WorldWideScience

Sample records for sodium-iodide symporter nis

  1. The sodium iodide symporter (NIS) and potential regulators in normal, benign and malignant human breast tissue.

    LENUS (Irish Health Repository)

    Ryan, James

    2011-01-01

    The presence, relevance and regulation of the Sodium Iodide Symporter (NIS) in human mammary tissue remains poorly understood. This study aimed to quantify relative expression of NIS and putative regulators in human breast tissue, with relationships observed further investigated in vitro.

  2. Discovery of aryl-tri-fluoroborates as potent sodium/iodide sym-porter (NIS) inhibitors

    International Nuclear Information System (INIS)

    Lecat-Guillet, N.; Ambroise, Y.

    2008-01-01

    The structure-based design of sodium/iodide sym-porter (NIS) inhibitors identified new active compounds. The organo-tri-fluoroborate shown was found to inhibit iodide uptake with an IC50 value of 0.4 μM on rat-derived thyroid cells. The biological activity is rationalized by the presence of the BF3 - ion as a minimal binding motif for substrate recognition at the iodide binding site. (authors)

  3. Discovery of aryl-tri-fluoroborates as potent sodium/iodide sym-porter (NIS) inhibitors

    Energy Technology Data Exchange (ETDEWEB)

    Lecat-Guillet, N.; Ambroise, Y. [CEA, DSV, Dept Bioorgan Chem and Isotop Labelling, Inst Biol and Technol, iBiTecS, F-91191 Gif Sur Yvette (France)

    2008-07-01

    The structure-based design of sodium/iodide sym-porter (NIS) inhibitors identified new active compounds. The organo-tri-fluoroborate shown was found to inhibit iodide uptake with an IC50 value of 0.4 {mu}M on rat-derived thyroid cells. The biological activity is rationalized by the presence of the BF3{sup -} ion as a minimal binding motif for substrate recognition at the iodide binding site. (authors)

  4. Sodium iodide symporter (NIS) in extrathyroidal malignancies: focus on breast and urological cancer

    International Nuclear Information System (INIS)

    Micali, Salvatore; Bulotta, Stefania; Puppin, Cinzia; Territo, Angelo; Navarra, Michele; Bianchi, Giampaolo; Damante, Giuseppe; Filetti, Sebastiano; Russo, Diego

    2014-01-01

    Expression and function of sodium iodide symporter (NIS) is requisite for efficient iodide transport in thyrocytes, and its presence in cancer cells allows the use of radioiodine as a diagnostic and therapeutic tool in thyroid neoplasia. Discovery of NIS expression in extrathyroidal tissues, including transformed cells, has opened a novel field of research regarding NIS-expressing extrathyroidal neoplasia. Indeed, expression of NIS may be used as a biomarker for diagnostic, prognostic, and therapeutic purposes. Moreover, stimulation of endogenous NIS expression may permit the radioiodine treatment of extrathyroidal lesions by concentrating this radioisotope. This review describes recent findings in NIS research in extrathyroidal malignancies, focusing on breast and urological cancer, emphasizing the most relevant developments that may have clinical impact. Given the recent progress in the study of NIS regulation as molecular basis for new therapeutic approaches in extrathyroidal cancers, particular attention is given to studies regarding the relationship between NIS and clinical-pathological aspects of the tumors and the regulation of NIS expression in the experimental models

  5. Human sodium iodide symporter (hNIS) in fibroadenoma breast--a immunohistochemical study.

    Science.gov (United States)

    Rai, Ruchi; Shrivastava, Ashutosh; Tandon, Ashwani; Godbole, Madan M; Kumar, Sandeep; Das, Vinita; Dwivedi, Varsha; Pal, Lily

