and sensors. Although the solar energy can be well harvested by using existing technologies, the large amounts of wasted wind energy in the city cannot be effectively utilized since conventional wind turbine generators can only be installed in remote areas due to their large volumes and safety issues. Here, we rationally design a hybridized nanogenerator, including a solar cell (SC) and a triboelectric nanogenerator (TENG), that can individually/simultaneously scavenge solar and wind energies, which can be extensively installed on the roofs of the city buildings. Under the same device area of about 120 mm × 22 mm, the SC can deliver a largest output power of about 8 mW, while the output power of the TENG can be up to 26 mW. Impedance matching between the SC and TENG has been achieved by using a transformer to decrease the impedance of the TENG. The hybridized nanogenerator has a larger output current and a better charging performance than that of the individual SC or TENG. This research presents a feasible approach to maximize solar and wind energies scavenging from the city environments with the aim to realize some self-powered functions in smart city.

  15. Dawn-dusk asymmetry in particles of solar wind origin within the magnetosphere

    Directory of Open Access Journals (Sweden)

    T. J. Stubbs

    2001-01-01

    Full Text Available Solar wind/magnetosheath plasma in the magnetosphere can be identified using a component that has a higher charge state, lower density and, at least soon after their entry into the magnetosphere, lower energy than plasma from a terrestrial source. We survey here observations taken over 3 years of He2+ ions made by the Magnetospheric Ion Composition Sensor (MICS of the Charge and Mass Magnetospheric Ion Composition Experiment (CAMMICE instrument aboard POLAR. The occurrence probability of these solar wind ions is then plotted as a function of Magnetic Local Time (MLT and invariant latitude (7 for various energy ranges. For all energies observed by MICS (1.8–21.4 keV and all solar wind conditions, the occurrence probabilities peaked around the cusp region and along the dawn flank. The solar wind conditions were filtered to see if this dawnward asymmetry is controlled by the Svalgaard-Mansurov effect (and so depends on the BY component of the interplanetary magnetic field, IMF or by Fermi acceleration of He2+ at the bow shock (and so depends on the IMF ratio BX /BY . It is shown that the asymmetry remained persistently on the dawn flank, suggesting it was not due to effects associated with direct entry into the magnetosphere. This asymmetry, with enhanced fluxes on the dawn flank, persisted for lower energy ions (below a "cross-over" energy of about 23 keV but reversed sense to give higher fluxes on the dusk flank at higher energies. This can be explained by the competing effects of gradient/curvature drifts and the convection electric field on ions that are convecting sunward on re-closed field lines. The lower-energy He2+ ions E × B drift dawnwards as they move earthward, whereas the higher energy ions curvature/ gradient drift towards dusk. The convection electric field in the tail is weaker for northward IMF. Ions then need less energy to drift to the dusk flank, so that the cross-over energy, at which the asymmetry changes sense, is reduced

  16. On ion-cyclotron-resonance heating of the corona and solar wind

    Directory of Open Access Journals (Sweden)

    E. Marsch

    2003-01-01

    Full Text Available This paper concisely summarizes and critically reviews recent work by the authors on models of the heating of the solar corona by resonance of ions with high-frequency waves (up to the proton cyclotron frequency. The quasi-linear theory of pitch angle diffusion is presented in connection with relevant solar wind proton observations. Hybrid fluid-kinetic model equations, which include wave-particle interactions and collisions, are derived. Numerical solutions are discussed, representative of the inner corona and near-Sun solar wind. A semi-kinetic model for reduced velocity distributions is presented, yielding kinetic results for heavy ions in the solar corona. It is concluded that a self-consistent treatment of particle distributions and wave spectra is required, in order to adequately describe coronal physics and to obtain agreement with observations.

  17. Intercalibration and Cross-Correlation of Ace and Wind Solar Wind Data

    Science.gov (United States)

    2003-01-01

    This report covers activities funded from October 1, 1998 through September 30, 2002. Two yearly status reports have been filed on this grant, and they are included as Appendix 1. The purpose of this grant was to compare ACE and Wind solar wind parameters when the two spacecraft were near to one another and then to use the intercalibrated parameters to carry out scientific investigations. In September, 2001 a request for a one-year, no-cost extension until September 30, 2002 was submitted and approved. The statement of work for that extension included adjustment of ACE densities below wind speeds of 350 km/s, a study of shock normal orientations using travel time delays between the two spacecraft, comparison of density jumps at shocks, and a study of temperature anisotropies and double streaming to see if such features evolved between the spacecraft.

  18. Solar wind and coronal structure near sunspot minimum - Pioneer and SMM observations from 1985-1987

    Science.gov (United States)

    Mihalov, J. D.; Barnes, A.; Hundhausen, A. J.; Smith, E. J.

    1990-01-01

    Changes in solar wind speed and magnetic polarity observed at the Pioneer spacecraft are discussed here in terms of the changing magnetic geometry implied by SMM coronagraph observations over the period 1985-1987. The pattern of recurrent solar wind streams, the long-term average speed, and the sector polarity of the interplanetary magnetic field all changed in a manner suggesting both a temporal variation, and a changing dependence on heliographic latitude. Coronal observations during this epoch show a systematic variation in coronal structure and the magnetic structure imposed on the expanding solar wind. These observations suggest interpretation of the solar wind speed variations in terms of the familiar model where the speed increases with distance from a nearly flat interplanetary current sheet, and where this current sheet becomes aligned with the solar equatorial plane as sunspot minimum approaches, but deviates rapidly from that orientation after minimum.

  19. Morphology of Pseudostreamers and Solar Wind Properties

    Science.gov (United States)

    Panasenco, Olga; Velli, Marco

    2016-05-01

    The solar dynamo and photospheric convection lead to three main types of structures extending from the solar surface into the corona - active regions, solar filaments (prominences when observed at the limb) and coronal holes. These structures exist over a wide range of scales, and are interlinked with each other in evolution and dynamics. Active regions can form clusters of magnetic activity and the strongest overlie sunspots. In the decay of active regions, the boundaries separating opposite magnetic polarities (neutral lines) develop the specific structures called filament channels above which filaments form. In the presence of flux imbalance decaying active regions can also give birth to lower latitude coronal holes. The accumulation of magnetic flux at coronal hole boundaries also creates the conditions for filament formation: polar crown filaments are permanently present at the boundaries of the polar coronal holes. Middle-latitude and equatorial coronal holes - the result of active region evolution - can create pseudostreamers (PSs) if other coronal holes of the same polarity are present. While helmet streamers form between open fields of opposite polarities, the pseudostreamer, characterized by a smaller coronal imprint, typically shows a more prominent straight ray or stalk extending from the corona. The pseudostreamer base at photospheric heights is multipolar; often one observes tripolar magnetic configurations with two neutral lines - where filaments can form - separating the coronal holes. Here we discuss the specific role of filament channels on pseudostreamer topology and on solar wind properties. 1D numerical analysis of PSs shows that the properties of the solar wind from around PSs depend on the presence/absence of filament channels, number of channels and chirality at the PS base low in the corona.

  20. Solar Wind Monitor--A School Geophysics Project

    Science.gov (United States)

    Robinson, Ian

    2018-01-01

    Described is an established geophysics project to construct a solar wind monitor based on a nT resolution fluxgate magnetometer. Low-cost and appropriate from school to university level it incorporates elements of astrophysics, geophysics, electronics, programming, computer networking and signal processing. The system monitors the earth's field in…

  1. Performance Analysis for One-Step-Ahead Forecasting of Hybrid Solar and Wind Energy on Short Time Scales

    Directory of Open Access Journals (Sweden)

    Jing Huang

    2018-05-01

    Full Text Available With ever increasing demand for electricity and the huge potential of renewable energy, an increasing number of renewable-energy sources are being used to generate electricity. However, due to the intermittency of renewable-energy generation, many researchers try to overcome the variable nature of renewable energy. A hybrid renewable-energy system is one possible way to introduce smoothing of the supply. Many hybrid renewable-energy studies focus on system optimization and management. This paper mainly researches the performance prediction accuracy of a hybrid solar and wind system. Through a mixed autoregressive and dynamical system model, we test the predictability of the hybrid system and compare it with individual solar and wind series forecasting. After error analysis, the predictability of the hybrid system shows a better performance than solar or wind for Adelaide global solar radiation and Starfish Hill wind farm data. The prediction errors were reduced by 13% to more than 30% according to various error analyses. This result indicates an advantage of the hybrid solar and wind system compared to solar and wind systems taken individually.

  2. High-latitude Conic Current Sheets in the Solar Wind

    Energy Technology Data Exchange (ETDEWEB)

    Khabarova, Olga V.; Obridko, Vladimir N.; Kharshiladze, Alexander F. [Pushkov Institute of Terrestrial Magnetism, Ionosphere and Radio Wave Propagation of the Russian Academy of Sciences (IZMIRAN), Moscow (Russian Federation); Malova, Helmi V. [Scobeltsyn Nuclear Physics Institute of Lomonosov Moscow State University, Moscow (Russian Federation); Kislov, Roman A.; Zelenyi, Lev M. [Space Research Centre of the Polish Academy of Sciences (CBK PAN), Warsaw (Poland); Tokumaru, Munetoshi; Fujiki, Ken’ichi [Institute for Space-Earth Environmental Research, Nagoya University (Japan); Sokół, Justyna M.; Grzedzielski, Stan [Space Research Centre of the Polish Academy of Sciences (CBK), Warsaw (Poland)

    2017-02-10

    We provide observational evidence for the existence of large-scale cylindrical (or conic-like) current sheets (CCSs) at high heliolatitudes. Long-lived CCSs were detected by Ulysses during its passages over the South Solar Pole in 1994 and 2007. The characteristic scale of these tornado-like structures is several times less than a typical width of coronal holes within which the CCSs are observed. CCS crossings are characterized by a dramatic decrease in the solar wind speed and plasma beta typical for predicted profiles of CCSs. Ulysses crossed the same CCS at different heliolatitudes at 2–3 au several times in 1994, as the CCS was declined from the rotation axis and corotated with the Sun. In 2007, a CCS was detected directly over the South Pole, and its structure was strongly highlighted by the interaction with comet McNaught. Restorations of solar coronal magnetic field lines reveal the occurrence of conic-like magnetic separators over the solar poles in both 1994 and 2007. Such separators exist only during solar minima. Interplanetary scintillation data analysis confirms the presence of long-lived low-speed regions surrounded by the typical polar high-speed solar wind in solar minima. Energetic particle flux enhancements up to several MeV/ nuc are observed at edges of the CCSs. We built simple MHD models of a CCS to illustrate its key features. The CCSs may be formed as a result of nonaxiality of the solar rotation axis and magnetic axis, as predicted by the Fisk–Parker hybrid heliospheric magnetic field model in the modification of Burger and coworkers.