    2011-02-01

    Human sodium iodide symporter (hNIS), responsible for the active transport of iodine is an integral plasma membrane glycoprotein present in the thyroid cells and extrathyroid tissues like breast and salivary glands. If its functional form is unequivocally shown in benign or malignant breast tissues, then it may serve as a basis for diagnosis and treatment using radioactive iodine. With an aim to analyze the hNIS expression in a distinct benign breast condition of fibroadenoma, biopsy proven fibroadenoma tissues, normal non-lactating breast tissue and biopsy proven infiltrating duct carcinoma tissues were examined for hNIS expression using immunohistochemistry. Out of 20 biopsy proven fibroadenoma tissues, 19 (95%) showed positivity for hNIS protein and only one was negative. Of these 10% were mildly positive, 50% cases were moderately positive and 35% showed intense positivity. None of the control tissue obtained from reduction mammoplasty specimens or normal breast tissues samples (5 cms away from the tumor) were positive, hNIS was also intensely positive in 9 out of 10 (90%) infiltrating duct carcinoma tissues and moderately positive in one case. These preliminary results show that hNIS was present in high frequency as demonstrated by immunohistochemistry in fibroadenoma breast.

  6. Towards a biochemical and structural characterisation of the sodium-iodide sym-porter (Nis)

    International Nuclear Information System (INIS)

    Darrouzet, E.; Marcellin, D.; Huc, S.; Quemeneur, E.; Pourcher, T.

    2006-01-01

    Iodide is essential for thyroid hormone biosynthesis in mammals, and therefore for the control of cell metabolism and the development of the central nervous system in the foetus and newborns, but is relatively scarce element in the environment. To ensure its accumulation, the thyroid gland has evolved a remarkably efficient system, the sodium-iodide sym-porter (NIS), that was first characterized at the molecular level 10 years ago (1). NIS is an intrinsic protein mainly located in the basolateral membrane of thyroid follicular cells where it actively transports iodide ions using the sodium gradient as a driving force (2,3). In addition, this transporter has been found in lactating mammary gland, stomach, and salivary glands, and its mRNA was detected in brain, ovaries, testis. To date, the physiological role of NIS in these organs is not yet identified (3,4).The capacity of NIS to mediate the accumulation of radioactive iodide has been exploited for many years in the diagnosis of thyroid cancer as well as for the detection and radiotherapy of derived metastases. Moreover, the presence of NIS in some breast tumours and the possibility to express it by targeted gene therapy in tumour cells where it is not naturally present could also widen its medical application (4-7). In case of accidental contamination, NIS would also be responsible for accumulation of radioisotopes in the thyroid and for their transfer to the milk and the newborn, eventually causing thyroid cancers. This has motivated our research program in the perspective of designing novel specific therapeutics. During the last decade, the gene encoding the thyroid NIS has been identified and sequenced in various species including rat, mouse and human (1, 8). It was also demonstrated that the protein expression and activity are highly regulated both at the transcriptional and post-translational levels (3). A preliminary topological mode could be drawn from the protein sequence. It proposes a general

  7. Rhenium-188 as an alternative to Iodine-131 for treatment of breast tumors expressing the sodium/iodide symporter (NIS)

    International Nuclear Information System (INIS)

    Dadachova, E.; Bouzahzah, B.; Zuckier, L.S.; Pestell, R.G.

    2002-01-01

    The sodium-iodide symporter (NIS), which transports iodine into the cell, is expressed in thyroid tissue and was recently found to be expressed in approximately 80% of human breast cancers but not in healthy breast tissue. These findings raised the possibility that therapeutics targeting uptake by NIS may be used for breast cancer treatment. To increase the efficacy of such therapy it would be ideal to identify a radioactive therapy with enhanced local emission. The feasibility of using the powerful beta-emitting radiometal 188 Re in the form of 188 Re-perrhenate was therefore compared with 131 I for treatment of NIS-expressing mammary tumors. In the current studies, using a xenografted breast cancer model induced by the ErbB2 oncogene in nude mice, 188 Re-perrhenate exhibited NIS-dependent uptake into the mammary tumor. Dosimetry calculations in the mammary tumor demonstrate that 188 Re-perrhenate is able to deliver a dose 4.5 times higher than 131 I suggesting it may provide enhanced therapeutic efficacy

  8. Experimental study of the function of the sodium/iodide symporter (nis) in the nude mice bearing breast cancer

    International Nuclear Information System (INIS)

    Fan Wei; Wang Guohui; Zhang Weiguang; Dai Junjin; Yang Xiaochun

    2004-01-01

    Objective: To investigate the function of the sodium / iodide symporter (NIS) and the feasibility of treating breast cancer by studying the distribution and imaging of the nude mice bearing breast cancer. Methods: The animal model of MCF-7/ER(+)-bearing and MCF-7/ER(-)-bearing human breast cancer nude mice were prepared before experiments. The mice were intraperitoneally injected with 131I when tumor grown to 0.8-1 cm . The distribution of 131I in different tissues was detected at different time ( 6, 12, and 24h ). The percentage of the injected dose per gram of tissue (%D/g) and the ratio of Tumor/Non-tumor were calculated. Meanwhile, the nude mice were imaged at different time. Results: The 131I in tumor tissue in the MCF-7/ER(+)group was higher than that of MCF- 7/ER(-) group at 6h after injection, and the %ID/g were 6.13% and 2.37% respectively. The %lD/g at 12 h of two groups were 9.31 and 3.12, and were 11.21 and 3.47 at 24 h. There was a distinguish difference between them (p<0.05). At 12 h, the values of T/NT of blood, heart, lung, intestine and muscle were 2.39,3.06,3.94, 7.69 and 7.60 and were 5.15, 5.47, 5.29, 11.44 and 10.99 at 24 h. The values of T/NT of MCF-7/ER(-) group were much lower than those of MCF-7/ER(+) group. The imaging results showed that there was much radioactivity in tumor tissue in the MCF-7/ER(+) group at 12 h . The control groups has no obvious radioactivity in the tumor tissue all the time. Conclusion: Sodium/iodide symporter expressed in the estrogen-receptor-positive breast cancer tissue could transformed actively 131I into tumor tissue, which suggests 1311 therapy might become a promising way to treat breast cancer. (authors)

  9. Comparison of human sodium iodide symporter (hNIS) gene expression between lentiviral and adenoviral vectors in rat mesenchymal stem cell

    International Nuclear Information System (INIS)

    Park, So Yeon; Lee, Won Woo; Kim, Sung Jin; Lee, Heui Ran; Kim, Hyun Joo; Chung, June Key; Kim, Sang Eun

    2007-01-01

    Quantitative comparison of transgene expression within stem cells between lentivirus and adenovirus-mediated delivery systems has not been done. Here, we evaluated the human sodium iodide symporter (hNIS) gene expression in rat mesenchymal stem cell (rMSC) transduced by lentivirus or adenovirus, and compared the hNIS expression quantitatively between the two delivery systems. Lentiviral-mediated stably hNIS expressing rMSC (lenti-hNIS-rMSC) was constructed by cloning the hNIS gene into pLenti6/UbC/V5-DEST (Invitrogen) to obtain pLenti-hNIS, transducing rMSC with the pLenti-hNIS, and selecting with blasticidin for 3 weeks. Recombinant adenovirus expressing hNIS gene (Rad-hNIS) was produced by homologous recombination and Rad-hNIS transduced rMSC (adeno-hNIS-rMSC) was evaluated for the hNIS expression 48 hours post infection at MOI 1, 5, 20, 50, and 100. The hNIS expression in lenti-hNIS-rMSC or adeno-hNIS-rMSC was assessed by immunocytochemistry, western blot, and I-125 uptake. Immunocytochemistry using mono-clonal anti-hNIS antibody revealed that intensity of hNIS immunoreactivity in lenti-hNIS-rMSC was greater than that in adeno-hNIS-rMSC at MOl 20 but lower than that at MOl 50. Western blot analysis also showed that lenti-hNIS-rMSC was intermediate between adeno-hNIS-rMSCs at MOl 20 and 50 in hNIS expression. However in vitro I-125 uptake test demonstrated that iodide uptake in lenti-hNIS-rMSC (297046659 picomole/106 cells) was greater than that in adeno-hNIS-rMSC at MOI 100 (61682134 picomole/106 cells). These results suggest that lentivirus mediated hNIS expression is greater in terms of hNIS function but lower in terms of hNIS protein amount than adenovirus mediated hNIS expression 48 hours post infection. Stem cell tracking using hNIS as a reporter gene should be conducted in consideration of relative viral efficiency of transgene expression