  3. EVIDENCE FOR NEWLY INITIATED RECONNECTION IN THE SOLAR WIND AT 1 AU

    International Nuclear Information System (INIS)

    Xu, Xiaojun; Ma, Yonghui; Wong, Hon-Cheng; Wang, Yi; Zuo, Pingbing; Wei, Fengsi; Feng, Xueshang; Zhou, Meng; Deng, Xiaohua

    2015-01-01

    We report the first evidence for a large-scale reconnection exhaust newly initiated in the solar wind using observations from three spacecraft: ACE, Wind, and ARTEMIS P2. We identified a well-structured X-line exhaust using measurements from ARTEMIS P2 in the downstream solar wind. However, in the upstream solar wind, ACE detected the same current sheet that corresponds to the exhaust identified by ARTEMIS P2 data without showing any reconnection signals. We cannot find any reconnection signals from Wind located between ACE and ARTEMIS P2. Within the exhaust, a magnetic island is identified, which is not consistent with the quasi-steady feature as previously reported and provides further evidence that the reconnection is newly initiated. Our observations show that the entering of energetic particles, probably from Earth's bow shock, makes the crucial difference between the non-reconnecting current sheet and the exhaust. Since no obvious driving factors are responsible for the reconnection initiation, we infer that these energetic particles probably play an important role in the reconnection initiation. Theoretical analysis also shows support for this potential mechanism

  4. Pioneer and Voyager observations of the solar wind at large heliocentric distances and latitudes

    Science.gov (United States)

    Gazis, P. R.; Mihalov, J. D.; Barnes, A.; Lazarus, A. J.; Smith, E. J.

    1989-01-01

    Data obtained from the electrostatic analyzers aboard the Pioneer 10 and 11 spacecraft and from the Faraday cup aboard Voyager 2 were used to study spatial gradients in the distant solar wind. Prior to mid-1985, both spacecraft observed nearly identical solar wind structures. After day 150 of 1985, the velocity structure at Voyager 2 became flatter, and the Voyager 2 velocities were smaller than those observed by Pioneer 11. It is suggested that these changes in the solar wind at low latitudes may be related to a change which occurred in the coronal hole structure in early 1985.

  5. The solar wind in the third dimension

    International Nuclear Information System (INIS)

    Neugebauer, M.

    1996-01-01

    For many years, solar-wind physicists have been using plasma and field data acquired near the ecliptic plane together with data on the scintillation of radio sources and remote sensing of structures in the solar corona to estimate the properties of the high-latitude solar wind. Because of the highly successful Ulysses mission, the moment of truth is now here. This paper summarizes the principal agreements and differences between the Ulysses observations and expectations. The speed of the high-latitude solar wind was even greater than anticipated. The strength of the radial component of the interplanetary magnetic field was found to be independent of latitude. The tilt of the heliospheric current sheet caused reverse corotating shocks to be observed to higher latitudes than forward corotating shocks. The energetic particles accelerated in these shocks were detected well poleward of the latitudes at which Ulysses observed the interaction regions themselves. As anticipated, there was a strong flux of outward propagating Alfven waves throughout the polar flow. Those waves were probably largely responsible for the smaller-than-anticipated increase of galactic cosmic rays with increasing latitude. As expected, the charge state or ionization temperature of heavy ions was lower in the polar flow than in low-latitude interstream flows. What was not anticipated was the correlation of elemental abundances with ionization temperatures; the Ulysses data revealed a connection between the first ionization time in the upper chromosphere and the final ionization state in the corona. As expected, transient events were detected to ∼60 deg. latitude, but the properties of those high latitude transient flows held some surprises. At high latitudes, the speeds of the transient interplanetary plasma clouds were approximately the same as the speed of the ambient plasma and the expansion of the clouds drove forward and reverse shock pairs that had never been seen at low latitudes. At high

  6. TURBULENCE IN THE SUB-ALFVENIC SOLAR WIND DRIVEN BY REFLECTION OF LOW-FREQUENCY ALFVEN WAVES

    International Nuclear Information System (INIS)

    Verdini, A.; Velli, M.; Buchlin, E.

    2009-01-01

    We study the formation and evolution of a turbulent spectrum of Alfven waves driven by reflection off the solar wind density gradients, starting from the coronal base up to 17 solar radii, well beyond the Alfvenic critical point. The background solar wind is assigned and two-dimensional shell models are used to describe nonlinear interactions. We find that the turbulent spectra are influenced by the nature of the reflected waves. Close to the base, these give rise to a flatter and steeper spectrum for the outgoing and reflected waves, respectively. At higher heliocentric distance both spectra evolve toward an asymptotic Kolmogorov spectrum. The turbulent dissipation is found to account for at least half of the heating required to sustain the background imposed solar wind and its shape is found to be determined by the reflection-determined turbulent heating below 1.5 solar radii. Therefore, reflection and reflection-driven turbulence are shown to play a key role in the acceleration of the fast solar wind and origin of the turbulent spectrum found at 0.3 AU in the heliosphere.

  7. 26 CFR 31.3306(b)-1T - Question and answer relating to the definition of wages in section 3306(b) (Temporary).

    Science.gov (United States)

    2010-04-01

    ... employee is excluded from the definition of “wages” if at the time such benefit is provided it is... 26 Internal Revenue 15 2010-04-01 2010-04-01 false Question and answer relating to the definition... (Chapter 23, Internal Revenue Code of 1954) § 31.3306(b)-1T Question and answer relating to the definition...

  8. Solar wind stream evolution at large heliocentric distances - Experimental demonstration and the test of a model

    Science.gov (United States)

    Gosling, J. T.; Hundhausen, A. J.; Bame, S. J.

    1976-01-01

    A stream propagation model which neglects all dissipation effects except those occurring at shock interfaces, was used to compare Pioneer-10 solar wind speed observations, during the time when Pioneer 10, the earth, and the sun were coaligned, with near-earth Imp-7 observations of the solar wind structure, and with the theoretical predictions of the solar wind structure at Pioneer 10 derived from the Imp-7 measurements, using the model. The comparison provides a graphic illustration of the phenomenon of stream steepening in the solar wind with the attendant formation of forward-reverse shock pairs and the gradual decay of stream amplitudes with increasing heliocentric distance. The comparison also provides a qualitative test of the stream propagation model.

  9. Quiet-time Suprathermal (~0.1-1.5 keV) Electrons in the Solar Wind

    Science.gov (United States)

    Tao, Jiawei; Wang, Linghua; Zong, Qiugang; Li, Gang; Salem, Chadi S.; Wimmer-Schweingruber, Robert F.; He, Jiansen; Tu, Chuanyi; Bale, Stuart D.

    2016-03-01

    We present a statistical survey of the energy spectrum of solar wind suprathermal (˜0.1-1.5 keV) electrons measured by the WIND 3DP instrument at 1 AU during quiet times at the minimum and maximum of solar cycles 23 and 24. After separating (beaming) strahl electrons from (isotropic) halo electrons according to their different behaviors in the angular distribution, we fit the observed energy spectrum of both strahl and halo electrons at ˜0.1-1.5 keV to a Kappa distribution function with an index κ and effective temperature Teff. We also calculate the number density n and average energy Eavg of strahl and halo electrons by integrating the electron measurements between ˜0.1 and 1.5 keV. We find a strong positive correlation between κ and Teff for both strahl and halo electrons, and a strong positive correlation between the strahl n and halo n, likely reflecting the nature of the generation of these suprathermal electrons. In both solar cycles, κ is larger at solar minimum than at solar maximum for both strahl and halo electrons. The halo κ is generally smaller than the strahl κ (except during the solar minimum of cycle 23). The strahl n is larger at solar maximum, but the halo n shows no difference between solar minimum and maximum. Both the strahl n and halo n have no clear association with the solar wind core population, but the density ratio between the strahl and halo roughly anti-correlates (correlates) with the solar wind density (velocity).

  10. Periodic Density Structures and the Origin of the Slow Solar Wind

    Science.gov (United States)

    Viall-Kepko, Nicholeen M.; Vourlidas, Angelos

    2015-01-01

    The source of the slow solar wind has challenged scientists for years. Periodic density structures (PDSs), observed regularly in the solar wind at 1 AU (Astronomical Unit), can be used to address this challenge. These structures have length scales of hundreds to several thousands of megameters and frequencies of tens to hundreds of minutes. Two lines of evidence indicate that PDSs are formed in the solar corona as part of the slow solar wind release and/or acceleration processes. The first is corresponding changes in compositional data in situ, and the second is PDSs observed in the inner Heliospheric Imaging data on board the Solar Terrestrial Relations Observatory (STEREO)/Sun Earth Connection Coronal and Heliospheric Investigation (SECCHI) suite. The periodic nature of these density structures is both a useful identifier as well as an important physical constraint on their origin. In this paper, we present the results of tracking periodic structures identified in the inner Heliospheric Imager in SECCHI back in time through the corresponding outer coronagraph (COR2) images. We demonstrate that the PDSs are formed around or below 2.5 solar radii-the inner edge of the COR2 field of view. We compute the occurrence rates of PDSs in 10 days of COR2 images both as a function of their periodicity and location in the solar corona, and we find that this set of PDSs occurs preferentially with a periodicity of approximately 90 minutes and occurs near streamers. Lastly, we show that their acceleration and expansion through COR2 is self-similar, thus their frequency is constant at distances beyond 2.5 solar radii.

  11. The economics of wind and solar variability. How the variability of wind and solar power affects their marginal value, optimal deployment, and integration costs

    Energy Technology Data Exchange (ETDEWEB)

    Hirth, Lion

    2014-11-14

    Variable renewable energy sources (VRE) for electricity generation, such as wind and solar power, are subject to inherent output fluctuations. This variability has significant impacts on power system and electricity markets if VRE are deployed at large scale. While on global average, wind and solar power currently supply only a minor share of electricity, they are expected to play a much larger role in the future - such that variability will become a major issue (which it already is in some regions). This thesis contributes to the literature that assesses these impacts the ''system and market integration'' literature. This thesis aims at answering the question: What is the impact of wind and solar power variability on the economics of these technologies? It will be laid out that the impact can be expressed in (at least) three ways: as reduction of value, as increase of cost, or as decrease of optimal deployment. Translating between these perspectives is not trivial, as evidenced by the confusion around the concept of ''integration costs''. Hence, more specifically: How does variability impact the marginal economic value of these power sources, their optimal deployment, and their integration costs? This is the question that this thesis addresses. This study comprises six papers, of which two develop a valuation framework that accounts for the specific characteristics of the good electricity, and the specific properties of wind and solar power versus ''dispatchable'' power plants. Three articles then assess quantitative questions and estimate marginal value, optimal deployment, and integration costs. These estimates stem from a newly developed numerical power market model, EMMA, market data, and quantitative literature reviews. The final paper addresses market design. In short, the principal findings of this thesis are as follows. Electricity is a peculiar economic good, being at the same time perfectly

  12. The economics of wind and solar variability. How the variability of wind and solar power affects their marginal value, optimal deployment, and integration costs

    International Nuclear Information System (INIS)

    Hirth, Lion

    2014-01-01

    Variable renewable energy sources (VRE) for electricity generation, such as wind and solar power, are subject to inherent output fluctuations. This variability has significant impacts on power system and electricity markets if VRE are deployed at large scale. While on global average, wind and solar power currently supply only a minor share of electricity, they are expected to play a much larger role in the future - such that variability will become a major issue (which it already is in some regions). This thesis contributes to the literature that assesses these impacts the ''system and market integration'' literature. This thesis aims at answering the question: What is the impact of wind and solar power variability on the economics of these technologies? It will be laid out that the impact can be expressed in (at least) three ways: as reduction of value, as increase of cost, or as decrease of optimal deployment. Translating between these perspectives is not trivial, as evidenced by the confusion around the concept of ''integration costs''. Hence, more specifically: How does variability impact the marginal economic value of these power sources, their optimal deployment, and their integration costs? This is the question that this thesis addresses. This study comprises six papers, of which two develop a valuation framework that accounts for the specific characteristics of the good electricity, and the specific properties of wind and solar power versus ''dispatchable'' power plants. Three articles then assess quantitative questions and estimate marginal value, optimal deployment, and integration costs. These estimates stem from a newly developed numerical power market model, EMMA, market data, and quantitative literature reviews. The final paper addresses market design. In short, the principal findings of this thesis are as follows. Electricity is a peculiar economic good, being at the same time perfectly

  13. A Systematic Search for Solar Wind Charge Exchange Emission from the Earth's Exosphere with Suzaku

    Science.gov (United States)

    Ishi, D.; Ishikawa, K.; Ezoe, Y.; Ohashi, T.; Miyoshi, Y.; Terada, N.

    2017-10-01

    We report on a systematic search of all the Suzaku archival data covering from 2005 August to 2015 May for geocoronal Solar Wind Charge eXchange (SWCX). In the vicinity of Earth, solar wind ions strip an electron from Earth's exospheric neutrals, emitting X-ray photons (e.g., Snowden et al. 1997). The X-ray flux of this geocoronal SWCX can change depending on solar wind condition and line of sight direction. Although it is an immediate background for all the X-ray astronomy observations, the X-ray flux prediction and the dependence on the observational conditions are not clear. Using the X-ray Imaging Spectrometer onboard Suzaku which has one of the highest sensitivities to the geocoronal SWCX, we searched the data for time variation of soft X-ray background. We then checked the solar wind proton flux taken with the WIND satellite and compared it with X-ray light curve. We also analyzed X-ray spectra and fitted them with a charge exchange emission line model constructed by Bodewits et al. (2007). Among 3055 data sets, 90 data showed SWCX features. The event rate seems to correlate with solar activity, while the distribution of SWCX events plotted in the solar magnetic coordinate system was relatively uniform.

  14. Developing a hybrid solar/wind powered irrigation system for crops in the Great Plains

    Science.gov (United States)

    Some small scale irrigation systems (powered by wind or solar do not require subsidies, but this paper discusses ways to achieve an economical renewable energy powered center pivot irrigation system for crops in the Great Plains. By adding a solar-photovoltaic (PV) array together with a wind...

  15. Wind Tunnel Tests of Parabolic Trough Solar Collectors: March 2001--August 2003

    Energy Technology Data Exchange (ETDEWEB)

    Hosoya, N.; Peterka, J. A.; Gee, R. C.; Kearney, D.

    2008-05-01

    Conducted extensive wind-tunnel tests on parabolic trough solar collectors to determine practical wind loads applicable to structural design for stress and deformation, and local component design for concentrator reflectors.

  16. Modeling energy production of solar thermal systems and wind turbines for installation at corn ethanol plants

    Science.gov (United States)

    Ehrke, Elizabeth

    Nearly every aspect of human existence relies on energy in some way. Most of this energy is currently derived from fossil fuel resources. Increasing energy demands coupled with environmental and national security concerns have facilitated the move towards renewable energy sources. Biofuels like corn ethanol are one of the ways the U.S. has significantly reduced petroleum consumption. However, the large energy requirement of corn ethanol limits the net benefit of the fuel. Using renewable energy sources to produce ethanol can greatly improve its economic and environmental benefits. The main purpose of this study was to model the useful energy received from a solar thermal array and a wind turbine at various locations to determine the feasibility of applying these technologies at ethanol plants around the country. The model calculates thermal energy received from a solar collector array and electricity generated by a wind turbine utilizing various input data to characterize the equipment. Project cost and energy rate inputs are used to evaluate the profitability of the solar array or wind turbine. The current state of the wind and solar markets were examined to give an accurate representation of the economics of each industry. Eighteen ethanol plant locations were evaluated for the viability of a solar thermal array and/or wind turbine. All ethanol plant locations have long payback periods for solar thermal arrays, but high natural gas prices significantly reduce this timeframe. Government incentives will be necessary for the economic feasibility of solar thermal arrays. Wind turbines can be very profitable for ethanol plants in the Midwest due to large wind resources. The profitability of wind power is sensitive to regional energy prices. However, government incentives for wind power do not significantly change the economic feasibility of a wind turbine. This model can be used by current or future ethanol facilities to investigate or begin the planning process for a

  17. Opportunities for wind and solar to displace coal and associated health impacts in Texas

    Science.gov (United States)

    Cohan, D. S.; Strasert, B.; Slusarewicz, J.

    2017-12-01

    Texas uses more coal for power production than any other state, but also leads the nation in wind power while lagging in solar. Many analysts expect that more than half of coal power plants may close within the next decade, unable to compete with cheaper natural gas and renewable electricity. To what extent could displacing coal with wind and solar yield benefits for air quality, health, and climate? Here, we present modeling of the ozone, particulate matter, and associated health impacts of each of 15 coal power plants in Texas, using the CAMx model for air quality and BenMAP for health effects. We show that health impacts from unscrubbed coal plants near urban areas can be an order of magnitude larger than some other facilities. We then analyze the temporal patterns of generation that could be obtained from solar and wind farms in various regions of Texas that could displace these coal plants. We find that winds along the southern Gulf coast of Texas exhibit strikingly different temporal patterns than in west Texas, peaking on summer afternoons rather than winter nights. Thus, wind farms from the two regions along with solar farms could provide complementary sources of power to displace coal. We quantify several metrics to characterize the extent to which wind and solar farms in different regions provide complementary sources of power that can reliably displace traditional sources of electricity.

  18. Solar wind/local interstellar medium interaction including charge exchange with neural hydrogen

    Science.gov (United States)

    Pauls, H. Louis; Zank, Gary P.

    1995-01-01

    We present results from a hydrodynamic model of the interaction of the solar wind with the local interstellar medium (LISM), self-consistently taking into account the effects of charge exchange between the plasma component and the interstellar neutrals. The simulation is fully time dependent, and is carried out in two or three dimensions, depending on whether the helio-latitudinal dependence of the solar wind speed and number density (both giving rise to three dimensional effects) are included. As a first approximation it is assumed that the neutral component of the flow can be described by a single, isotropic fluid. Clearly, this is not the actual situation, since charge exchange with the supersonic solar wind plasma in the region of the nose results in a 'second' neutral fluid propagating in the opposite direction as that of the LISM neutrals.

  19. Solar Atmosphere to Earth's Surface: Long Lead Time dB/dt Predictions with the Space Weather Modeling Framework

    Science.gov (United States)

    Welling, D. T.; Manchester, W.; Savani, N.; Sokolov, I.; van der Holst, B.; Jin, M.; Toth, G.; Liemohn, M. W.; Gombosi, T. I.