  10. Comparison of Human Sodium/Iodide Symporter (hNIS) Gene Expressions between Lentiviral and Adenoviral Vectors in Rat Mesenchymal Stem Cells

    Energy Technology Data Exchange (ETDEWEB)

    Park, So Yeon; Lee, Won Woo; Kim, Hyun Joo; Chung, June Key; Kim, Sang Eun [Seoul National University College of Medicine, Seoul (Korea, Republic of); Kim, Sung Jin; Lee, Heui Ran [Medical Research Center, Seoul National University, Seoul (Korea, Republic of)

    2008-10-15

    Quantitative comparison of transgene expression within stem cells between lentivirus and adenovirusmediated delivery systems has not been reported. Here, we evaluated the human sodium iodide symporter (hNIS) gene expression in rat mesenchymal stem cell (rMSC) transduced by lentivirus or adenovirus, and compared the hNIS expression quantitatively between the two delivery systems. Lentiviral-mediated hNIS expressing rMSC (lenti-hNIS-rMSC) was constructed by cloning hNIS gene into pLenti6/UbC/V5-DEST (Invitrogen) to obtain pLenti-hNIS, transducing rMSC with the pLenti-hNIS, and selecting with blasticidin for 3 weeks. Recombinant adenovirus expressing hNIS gene (Rad-hNIS) was produced by homologous recombination and transduction efficiency of Rad-hNIS into rMSC evaluated by Rad-GFP was 19.1{+-}4.7%, 54.0{+-}6.4%, 85.7{+-}8.7%, and 98.4{+-}1.3% at MOI 1, 5, 20, and 100, respectively. The hNIS expressions in lenti-hNIS-rMSC or adeno-hNIS-rMSC were assessed by immunocytochemistry, western blot, and I-125 uptake. Immunocytochemistry and western blot analyses revealed that hNIS expressions in lenti-hNIS-rMSC were greater than those in adeno-hNIS-rMSC at MOI 20 but lower than at MOI 50. However in vitro I-125 uptake test demonstrated that iodide uptake in lenti-hNIS-rMSC (29,704{+-}6,659 picomole/10{sup 6} cells) was greater than that in adeno-hNIS-rMSC at MOI 100 (6,168{+-}2,134 picomole/10{sup 6} cells). Despite lower amount of expressed protein, hNIS function in rMSC was greater by lentivirus than by adenovirus mediated expression. Stem cell tracking using hNIS as a reporter gene should be conducted in consideration of relative vector efficiency for transgene expression.

  11. Comparison of Human Sodium/Iodide Symporter (hNIS) Gene Expressions between Lentiviral and Adenoviral Vectors in Rat Mesenchymal Stem Cells

    International Nuclear Information System (INIS)

    Park, So Yeon; Lee, Won Woo; Kim, Hyun Joo; Chung, June Key; Kim, Sang Eun; Kim, Sung Jin; Lee, Heui Ran