    2017-12-01

    The future of space weather prediction depends on the community's ability to predict L1 values from observations of the solar atmosphere, which can yield hours of lead time. While both empirical and physics-based L1 forecast methods exist, it is not yet known if this nascent capability can translate to skilled dB/dt forecasts at the Earth's surface. This paper shows results for the first forecast-quality, solar-atmosphere-to-Earth's-surface dB/dt predictions. Two methods are used to predict solar wind and IMF conditions at L1 for several real-world coronal mass ejection events. The first method is an empirical and observationally based system to estimate the plasma characteristics. The magnetic field predictions are based on the Bz4Cast system which assumes that the CME has a cylindrical flux rope geometry locally around Earth's trajectory. The remaining plasma parameters of density, temperature and velocity are estimated from white-light coronagraphs via a variety of triangulation methods and forward based modelling. The second is a first-principles-based approach that combines the Eruptive Event Generator using Gibson-Low configuration (EEGGL) model with the Alfven Wave Solar Model (AWSoM). EEGGL specifies parameters for the Gibson-Low flux rope such that it erupts, driving a CME in the coronal model that reproduces coronagraph observations and propagates to 1AU. The resulting solar wind predictions are used to drive the operational Space Weather Modeling Framework (SWMF) for geospace. Following the configuration used by NOAA's Space Weather Prediction Center, this setup couples the BATS-R-US global magnetohydromagnetic model to the Rice Convection Model (RCM) ring current model and a height-integrated ionosphere electrodynamics model. The long lead time predictions of dB/dt are compared to model results that are driven by L1 solar wind observations. Both are compared to real-world observations from surface magnetometers at a variety of geomagnetic latitudes

  20. Statistics of counter-streaming solar wind suprathermal electrons at solar minimum: STEREO observations

    Directory of Open Access Journals (Sweden)

    B. Lavraud

    2010-01-01

    Full Text Available Previous work has shown that solar wind suprathermal electrons can display a number of features in terms of their anisotropy. Of importance is the occurrence of counter-streaming electron patterns, i.e., with "beams" both parallel and anti-parallel to the local magnetic field, which is believed to shed light on the heliospheric magnetic field topology. In the present study, we use STEREO data to obtain the statistical properties of counter-streaming suprathermal electrons (CSEs in the vicinity of corotating interaction regions (CIRs during the period March–December 2007. Because this period corresponds to a minimum of solar activity, the results are unrelated to the sampling of large-scale coronal mass ejections, which can lead to CSE owing to their closed magnetic field topology. The present study statistically confirms that CSEs are primarily the result of suprathermal electron leakage from the compressed CIR into the upstream regions with the combined occurrence of halo depletion at 90° pitch angle. The occurrence rate of CSE is found to be about 15–20% on average during the period analyzed (depending on the criteria used, but superposed epoch analysis demonstrates that CSEs are preferentially observed both before and after the passage of the stream interface (with peak occurrence rate >35% in the trailing high speed stream, as well as both inside and outside CIRs. The results quantitatively show that CSEs are common in the solar wind during solar minimum, but yet they suggest that such distributions would be much more common if pitch angle scattering were absent. We further argue that (1 the formation of shocks contributes to the occurrence of enhanced counter-streaming sunward-directed fluxes, but does not appear to be a necessary condition, and (2 that the presence of small-scale transients with closed-field topologies likely also contributes to the occurrence of counter-streaming patterns, but only in the slow solar wind prior to

  1. The distribution of waves in the inner magnetosphere as a function of solar wind parameters

    Science.gov (United States)

    Aryan, Homayon; Balikhin, Michael A.; Agapitov, Oleksiy; Krasnoselskikh, Vladimir; Yearby, Keith

    Energetic electrons within the Earth’s radiation belts represent a serious hazard to geostationary satellites. The interactions of electrons with chorus waves play an important role in both the acceleration and loss of radiation belt electrons. Studies of the evolution of energetic electron fluxes rely heavily on numerical codes in order to model energy and pitch angle diffusion due to electron interaction with plasma waves in the frame of quasilinear approximation. Application of these codes requires knowledge of statistical wave models to present wave distributions in the magnetosphere. A number of such models are based on CRESS, Cluster, THEMIS and other mission data. These models present wave distributions as a function of L-shell, magnetic local time, magnetic latitude and geomagnetic activity expressed by geomagnetic indices (Kp or Ae). However, it has been shown by G. Reeves and co-authors that only 50% of geomagnetic storms increase flux of relativistic electrons at GEO while 20% cause a decrease. This emphasizes the importance of including solar wind parameters in addition to geomagnetic indices. The present study examines almost four years (01, January, 2004 to 29, September, 2007) of STAFF (Spatio-Temporal Analysis of Field Fluctuation) data from Double Star TC1 combined with geomagnetic indices and solar wind parameters from OMNI database in order to present a comprehensive model of chorus wave intensities as a function of L-shell, magnetic local time, magnetic latitude, geomagnetic indices and solar wind parameters. The results show that chorus emission is not only sub-storm dependent but also dependent upon solar wind parameters with solar wind velocity evidently the most influential solar wind parameter. The largest peak intensities are observed for lower band chorus during active conditions, high solar wind velocity, low density and high pressure.

  2. An illustrative note on the system price effect of wind and solar power. The German case

    Energy Technology Data Exchange (ETDEWEB)

    Jaegemann, Cosima

    2014-07-15

    Exposing wind and solar power to the market price signal allows for cost-efficient investment decisions, as it incentivizes investors to account for the marginal value (MV{sup el}) of renewable energy technologies. As shown by Lamont (2008), the MV{sup el} of wind and solar power units depends on their penetration level. More specifically, the MV el of wind and solar power units is a function of the respective unit's capacity factor and the covariance between its generation profile and the system marginal costs. The latter component of the MV{sup el} (i.e., the covariance) is found to decline as the wind and solar power penetration increases, displacing dispatchable power plants with higher short-run marginal costs of power production and thus reducing the system marginal costs in all generation hours. This so called 'system price effect' is analyzed in more detail in this paper. The analysis complements the work Lamont (2008) in two regards. First of all, an alternative expression for the MV{sup el} of wind and solar power units is derived, which shows that the MV{sup el} of fluctuating renewable energy technologies depends not only on their own penetration level but also on a variety of other parameters that are specific to the electricity system. Second, based on historical wholesale prices and wind and solar power generation data for Germany, a numerical 'ceteris paribus' example for Germany is presented which illustrates that the system price effect is already highly relevant for both wind and solar power generation in Germany.

  3. An illustrative note on the system price effect of wind and solar power. The German case

    International Nuclear Information System (INIS)

    Jaegemann, Cosima

    2014-01-01

    Exposing wind and solar power to the market price signal allows for cost-efficient investment decisions, as it incentivizes investors to account for the marginal value (MV el ) of renewable energy technologies. As shown by Lamont (2008), the MV el of wind and solar power units depends on their penetration level. More specifically, the MV el of wind and solar power units is a function of the respective unit's capacity factor and the covariance between its generation profile and the system marginal costs. The latter component of the MV el (i.e., the covariance) is found to decline as the wind and solar power penetration increases, displacing dispatchable power plants with higher short-run marginal costs of power production and thus reducing the system marginal costs in all generation hours. This so called 'system price effect' is analyzed in more detail in this paper. The analysis complements the work Lamont (2008) in two regards. First of all, an alternative expression for the MV el of wind and solar power units is derived, which shows that the MV el of fluctuating renewable energy technologies depends not only on their own penetration level but also on a variety of other parameters that are specific to the electricity system. Second, based on historical wholesale prices and wind and solar power generation data for Germany, a numerical 'ceteris paribus' example for Germany is presented which illustrates that the system price effect is already highly relevant for both wind and solar power generation in Germany.

  4. EVOLUTION OF INTERMITTENCY IN THE SLOW AND FAST SOLAR WIND BEYOND THE ECLIPTIC PLANE

    International Nuclear Information System (INIS)

    Wawrzaszek, A.; Macek, W. M.; Echim, M.; Bruno, R.

    2015-01-01

    We study intermittency as a departure from self-similarity of the solar wind magnetic turbulence and investigate the evolution with the heliocentric distance and latitude. We use data from the Ulysses spacecraft measured during two solar minima (1997–1998 and 2007–2008) and one solar maximum (1999–2001). In particular, by modeling a multifractal spectrum, we revealed the intermittent character of turbulence in the small-scale fluctuations of the magnetic field embedded in the slow and fast solar wind. Generally, at small distances from the Sun, in both the slow and fast solar wind, we observe the high degree of multifractality (intermittency) that decreases somewhat slowly with distance and slowly with latitude. The obtained results seem to suggest that generally intermittency in the solar wind has a solar origin. However, the fast and slow streams, shocks, and other nonlinear interactions can only be considered as the drivers of the intermittent turbulence. It seems that analysis shows that turbulence beyond the ecliptic plane evolves too slowly to maintain the intermittency with the distance and latitude. Moreover, we confirm that the multifractality and intermittency are at a lower level than in the ecliptic, as well as the existence of symmetry with respect to the ecliptic plane, suggesting that there are similar turbulent properties observed in the two hemispheres

  5. EVOLUTION OF INTERMITTENCY IN THE SLOW AND FAST SOLAR WIND BEYOND THE ECLIPTIC PLANE

    Energy Technology Data Exchange (ETDEWEB)

    Wawrzaszek, A.; Macek, W. M. [Space Research Centre, Polish Academy of Sciences, Warsaw (Poland); Echim, M. [The Belgian Institute for Space Aeronomy, Brussels (Belgium); Bruno, R., E-mail: anna.wawrzaszek@cbk.waw.pl, E-mail: marius.echim@oma.be, E-mail: macek@cbk.waw.pl, E-mail: roberto.bruno@iaps.inaf.it [Institute for Space Astrophysics and Planetology, Roma (Italy)

    2015-12-01

    We study intermittency as a departure from self-similarity of the solar wind magnetic turbulence and investigate the evolution with the heliocentric distance and latitude. We use data from the Ulysses spacecraft measured during two solar minima (1997–1998 and 2007–2008) and one solar maximum (1999–2001). In particular, by modeling a multifractal spectrum, we revealed the intermittent character of turbulence in the small-scale fluctuations of the magnetic field embedded in the slow and fast solar wind. Generally, at small distances from the Sun, in both the slow and fast solar wind, we observe the high degree of multifractality (intermittency) that decreases somewhat slowly with distance and slowly with latitude. The obtained results seem to suggest that generally intermittency in the solar wind has a solar origin. However, the fast and slow streams, shocks, and other nonlinear interactions can only be considered as the drivers of the intermittent turbulence. It seems that analysis shows that turbulence beyond the ecliptic plane evolves too slowly to maintain the intermittency with the distance and latitude. Moreover, we confirm that the multifractality and intermittency are at a lower level than in the ecliptic, as well as the existence of symmetry with respect to the ecliptic plane, suggesting that there are similar turbulent properties observed in the two hemispheres.

  6. The "FIP Effect" and the Origins of Solar Energetic Particles and of the Solar Wind

    OpenAIRE

    Reames, Donald V.