    2008-01-01

    Quantitative comparison of transgene expression within stem cells between lentivirus and adenovirusmediated delivery systems has not been reported. Here, we evaluated the human sodium iodide symporter (hNIS) gene expression in rat mesenchymal stem cell (rMSC) transduced by lentivirus or adenovirus, and compared the hNIS expression quantitatively between the two delivery systems. Lentiviral-mediated hNIS expressing rMSC (lenti-hNIS-rMSC) was constructed by cloning hNIS gene into pLenti6/UbC/V5-DEST (Invitrogen) to obtain pLenti-hNIS, transducing rMSC with the pLenti-hNIS, and selecting with blasticidin for 3 weeks. Recombinant adenovirus expressing hNIS gene (Rad-hNIS) was produced by homologous recombination and transduction efficiency of Rad-hNIS into rMSC evaluated by Rad-GFP was 19.1±4.7%, 54.0±6.4%, 85.7±8.7%, and 98.4±1.3% at MOI 1, 5, 20, and 100, respectively. The hNIS expressions in lenti-hNIS-rMSC or adeno-hNIS-rMSC were assessed by immunocytochemistry, western blot, and I-125 uptake. Immunocytochemistry and western blot analyses revealed that hNIS expressions in lenti-hNIS-rMSC were greater than those in adeno-hNIS-rMSC at MOI 20 but lower than at MOI 50. However in vitro I-125 uptake test demonstrated that iodide uptake in lenti-hNIS-rMSC (29,704±6,659 picomole/10 6 cells) was greater than that in adeno-hNIS-rMSC at MOI 100 (6,168±2,134 picomole/10 6 cells). Despite lower amount of expressed protein, hNIS function in rMSC was greater by lentivirus than by adenovirus mediated expression. Stem cell tracking using hNIS as a reporter gene should be conducted in consideration of relative vector efficiency for transgene expression

  12. Imaging of adenovirus-mediated expression of human sodium iodide symporter (hNIS) by 99mTcO4 scan in mice

    International Nuclear Information System (INIS)

    Lee, Won Woo; Moon, D. H.; Park, S. Y.; Jin, J.; Kim, S. J.; Lee, H.

    2002-01-01

    We have evaluated the feasibility of human sodium iodide symporter (hNIS) as a reporter gene by 99m TcO 4 scan in vivo. Recombinant adenovirus encoding hNIS (Rad-hNIS) gene was introduced to FRO cell. hNIS expression was assessed by western blot and 99m TcO 4 uptake in vitro. 99m TcO 4 scan were obtained in BALB/c mice 48 hrs post injection of Tris buffer, Rad-hNIS (1x10 9 or 2x10 8 pfu), or Rad-LacZ (1x10 9 pfu) via the tail vein (n=5-7 for each group). Biodistribution study and RT-PCR were performed. A series of 99m TcO 4 scans were obtained in 2 mice until 21 days post Rad-hNIS injection. FRO readily expressed hNIS protein and incorporated significantly higher level of 99m TcO 4 in vitro. With 99m TcO 4 scan, prominent hepatic uptake was observed only in the mice with 1x10 9 pfu of Rad-hNIS. Liver/lung ratio was increased in this group from 15 (5.7±2.5) till 60 min(6.7±3.6) (p 99m TcO 4 uptake (22.7±11.2 %ID/g) and hNIS mRNA expression were exclusively noticed in livers of this group. The persistent hepatic uptake was observed for up one week. NaClO 4 inhibited the hepatic uptake of 99m TcO 4 . hNIS holds a promising potential as an effective reporter gene for noninvasive/repeated imaging in combination with 99m TcO 4

  13. Enhanced iodide sequestration by 3-biphenyl-5,6-dihydroimidazo 2,1-b thiazole in sodium/iodide sym-porter (NIS)-expressing cells

    International Nuclear Information System (INIS)

    Lecat-Guillet, N.; Ambroise, Y.

    2008-01-01

    The ability of the sodium/iodide sym-porter (NIS) to take up iodide has long provided the basis for cyto-reductive gene therapy and cancer treatment with radio-iodide. One of the major limitations of this approach is that radio-iodide retention in NIS-expressing cells is not sufficient for their destruction. We identified and characterized a small organic molecule capable of increasing iodide retention in HEK293 cells permanently transfected with human NIS cDNA (hNIS-HEK293) and in the rat thyroid-derived cell line FRTL-5. In the presence of 3-biphenyl-4'-yl-5,6-dihydroimidazo[2,1-b)thiazole (ISA1), the transmembrane iodide concentration gradient was increased up to 4.5-fold. Our experiments indicate that the imidazo-thiazole derivative acts either by inhibiting anion efflux mechanisms, or by promoting the relocation of iodide into subcellular compartments. This new compound is not only an attractive chemical tool to investigate the mechanisms of iodide flux at the cellular level, but also opens promising perspectives in the treatment of cancer after NIS gene transfer. (authors)

  14. Establishment of a hepatocellular carcinoma cell line expressing dual reporter genes: sodium iodide symporter (NIS) and enhanced green fluorescence protein (EGFP)

    International Nuclear Information System (INIS)

    Kwak, Won Jung; Koo, Bon Chul; Kwon, Mo Sun

    2007-01-01

    Dual reporter gene imaging has several advantages for more sophisticated molecular imaging studies such as gene therapy monitoring. Herein, we have constructed hepatoma cell line expressing dual reporter genes of sodium iodide symporter (NIS) and enhanced green fluorescence protein (EGFP), and the functionalities of the genes were evaluated in vivo by nuclear and optical imaging. A pRetro-PN vector was constructed after separating NIS gene from pcDNA-NIS. RSV-EGFP-WPRE fragment separated from pLNRGW was cloned into pRetro-PN vector. The final vector expressing dual reporter genes was named pRetro-PNRGW. A human hepatoma (HepG2) cells were transfected by the retrovirus containing NIS and EGFP gene (HepG2-NE). Expression of NIS gene was confirmed by RT-PCR, radioiodine uptake and efflux studies. Expression of EGFP was confirmed by RT-PCR and fluorescence microscope. The HepG2 and HepG2-NE cells were implanted in shoulder and hindlimb of nude mice, then fluorescence image, gamma camera image and I-124 microPET image were undertaken. The HepG2-NE cell was successfully constructed. RT-PCR showed NIS and EGFP mRNA expression. About 50% of cells showed fluorescence. The iodine uptake of NIS-expressed cells was about 9 times higher than control. In efflux study, T 1/2 of HepG2-NE cells was 9 min. HepG2-NE xenograft showed high signal-to-background fluorescent spots and higher iodine-uptake compared to those of HepG2 xenograft. A hepatoma cell line expressing NIS and EGFP dual reporter genes was successfully constructed and could be used as a potential either by therapeutic gene or imaging reporter gene

  15. Imaging of adenovirus-mediated expression of human sodium iodide symporter (hNIS) by {sup 99m}TcO{sub 4} scan in mice

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Won Woo; Moon, D. H.; Park, S. Y.; Jin, J.; Kim, S. J.; Lee, H. [Ulsan University College of Medicine, Seoul (Korea, Republic of)

    2002-07-01

    We have evaluated the feasibility of human sodium iodide symporter (hNIS) as a reporter gene by {sup 99m}TcO{sub 4} scan in vivo. Recombinant adenovirus encoding hNIS (Rad-hNIS) gene was introduced to FRO cell. hNIS expression was assessed by western blot and {sup 99m}TcO{sub 4} uptake in vitro. {sup 99m}TcO{sub 4} scan were obtained in BALB/c mice 48 hrs post injection of Tris buffer, Rad-hNIS (1x10{sup 9} or 2x10{sup 8} pfu), or Rad-LacZ (1x10{sup 9} pfu) via the tail vein (n=5-7 for each group). Biodistribution study and RT-PCR were performed. A series of {sup 99m}TcO{sub 4} scans were obtained in 2 mice until 21 days post Rad-hNIS injection. FRO readily expressed hNIS protein and incorporated significantly higher level of {sup 99m}TcO{sub 4} in vitro. With {sup 99m}TcO{sub 4} scan, prominent hepatic uptake was observed only in the mice with 1x10{sup 9} pfu of Rad-hNIS. Liver/lung ratio was increased in this group from 15 (5.7{+-}2.5) till 60 min(6.7{+-}3.6) (p<0.01). Significantly increased {sup 99m}TcO{sub 4} uptake (22.7{+-}11.2 %ID/g) and hNIS mRNA expression were exclusively noticed in livers of this group. The persistent hepatic uptake was observed for up one week. NaClO{sub 4} inhibited the hepatic uptake of {sup 99m}TcO{sub 4}. hNIS holds a promising potential as an effective reporter gene for noninvasive/repeated imaging in combination with {sup 99m}TcO{sub 4}.