    2018-01-01

    We find that the element abundances in solar energetic particles (SEPs) and in the slow solar wind (SSW), relative to those in the photosphere, show different patterns as a function of the first ionization potential (FIP) of the elements. Generally, the SEP and SSW abundances reflect abundance samples of the solar corona, where low-FIP elements, ionized in the chromosphere, are more efficiently conveyed upward to the corona than high-FIP elements that are initially neutral atoms. Abundances o...

  7. ON THE ORIGIN OF THE SLOW SPEED SOLAR WIND: HELIUM ABUNDANCE VARIATIONS

    Energy Technology Data Exchange (ETDEWEB)

    Rakowski, Cara E.; Laming, J. Martin [Space Science Division, Naval Research Laboratory Code 7674L, Washington, DC 20375 (United States)

    2012-07-20

    The first ionization potential (FIP) effect is the by now well-known enhancement in abundance over photospheric values of Fe and other elements with FIP below about 10 eV observed in the solar corona and slow speed solar wind. In our model, this fractionation is achieved by means of the ponderomotive force, arising as Alfven waves propagate through or reflect from steep density gradients in the solar chromosphere. This is also the region where low FIP elements are ionized, and high FIP elements are largely neutral leading to the fractionation as ions interact with the waves but neutrals do not. Helium, the element with the highest FIP and consequently the last to remain neutral as one moves upward, can be depleted in such models. Here, we investigate this depletion for varying loop lengths and magnetic field strengths. Variations in this depletion arise as the concentration of the ponderomotive force at the top of the chromosphere varies in response to Alfven wave frequency with respect to the resonant frequency of the overlying coronal loop, the magnetic field, and possibly also the loop length. We find that stronger depletions of He are obtained for weaker magnetic field, at frequencies close to or just above the loop resonance. These results may have relevance to observed variations of the slow wind solar He abundance with wind speed, with slower slow speed solar wind having a stronger depletion of He.

  8. Oblique proton fire hose instability in the expanding solar wind: Hybrid simulations

    Czech Academy of Sciences Publication Activity Database

    Hellinger, Petr; Trávníček, Pavel M.

    2008-01-01

    Roč. 113, A10 (2008), A10109/1-A10109/9 ISSN 0148-0227 R&D Projects: GA AV ČR IAA300420702; GA AV ČR IAA300420602 Institutional research plan: CEZ:AV0Z30420517; CEZ:AV0Z10030501 Keywords : kinetic instability * fire hose * solar wind * fire hose instabilities * linear analysis * nonlinear evolution * solar wind Subject RIV: BL - Plasma and Gas Discharge Physics Impact factor: 3.147, year: 2008

  9. COMPLEX MAPPING OF ENERGY RESOURCES FOR ALLOCATION OF SOLAR AND WIND ENERGY OBJECTS

    Directory of Open Access Journals (Sweden)

    B. A. Novakovskiy

    2016-01-01

    Full Text Available The paper presents developed methodology of solar and wind energy resources complex mapping at the regional level, taking into account the environmental and socio-economic factors affecting the placement of renewable energy facilities. Methodology provides a reasonable search and allocation of areas, the most promising for the placement of wind and solar power plants.

  10. MHD effects of the solar wind flow around planets

    Directory of Open Access Journals (Sweden)

    H. K. Biernat

    2000-01-01

    Full Text Available The study of the interaction of the solar wind with magnetized and unmagnetized planets forms a central topic of space research. Focussing on planetary magnetosheaths, we review some major developments in this field. Magnetosheath structures depend crucially on the orientation of the interplanetary magnetic field, the solar wind Alfvén Mach number, the shape of the obstacle (axisymmetric/non-axisymmetric, etc., the boundary conditions at the magnetopause (low/high magnetic shear, and the degree of thermal anisotropy of the plasma. We illustrate the cases of Earth, Jupiter and Venus. The terrestrial magnetosphere is axisymmetric and has been probed in-situ by many spacecraft. Jupiter's magnetosphere is highly non-axisymmetric. Furthermore, we study magnetohydrodynamic effects in the Venus magnetosheath.

  11. Application of dimensional analysis to the problem of solar wind-magnetosphere energy coupling

    International Nuclear Information System (INIS)

    Bargatze, L.F.; McPherron, R.L.; Baker, D.N.; Hones, E.W. Jr.

    1984-01-01

    The constraints imposed by dimensional analyses are used to find how the solar wind-magnetosphere energy transfer rate depends upon interplanetary parameters. The analyses reported here assume that only magnetohydrodynamic processes are important in controlling the rate of energy transfer. The study utilizes ISEE-3 solar wind observations, the AE index, and U/sub T/ from three 10-day intervals during the IMS: Simple linear regression and histogram techniques are used to find the value of the MHD coupling exponent, α, which is consistent with observations of magnetospheric response. Once α is estimated, the form of the solar wind energy transfer rate is obtained by substitution into an equation of the interplanetary variables whose exponents depend upon α. 7 references, 6 figures, 1 table

  12. Optimal Scheduling of Biogas-Solar-Wind Renewable Portfolio for Multi-Carrier Energy Supplies

    DEFF Research Database (Denmark)

    Zhou, Bin; Xu, Da; Li, Canbing

    2018-01-01

    the mitigation of renewable intermittency and the efficient utilization of batteries, and a multi-carrier generation scheduling scheme is further presented to dynamically optimize dispatch factors in the coupling matrix for energy-efficient con-version and storage, while different energy demands of end......This paper proposes a multi-source multi-product framework for coupled multi-carrier energy supplies with a biogas-solar-wind hybrid renewable system. In this framework, the biogas-solar-wind complementarities are fully exploited based on digesting thermodynamic effects for the synergetic...... interactions of electricity, gas and heating energy flows, and a coupling matrix is formulated for the modeling of production, conversion, storage, and consumption of different energy carriers. The multi-energy complementarity of biogas-solar-wind renewable portfolio can be utilized to facilitate...

  13. Applying Nyquist's method for stability determination to solar wind observations

    Science.gov (United States)

    Klein, Kristopher G.; Kasper, Justin C.; Korreck, K. E.; Stevens, Michael L.

    2017-10-01

    The role instabilities play in governing the evolution of solar and astrophysical plasmas is a matter of considerable scientific interest. The large number of sources of free energy accessible to such nearly collisionless plasmas makes general modeling of unstable behavior, accounting for the temperatures, densities, anisotropies, and relative drifts of a large number of populations, analytically difficult. We therefore seek a general method of stability determination that may be automated for future analysis of solar wind observations. This work describes an efficient application of the Nyquist instability method to the Vlasov dispersion relation appropriate for hot, collisionless, magnetized plasmas, including the solar wind. The algorithm recovers the familiar proton temperature anisotropy instabilities, as well as instabilities that had been previously identified using fits extracted from in situ observations in Gary et al. (2016). Future proposed applications of this method are discussed.

  14. The Radial Variation of the Solar Wind Temperature-Speed Relationship

    Science.gov (United States)

    Elliott, H. A.; McComas, D. J.

    2010-12-01

    Generally, the solar wind temperature (T) and speed (V) are well correlated except in Interplanetary Coronal Mass Ejections where this correlation breaks down. We have shown that at 1 AU the speed-temperature relationship is often well represented by a linear fit for a speed range spanning both the slow and fast wind. By examining all of the ACE and OMNI measurements, we found that when coronal holes are large the fast wind can have a different T-V relationship than the slow wind. The best example of this was in 2003 when there was a very large and long-lived outward polarity coronal hole at low latitudes. The long-lived nature of the hole made it possible to clearly distinguish that large holes can have a different T-V relationship. We found it to be rare that holes are large enough and last long enough to have enough data points to clearly demonstrate this effect. In this study we compare the 2003 coronal hole observations from ACE with the Ulysses polar coronal hole measurements. In an even earlier ACE study we found that both the compressions and rarefactions curves are linear, but the compression curve is shifted to higher temperatures. In this presentation we use Helios, Ulysses, and ACE measurements to examine how the T-V relationship varies with distance. The dynamic evolution of the solar wind parameters is revealed when we first separate compressions and rarefactions and then determine the radial profiles of the solar wind parameters. We find that T-V relationship varies with distance and in particular beyond 3 AU the differences between the compressions and rarefactions are quite important and at such distances a simple linear fit does not represent the T-V distribution very well.

  15. Regional variations in the health, environmental, and climate benefits of wind and solar generation

    OpenAIRE

    Siler-Evans, Kyle; Azevedo, Inês Lima; Morgan, M. Granger; Apt, Jay

    2013-01-01

    When wind or solar energy displace conventional generation, the reduction in emissions varies dramatically across the United States. Although the Southwest has the greatest solar resource, a solar panel in New Jersey displaces significantly more sulfur dioxide, nitrogen oxides, and particulate matter than a panel in Arizona, resulting in 15 times more health and environmental benefits. A wind turbine in West Virginia displaces twice as much carbon dioxide as the same turbine in California. De...

  16. Western Wind and Solar Integration Study: Phase 2 (Presentation)

    Energy Technology Data Exchange (ETDEWEB)

    Lew, D.; Brinkman, G.; Ibanez, E.; Lefton, S.; Kumar, N.; Venkataraman, S.; Jordan, G.

    2013-09-01

    This presentation summarizes the scope and results of the Western Wind and Solar Integration Study Phase 2, which examined operational impacts of high penetrations of variable renewable generation in the West.

  17. Spectral analysis of turbulence propagation mechanisms in solar wind and tokamaks plasmas

    International Nuclear Information System (INIS)

    Dong, Yue

    2014-01-01

    This thesis takes part in the study of spectral transfers in the turbulence of magnetized plasmas. We will be interested in turbulence in solar wind and tokamaks. Spacecraft measures, first principle simulations and simple dynamical systems will be used to understand the mechanisms behind spectral anisotropy and spectral transfers in these plasmas. The first part of this manuscript will introduce the common context of solar wind and tokamaks, what is specific to each of them and present some notions needed to understand the work presented here. The second part deals with turbulence in the solar wind. We will present first an observational study on the spectral variability of solar wind turbulence. Starting from the study of Grappin et al. (1990, 1991) on Helios mission data, we bring a new analysis taking into account a correct evaluation of large scale spectral break, provided by the higher frequency data of the Wind mission. This considerably modifies the result on the spectral index distribution of the magnetic and kinetic energy. A second observational study is presented on solar wind turbulence anisotropy using autocorrelation functions. Following the work of Matthaeus et al. (1990); Dasso et al. (2005), we bring a new insight on this statistical, in particular the question of normalisation choices used to build the autocorrelation function, and its consequence on the measured anisotropy. This allows us to bring a new element in the debate on the measured anisotropy depending on the choice of the referential either based on local or global mean magnetic field. Finally, we study for the first time in 3D the effects of the transverse expansion of solar wind on its turbulence. This work is based on a theoretical and numerical scheme developed by Grappin et al. (1993); Grappin and Velli (1996), but never used in 3D. Our main results deal with the evolution of spectral and polarization anisotropy due to the competition between non-linear and linear (Alfven coupling

  18. Flank solar wind interaction. Annual report, June 1991-July 1992

    International Nuclear Information System (INIS)

    Moses, S.L.; Greenstadt, E.W.

    1992-08-01

    This report summarizes the results of the first 12 months of our program to study the interaction of the Earth's magnetosphere with the solar wind on the far flanks of the bow shock. This study employs data from the ISEE-3 spacecraft during its traversals of the Earth's magnetotail and correlative data from spacecraft monitoring the solar wind upstream. Our main effort to date has involved assembling data sets and developing new plotting programs. Two talks were given at the Spring Meeting of the American Geophysical Union describing our initial results from analyzing data from the far flank foreshock and magnetosheath. The following sections summarize our results

  19. High Time-Resolved Kinetic Temperatures of Solar Wind Minor Ions Measured with SOHO/CELIAS/CTOF

    Science.gov (United States)

    Janitzek, N. P.; Berger, L.; Drews, C.; Wimmer-Schweingruber, R. F.

    2017-12-01

    Solar wind heavy ions with an atomic number Z > 2 are referred to as minor ions since they represent a fraction of less than one percent of all solar wind ions. They can be therefore regarded as test particles, only reacting to but not driving the dynamics of the solar wind plasma, which makes them a unique diagnostic tool for plasma wave phenomena both in the solar atmosphere and the extended heliosphere. In the past, several studies have investigated the kinetic temperatures of minor ions, but due to low counting statistics these studies are based on ion velocity distribution functions (VDFs) recorded over time periods of several hours. The Charge Time-Of-Flight (CTOF) mass spectrometer as part of the Charge, ELement and Isotope Analysis System (CELIAS) onboard the SOlar and Heliospheric Observatory (SOHO) provides solar wind heavy ion 1D radial VDFs with excellent charge state separation, an unprecedented cadence of 5 minutes and very high counting statistics, exceeding similar state-of-the-art instruments by a factor of ten. In our study, based on CTOF measurements at Langrangian point L1 between DOY 150 and DOY 220 in 1996, we investigate systematically the influence of the VDF time resolution on the derived kinetic temperatures for solar wind silicon and iron ions. The selected ion set spans a wide range of mass-per-charge from 3 amu/e heavy ions with ion-cyclotron waves.

  20. Energy Primer: Solar, Water, Wind, and Biofuels.

    Science.gov (United States)

    Portola Inst., Inc., Menlo Park, CA.

    This is a comprehensive, fairly technical book about renewable forms of energy--solar, water, wind, and biofuels. The biofuels section covers biomass energy, agriculture, aquaculture, alcohol, methane, and wood. The focus is on small-scale systems which can be applied to the needs of the individual, small group, or community. More than one-fourth…

  1. Comparison of Solar and Wind Power Output and Correlation with Real-Time Pricing

    Science.gov (United States)

    Hoepfl, Kathryn E.; Compaan, Alvin D.; Solocha, Andrew

    2011-03-01

    This study presents a method that can be used to determine the least volatile power output of a wind and solar hybrid energy system in which wind and solar systems have the same peak power. Hourly data for wind and PV systems in Northwest Ohio are used to show that a combination of both types of sustainable energy sources produces a more stable power output and would be more valuable to the grid than either individually. This method could be used to determine the ideal ratio in any part of the country and should help convince electric utility companies to bring more renewable generation online. This study also looks at real-time market pricing and how each system (solar, wind, and hybrid) correlates with 2009 hourly pricing from the Midwest Interconnect. KEH acknowledges support from the NSF-REU grant PHY-1004649 to the Univ. of Toledo and Garland Energy Systems/Ohio Department of Development.

  2. Nearly incompressible MHD turbulence in the solar wind

    International Nuclear Information System (INIS)

    Matthaeus, W.H.; Zhou, Y.

    1989-01-01

    Observational studies indicate that solar wind plasma and magnetic field fluctuations may be meaningfully viewed as an example of magnetohydrodynamic turbulence. This paper presents a brief summary of some relevant results of turbulence theory and reviews a turbulence style description of 'typical' solar wind conditions. Recent results, particularly those regarding the radial evolution of inertial range cross helicity, support the viewpoint that interplanetary turbulence is active and evolving with heliocentric distance. A number of observed properties can be understood by appeal to incompressible turbulence mechanisms. This connection may be understood by appeal to incompressible turbulence mechanisms. This connection may be understood in terms of theories of pseudosound density fluctuations and nearly incompressible magnetohydrodynamics, which are also reviewed here. Finally, we summarize a recent two-scale dynamical theory of the radial and temporal evolution of the turbulence, which may provide an additional framework for understanding the observations. (author). 49 refs

  3. Solar wind proton temperature anisotropy: Linear theory and WIND/SWE observations

    Czech Academy of Sciences Publication Activity Database

    Hellinger, Petr; Trávníček, Pavel; Kasper, J. C.; Lazarus, A. J.

    2006-01-01

    Roč. 33, č. 9 (2006), L09101/1-L09101/4 ISSN 0094-8276 R&D Projects: GA AV ČR(CZ) IAA3042403 Grant - others:ESA(XE) PECS 98024; NASA (US) NAG-10915 Institutional research plan: CEZ:AV0Z30420517 Keywords : proton temperature anisotropy * solar wind * in situ observations Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 2.602, year: 2006

  4. Theoretical models for MHD turbulence in the solar wind

    International Nuclear Information System (INIS)

    Veltri, P.; Malara, F.

    1997-01-01

    The in situ measurements of velocity, magnetic field, density and temperature fluctuations performed in the solar wind have greatly improved our knowledge of MDH turbulence not only from the point of view of space physics but also from the more general point of view of plasma physics. These fluctuations which extend over a wide range of frequencies (about 5 decades), a fact which seems to be the signature of turbulent nonlinear energy cascade, display, mainly in the trailing edge of high-speed streams, a number of features characteristic of a self-organized situation: i) a high degree of correlation between magnetic and velocity field fluctuations, ii) a very low level of fluctuations in mass density and magnetic-field intensity, iii) a considerable anisotropy revealed by minimum variance analysis of the magnetic-field correlation tensor. Many fundamental processes in plasma physics, which were largely unknown or not understood before their observations in the solar wind, have been explained, by building up analytical models or performing numerical simulations. We discuss the most recent analytical theories and numerical simulations and outline the limits implicit in any analysis which consider the low-frequency solar-wind fluctuations as a superposition of linear modes. The characterization of low-frequency fluctuations during Alfvenic periods, which results from the models discussed, is finally presented

  5. Analysis of Correlation Tendency between Wind and Solar from Various Spatio-temporal Perspectives

    Science.gov (United States)

    Wang, X.; Weihua, X.; Mei, Y.

    2017-12-01

    Analysis of correlation between wind resources and solar resources could explore their complementary features, enhance the utilization efficiency of renewable energy and further alleviate the carbon emission issues caused by the fossil energy. In this paper, we discuss the correlation between wind and solar from various spatio-temporal perspectives (from east to west, in terms of plain, plateau, hill, and mountain, from hourly to daily, ten days and monthly) with observed data and modeled data from NOAA (National Oceanic and Atmospheric Administration) and NERL (National Renewable Energy Laboratory). With investigation of wind speed time series and solar radiation time series (period: 10 years, resolution: 1h) of 72 stations located in various landform and distributed dispersedly in USA, the results show that the correlation coefficient, Kendall's rank correlation coefficient, changes negative to positive value from east coast to west coast of USA, and this phenomena become more obvious when the time scale of resolution increases from daily to ten days and monthly. Furthermore, considering the differences of landforms which influence the local meteorology the Kendall coefficients of diverse topographies are compared and it is found that the coefficients descend from mountain to hill, plateau and plain. However, no such evident tendencies could be found in daily scale. According to this research, it is proposed that the complementary feature of wind resources and solar resources in the east or in the mountain area of USA is conspicuous. Subsequent study would try to further verify this analysis by investigating the operation status of wind power station and solar power station.

  6. Anisotropic Behaviour of Magnetic Power Spectra in Solar Wind Turbulence.

    Science.gov (United States)

    Banerjee, S.; Saur, J.; Gerick, F.; von Papen, M.