  16. DEVELOPMENT OF A SCREENING APPROACH TO DETECT THYROID DISRUPTING CHEMICALS THAT INHIBIT THE HUMAN SODIUM IODIDE SYMPORTER (NIS)

    Data.gov (United States)

    U.S. Environmental Protection Agency — Data pertaining to a NIS-expressing cell line, hNIS-HEK293T-EPA, and its screening capabilities for determining inhibitors of NIS-mediated iodide uptake. This...

  17. Clinical value of sodium iodide symporter

    International Nuclear Information System (INIS)

    Li Qian

    2003-01-01

    The sodium iodide symptorter (NIS) is a membrane glycoprotein that mediates iodide uptake in the thyroid gland and several extrathyroidal tissues. In addition to thyroid tissues, the expression of NIS is found in stomach, prostate, placenta and so on. Radioiodine-concentrating activity in thyroid tissues has allowed the use of radioiodine as a diagnostic and therapeutic agent for patients with thyroid disorders. However, some extrathyroid tissues also take up radioiodine, contributing to unwanted side effects of radioiodine therapy. Now that the molecule of NIS has been cloned and characterized, it may be possible to develop novel strategies to differentially modulate NIS expression and activity, enhancing it in target tissues and impeding it in others. It is also important to explore the use of NIS as an imaging reporter gene to monitor the expression profile of the transgene in transgenic mouse animal models and in patients undergoing gene therapy clinical trials

  18. Determination of major sodium iodide symporter (NIS) inhibitors in drinking waters using ion chromatography with conductivity detector.

    Science.gov (United States)

    Cengiz, Mehmet Fatih; Bilgin, Ayse Kevser

    2016-02-20

    Goiter is an important health problem all over the world and iodine deficiency is its most common cause. Perchlorate, thiocyanate and nitrate (called as major NIS inhibitors) are known to competitively inhibit iodide uptake by the thyroid gland and thus, human exposure to major NIS inhibitors is a public health concern. In this study, an ion chromatographic method for the determination of most common NIS inhibitor ions in drinking waters was developed and validated. This is the first study where an analytical method is used for the determination of major NIS inhibitors in drinking water by an ion chromatography system in a single run. Chromatographic separations were achieved with an anion-exchange column and separated ions were identified by a conductivity detector. The method was found to be selective, linear, precise accurate and true for all of interested ions. The limits of the detections (LOD) were estimated at 0.003, 0.004 and 0.025mgL(-1) for perchlorate, thiocyanate and nitrate, respectively. Possible interference ions in drinking waters were examined for the best separation of NIS inhibitors. The excellent method validation data and proficiency test result (Z-score for nitrate: -0.1) of the FAPAS(®) suggested that the developed method could be applied for determination of NIS inhibitor residues in drinking waters. To evaluate the usefulness of the method, 75 drinking water samples from Antalya/Turkey were analyzed for NIS inhibitors. Perchlorate concentrations in the samples ranged from not detected (less than LOD) to 0.07±0.02mgL(-1) and the range of nitrate concentrations were found to be 3.60±0.01mgL(-1) and 47.42±0.40mgL(-1). No thiocyanate residues were detected in tested drinking water samples. Copyright © 2015 Elsevier B.V. All rights reserved.