    2017-12-01

    Introduction:High altitude fast solar wind turbulence (SWT) shows different spectral properties as a function of the angle between the flow direction and the scale dependent mean magnetic field (Horbury et al., PRL, 2008). The average magnetic power contained in the near perpendicular direction (80º-90º) was found to be approximately 5 times larger than the average power in the parallel direction (0º- 10º). In addition, the parallel power spectra was found to give a steeper (-2) power law than the perpendicular power spectral density (PSD) which followed a near Kolmogorov slope (-5/3). Similar anisotropic behaviour has also been observed (Chen et al., MNRAS, 2011) for slow solar wind (SSW), but using a different method exploiting multi-spacecraft data of Cluster. Purpose:In the current study, using Ulysses data, we investigate (i) the anisotropic behaviour of near ecliptic slow solar wind using the same methodology (described below) as that of Horbury et al. (2008) and (ii) the dependence of the anisotropic behaviour of SWT as a function of the heliospheric latitude.Method:We apply the wavelet method to calculate the turbulent power spectra of the magnetic field fluctuations parallel and perpendicular to the local mean magnetic field (LMF). According to Horbury et al., LMF for a given scale (or size) is obtained using an envelope of the envelope of that size. Results:(i) SSW intervals always show near -5/3 perpendicular spectra. Unlike the fast solar wind (FSW) intervals, for SSW, we often find intervals where power parallel to the mean field is not observed. For a few intervals with sufficient power in parallel direction, slow wind turbulence also exhibit -2 parallel spectra similar to FSW.(ii) The behaviours of parallel and perpendicular power spectra are found to be independent of the heliospheric latitude. Conclusion:In the current study we do not find significant influence of the heliospheric latitude on the spectral slopes of parallel and perpendicular

  7. Sputtering of Lunar Regolith Simulant by Protons and Multicharged Heavy Ions at Solar Wind Energies

    International Nuclear Information System (INIS)

    Meyer, Fred W.; Harris, Peter R.; Taylor, C.N.; Meyer, Harry M. III; Barghouty, N.; Adams, J. Jr.

    2011-01-01

    We report preliminary results on sputtering of a lunar regolith simulant at room temperature by singly and multiply charged solar wind ions using quadrupole and time-of-flight (TOF) mass spectrometry approaches. Sputtering of the lunar regolith by solar-wind heavy ions may be an important particle source that contributes to the composition of the lunar exosphere, and is a possible mechanism for lunar surface ageing and compositional modification. The measurements were performed in order to assess the relative sputtering efficiency of protons, which are the dominant constituent of the solar wind, and less abundant heavier multicharged solar wind constituents, which have higher physical sputtering yields than same-velocity protons, and whose sputtering yields may be further enhanced due to potential sputtering. Two different target preparation approaches using JSC-1A AGGL lunar regolith simulant are described and compared using SEM and XPS surface analysis.

  8. Statistical study of chorus wave distributions in the inner magnetosphere using Ae and solar wind parameters

    Science.gov (United States)

    Aryan, Homayon; Yearby, Keith; Balikhin, Michael; Agapitov, Oleksiy; Krasnoselskikh, Vladimir; Boynton, Richard

    2014-08-01

    Energetic electrons within the Earth's radiation belts represent a serious hazard to geostationary satellites. The interactions of electrons with chorus waves play an important role in both the acceleration and loss of radiation belt electrons. The common approach is to present model wave distributions in the inner magnetosphere under different values of geomagnetic activity as expressed by the geomagnetic indices. However, it has been shown that only around 50% of geomagnetic storms increase flux of relativistic electrons at geostationary orbit while 20% causes a decrease and the remaining 30% has relatively no effect. This emphasizes the importance of including solar wind parameters such as bulk velocity (V), density (n), flow pressure (P), and the vertical interplanetary magnetic field component (Bz) that are known to be predominately effective in the control of high energy fluxes at the geostationary orbit. Therefore, in the present study the set of parameters of the wave distributions is expanded to include the solar wind parameters in addition to the geomagnetic activity. The present study examines almost 4 years (1 January 2004 to 29 September 2007) of Spatio-Temporal Analysis of Field Fluctuation data from Double Star TC1 combined with geomagnetic indices and solar wind parameters from OMNI database in order to present a comprehensive model of wave magnetic field intensities for the chorus waves as a function of magnetic local time, L shell (L), magnetic latitude (λm), geomagnetic activity, and solar wind parameters. Generally, the results indicate that the intensity of chorus emission is not only dependent upon geomagnetic activity but also dependent on solar wind parameters with velocity and southward interplanetary magnetic field Bs (Bz < 0), evidently the most influential solar wind parameters. The largest peak chorus intensities in the order of 50 pT are observed during active conditions, high solar wind velocities, low solar wind densities, high

  9. Dawn- Dusk Auroral Oval Oscillations Associated with High- Speed Solar Wind

    Science.gov (United States)

    Liou, Kan; Sibeck, David G.

    2018-01-01

    We report evidence of global-scale auroral oval oscillations in the millihertz range, using global auroral images acquired from the Ultraviolet Imager on board the decommissioned Polar satellite and concurrent solar wind measurements. On the basis of two events (15 January 1999 and 6 January 2000) studied, it is found that (1) quasi-periodic auroral oval oscillations (approximately 3 megahertz) can occur when solar wind speeds are high at northward or southward interplanetary magnetic field turning, (2) the oscillation amplitudes range from a few to more than 10 degrees in latitudes, (3) the oscillation frequency is the same for each event irrespective of local time and without any azimuthal phase shift (i.e., propagation), (4) the auroral oscillations occur in phase within both the dawn and dusk sectors but 180 degrees out of phase between the dawn and dusk sectors, and (5) no micropulsations on the ground match the auroral oscillation periods. While solar wind conditions favor the growth of the Kelvin-Helmholtz (K-H) instability on the magnetopause as often suggested, the observed wave characteristics are not consistent with predictions for K-H waves. The in-phase and out-of-phase features found in the dawn-dusk auroral oval oscillations suggest that wiggling motions of the magnetotail associated with fast solar winds might be the direct cause of the global-scale millihertz auroral oval oscillations. Plain Language Summary: We utilize global auroral image data to infer the motion of the magnetosphere and show, for the first time, the entire magnetospheric tail can move east-west in harmony like a windsock flapping in wind. The characteristic period of the flapping motion may be a major source of global long-period ULF (Ultra Low Frequency) waves, adding an extra source of the global mode ULF waves.

  10. EISCAT measurements of solar wind velocity and the associated level of interplanetary scintillation

    Directory of Open Access Journals (Sweden)

    R. A. Fallows

    2002-09-01

    Full Text Available A relative scintillation index can be derived from EISCAT observations of Interplanetary Scintillation (IPS usually used to study the solar wind velocity. This provides an ideal opportunity to compare reliable measurements of the solar wind velocity derived for a number of points along the line-of-sight with measurements of the overall level of scintillation. By selecting those occasions where either slow- or fast-stream scattering was dominant, it is shown that at distances from the Sun greater than 30 RS , in both cases the scintillation index fell with increasing distance as a simple power law, typically as R-1.7. The level of scintillation for slow-stream scattering is found to be 2.3 times the level for fast-stream scattering.Key words. Interplanetary physics (solar wind plasma

  11. On Kinetic Slow Modes, Fluid Slow Modes, and Pressure-balanced Structures in the Solar Wind

    Energy Technology Data Exchange (ETDEWEB)

    Verscharen, Daniel [Space Science Center and Department of Physics, University of New Hampshire, Durham, NH 03824 (United States); Chen, Christopher H. K. [Department of Physics, Imperial College London, London SW7 2AZ (United Kingdom); Wicks, Robert T., E-mail: daniel.verscharen@unh.edu, E-mail: christopher.chen@imperial.ac.uk, E-mail: r.wicks@ucl.ac.uk [Mullard Space Science Laboratory, University College London, London WC1E 6BT (United Kingdom)

    2017-05-10

    Observations in the solar wind suggest that the compressive component of inertial-range solar-wind turbulence is dominated by slow modes. The low collisionality of the solar wind allows for nonthermal features to survive, which suggests the requirement of a kinetic plasma description. The least-damped kinetic slow mode is associated with the ion-acoustic (IA) wave and a nonpropagating (NP) mode. We derive analytical expressions for the IA-wave dispersion relation in an anisotropic plasma in the framework of gyrokinetics and then compare them to fully kinetic numerical calculations, results from two-fluid theory, and magnetohydrodynamics (MHD). This comparison shows major discrepancies in the predicted wave phase speeds from MHD and kinetic theory at moderate to high β . MHD and kinetic theory also dictate that all plasma normal modes exhibit a unique signature in terms of their polarization. We quantify the relative amplitude of fluctuations in the three lowest particle velocity moments associated with IA and NP modes in the gyrokinetic limit and compare these predictions with MHD results and in situ observations of the solar-wind turbulence. The agreement between the observations of the wave polarization and our MHD predictions is better than the kinetic predictions, which suggests that the plasma behaves more like a fluid in the solar wind than expected.

  12. On Kinetic Slow Modes, Fluid Slow Modes, and Pressure-balanced Structures in the Solar Wind

    International Nuclear Information System (INIS)

    Verscharen, Daniel; Chen, Christopher H. K.; Wicks, Robert T.

    2017-01-01

    Observations in the solar wind suggest that the compressive component of inertial-range solar-wind turbulence is dominated by slow modes. The low collisionality of the solar wind allows for nonthermal features to survive, which suggests the requirement of a kinetic plasma description. The least-damped kinetic slow mode is associated with the ion-acoustic (IA) wave and a nonpropagating (NP) mode. We derive analytical expressions for the IA-wave dispersion relation in an anisotropic plasma in the framework of gyrokinetics and then compare them to fully kinetic numerical calculations, results from two-fluid theory, and magnetohydrodynamics (MHD). This comparison shows major discrepancies in the predicted wave phase speeds from MHD and kinetic theory at moderate to high β . MHD and kinetic theory also dictate that all plasma normal modes exhibit a unique signature in terms of their polarization. We quantify the relative amplitude of fluctuations in the three lowest particle velocity moments associated with IA and NP modes in the gyrokinetic limit and compare these predictions with MHD results and in situ observations of the solar-wind turbulence. The agreement between the observations of the wave polarization and our MHD predictions is better than the kinetic predictions, which suggests that the plasma behaves more like a fluid in the solar wind than expected.

  13. Operation strategy for grid-tied DC-coupling power converter interface integrating wind/solar/battery

    Science.gov (United States)

    Jou, H. L.; Wu, J. C.; Lin, J. H.; Su, W. N.; Wu, T. S.; Lin, Y. T.

    2017-11-01

    The operation strategy for a small-capacity grid-tied DC-coupling power converter interface (GDPCI) integrating wind energy, solar energy and battery energy storage is proposed. The GDPCI is composed of a wind generator, a solar module set a battery bank, a boost DC-DC power converter (DDPC), a bidirectional DDPC power converter, an AC-DC power converter (ADPC) and a five-level DC-AC inverter (DAI). A solar module set, a wind generator and a battery bank are coupled to the common DC bus through the boost DDPC, the ADPC and the bidirectional DDPC, respectively. For verifying the performance of the GDPCI under different operation modes, computer simulation is carried out by PSIM.

  14. Solar Wind Deflection by Mass Loading in the Martian Magnetosheath Based on MAVEN Observations

    Science.gov (United States)

    Dubinin, E.; Fraenz, M.; Pätzold, M.; Halekas, J. S.; Mcfadden, J.; Connerney, J. E. P.; Jakosky, B. M.; Vaisberg, O.; Zelenyi, L.

    2018-03-01

    Mars Atmosphere and Volatile EvolutioN observations at Mars show clear signatures of the shocked solar wind interaction with the extended oxygen atmosphere and hot corona displayed in a lateral deflection of the magnetosheath flow in the direction opposite to the direction of the solar wind motional electric field. The value of the velocity deflection reaches ˜50 km/s. The occurrence of such deflection is caused by the "Lorentz-type" force due to a differential streaming of the solar wind protons and oxygen ions originating from the extended oxygen corona. The value of the total deceleration of the magnetosheath flow due to mass loading is estimated as ˜40 km/s.

  15. Long-period variations of wind parameters in the mesopause region and the solar cycle dependence

    International Nuclear Information System (INIS)

    Greisiger, K.M.; Schminder, R.; Kuerschner, D.

    1987-01-01

    A solar dependence of wind parameters below 100 km was found by Sprenger and Schminder on the basis of long-term continuous ionospheric drift measurements. For winter they obtained for the prevailing wind a positive correlation with solar activity and for the amplitude of the semi-diurnal tidal wind a negative correlation. However, after the years 1973-1974 we found a significant negative correlation with solar activity with an indication of a new change after 1983. We conclude that this long-term behaviour points rather to a climatic variation with an internal atmospheric cause than to a direct solar control. Recent satellite data of the solar u.v. radiation and the upper stratospheric ozone have shown that the possible variation of the thermal tidal excitation during the solar cycle amounts to only a few per cent. This is, therefore, insufficient to account for the 40-70% variation of the tidal amplitudes. Some other possibilities of explaining this result are discussed. (author)

  16. Integrating wind and solar power into the energy systems of the 21st century

    Energy Technology Data Exchange (ETDEWEB)

    Flavin, C [Worldwatch Inst., Washington, DC (United States)

    1996-12-31

    Although they have been pursued by scientists and entrepreneurs for two decades, solar and wind energy have not yet claimed the large share of the world energy market that proponents hoped they would. Yet the past two years brought a series of developments that suggest the time has come for solar and wind energy to compete directly with fossil fuels. Wind and solar power generators are likely to contribute significant power to the electricity systems of scores of countries within the next decade, with generating costs as low as 4-5 cents per kilowatt-hour. This will require adjustment in the operation of power transmission and distribution systems to accommodate intermittent resources, as well as new time-specific pricing of electricity. The transition to more open, competitive power systems, with liberal access by independent producers, is likely to speed introduction of the new technologies. Altogether, the energy that strikes the earth`s atmosphere in the form of sunlight each year, and the winds that flow from it, represent the equivalent of nearly 1,000 trillion barrels of oil-sufficient to fuel the global economy thousands of times over. By relying on a new generation of efficient, high-tech, and mass produced energy conversion devices such as advanced wind turbines and photovoltaics, the world can rapidly reduce its dependence on oil and coal in the twenty-first century. In the more distant future, solar and wind energy have the potential not only to supply much of the world`s electricity but to displace the direct use of oil and natural gas. Solar and wind energy can be used to split water via electrolysis, producing hydrogen gas that can be substituted for liquid and gaseous fuels. (46 refs.)

  17. Integrating wind and solar power into the energy systems of the 21st century

    Energy Technology Data Exchange (ETDEWEB)

    Flavin, C. [Worldwatch Inst., Washington, DC (United States)

    1995-12-31

    Although they have been pursued by scientists and entrepreneurs for two decades, solar and wind energy have not yet claimed the large share of the world energy market that proponents hoped they would. Yet the past two years brought a series of developments that suggest the time has come for solar and wind energy to compete directly with fossil fuels. Wind and solar power generators are likely to contribute significant power to the electricity systems of scores of countries within the next decade, with generating costs as low as 4-5 cents per kilowatt-hour. This will require adjustment in the operation of power transmission and distribution systems to accommodate intermittent resources, as well as new time-specific pricing of electricity. The transition to more open, competitive power systems, with liberal access by independent producers, is likely to speed introduction of the new technologies. Altogether, the energy that strikes the earth`s atmosphere in the form of sunlight each year, and the winds that flow from it, represent the equivalent of nearly 1,000 trillion barrels of oil-sufficient to fuel the global economy thousands of times over. By relying on a new generation of efficient, high-tech, and mass produced energy conversion devices such as advanced wind turbines and photovoltaics, the world can rapidly reduce its dependence on oil and coal in the twenty-first century. In the more distant future, solar and wind energy have the potential not only to supply much of the world`s electricity but to displace the direct use of oil and natural gas. Solar and wind energy can be used to split water via electrolysis, producing hydrogen gas that can be substituted for liquid and gaseous fuels. (46 refs.)

  18. Optimization of PV/Wind/Battery stand-alone system, using hybrid FPA/SA algorithm and CFD simulation, case study: Tehran

    International Nuclear Information System (INIS)

    Tahani, Mojtaba; Babayan, Narek; Pouyaei, Arman

    2015-01-01

    Highlights: • The utilization of an optimized Hybrid PV/Wind/Battery system has been studied. • The proposed system has been studied for a building in Tehran. • A novel hybrid optimization method, namely FPA/SA has been proposed. • The impact of inclined part of the roof on wind velocity is studied by CFD. • LPSP and Payback time were considered as objective functions in this study. - Abstract: Renewable energy hybrid systems are a promising technology toward sustainable and clean development. Due to stochastic behavior of renewable energy sources, optimization of their convertors has great importance for increasing system’s reliability and efficiency and also in order to decrease the costs. In this research study, it was aimed to study the utilization of an optimized hybrid PV/Wind/Battery system for a three story building, with an inclined surface on the edge of its roof, located in Tehran, capital of Iran. For this purpose, a new evolutionary based optimization technique, namely hybrid FPA/SA algorithm was developed, in order to maximize system’s reliability and minimize system’s costs. The new algorithm combines the approaches which are utilized in Flower Pollination Algorithm (FPA) and Simulated Annealing (SA) algorithm. The developed algorithm was validated using popular benchmark functions. Moreover the influence of PV panels tilt angle (which is equal to the slope of inclined part of the roof) is studied on the wind speed by using computational fluid dynamics (CFD) simulation. The outputs of CFD simulations are utilized as inputs for modeling wind turbine performance. The Loss of Power Supply Probability (LPSP) and Payback time are considered as objective functions, and PV panel tilt angle, number of PV panels and number of batteries are selected as decision variables. The results showed that if the tilt angle for PV panels is set equal to 30° and the number of PV panels is selected equal to 11 the fastest payback time which is 12 years and

  19. The Effect of Solar Wind Variations on the Escape of Oxygen Ions From Mars Through Different Channels: MAVEN Observations

    Science.gov (United States)

    Dubinin, E.; Fraenz, M.; Pätzold, M.; McFadden, J.; Halekas, J. S.; DiBraccio, G. A.; Connerney, J. E. P.; Eparvier, F.; Brain, D.; Jakosky, B. M.; Vaisberg, O.; Zelenyi, L.

    2017-11-01

    We present multi-instrument observations of the effects of solar wind on ion escape fluxes on Mars based on the Mars Atmosphere and Volatile EvolutioN (MAVEN) data from 1 November 2014 to 15 May 2016. Losses of oxygen ions through different channels (plasma sheet, magnetic lobes, boundary layer, and ion plume) as a function of the solar wind and the interplanetary magnetic field variations were studied. We have utilized the modified Mars Solar Electric (MSE) coordinate system for separation of the different escape routes. Fluxes of the low-energy (≤30 eV) and high-energy (≥30 eV) ions reveal different trends with changes in the solar wind dynamic pressure, the solar wind flux, and the motional electric field. Major oxygen fluxes occur through the tail of the induced magnetosphere. The solar wind motional electric field produces an asymmetry in the ion fluxes and leads to different relations between ion fluxes supplying the tail from the different hemispheres and the solar wind dynamic pressure (or flux) and the motional electric field. The main driver for escape of the high-energy oxygen ions is the solar wind flux (or dynamic pressure). On the other hand, the low-energy ion component shows the opposite trend: ion flux decreases with increasing solar wind flux. As a result, the averaged total oxygen ion fluxes reveal a low variability with the solar wind strength. The large standard deviations from the averages values of the escape fluxes indicate the existence of mechanisms which can enhance or suppress the efficiency of the ion escape. It is shown that the Martian magnetosphere possesses the properties of a combined magnetosphere which contains different classes of field lines. The existence of the closed magnetic field lines in the near-Mars tail might be responsible for suppression of the ion escape fluxes.

  20. Beam tracking strategies for studies of kinetic scales in the solar wind with THOR-CSW

    Science.gov (United States)

    De Keyser, Johan; Lavraud, Benoit; Neefs, Eddy; Berkenbosch, Sophie; Anciaux, Michel; Maggiolo, Romain

    2016-04-01

    Modern plasma spectrometers for monitoring the solar wind attempt to intelligently track the energy and direction of the solar wind beam in order to obtain solar wind velocity distributions more efficiently. Such beam tracking strategies offer some benefits, but also have their limitations and drawbacks. Benefits include an improved resolution and/or a faster velocity distribution function acquisition time. Limitations are due to instrument characteristics that tend to be optimized for a particular range of particle energies and arrival directions. A drawback is the risk to miss an important part of the velocity distribution or to lose track of the beam altogether. A comparison is presented of different beam tracking strategies under consideration for the THOR-CSW instrument in order to highlight a number of design decisions and their impact on the acquired velocity distributions. The gain offered by beam tracking in terms of increased time resolution turns out to be essential for studies of solar wind physics at kinetic scales.