  19. The sodium iodide symporter: its implications for imaging and therapy

    International Nuclear Information System (INIS)

    Spitzweg, C.

    2007-01-01

    The sodium iodide symporter (NIS) is an intrinsic plasma membrane glycoprotein that mediates the active transport of iodide in the thyroid gland and a number of extrathyroidal tissues, in particular lactating mammary gland. In addition to its key function in thyroid physiology, NIS-mediated iodide accumulation allows diagnostic thyroid scintigraphy as well as therapeutic radioiodine application in benign and malignant thyroid disease. NIS therefore represents one of the oldest targets for molecular imaging and therapy. Based on the effective administration of radioiodine that has been used for over 60 years in the management of follicular cell-derived thyroid cancer, cloning and characterization of the NIS gene has paved the way for the development of a novel cytoreductive gene therapy strategy based on targeted NIS expression in thyroidal and nonthyroidal cancer cells followed by therapeutic application of 131 I or alternative radionuclides, including 188 Re and 211 At. In addition, the possibility of direct and non-invasive imaging of functional NIS expression by 123 I- and 99m Tc-scintigraphy or 124 I-PET-imaging allows the application of NIS as a novel reporter gene. In conclusion, the dual role of NIS as diagnostic and therapeutic gene and the detection of extra-thyroidal endogenous NIS expression in breast cancer open promising perspectives in nuclear medicine and molecular oncology for diagnostic and therapeutic application of NIS outside the thyroid gland. (orig.)

  20. Sodium iodide symporter: Its role in nuclear oncology

    International Nuclear Information System (INIS)

    Chung, June-Key

    2004-01-01

    Full text: Thyroid iodide uptake is basic to the clinical applications of radioiodine in diagnosis and therapy. Iodide uptake occurs across the membrane of thyroid follicular cells via an active transporter process mediated by the sodium/iodide symporter (NIS). The recent cloning of the gene encoding NIS enabled better characterization of the molecular mechanisms underlying the iodide transport, thus opening the way to clarify and expand its role in medicine. NIS contains 13 transmembrane segments, and its gene encodes a glycoprotein of 643 amino acids. Decreased NIS expression levels account for the reduced iodide uptake in thyroid carcinomas. We found that thyroid cancer patients with positive immunostaining for NIS responded to I-131 therapy better than did the patients with negative immunostaining. Thus, NIS gene can be used for radionuclide gene therapy. Targeted expression of functional NIS in cancer cells would enable these cells to concentrate iodide from plasma and would, therefore, offer the possibility of radioiodine therapy. We and others have shown that gene transfer of NIS into a variety of cell types confers increased radioiodine uptake up to several hundred-fold that of controls. There is great interest in exploring the possibility of NIS gene transfer to facilitate radioiodine therapy for non-thyroidal human cancers including hepatoma, prostate, breast, colon cancers as well as thyroid cancer. Recently, several approaches such as, targeted gene transfer, thyroid peroxidase gene co-transfection, retinoic acid treatment and Re-188 therapy instead of I-131, have been tried to improve this novel gene therapy. Imaging reporter gene is useful in non-invasively determining the location, duration and magnitude of transgene expression in living animal. Conventionally, HSV-tk and dopaminergic receptor (D2R) genes have been presented as possible imaging reporter genes. We proved that NIS could serve as an alternative imaging reporter gene. NIS has many

  1. Alpha-lipoic acid induces sodium iodide symporter expression in TPC-1 thyroid cancer cell line

    International Nuclear Information System (INIS)

    Choi, Hyun-Jeung; Kim, Tae Yong; Ruiz-Llorente, Sergio; Jeon, Min Ji; Han, Ji Min; Kim, Won Gu; Shong, Young Kee; Kim, Won Bae

    2012-01-01

    Introduction: Patients with metastatic thyroid cancers that do not uptake iodine need effective therapeutic option. Differentiation-inducing agents have been tried to restore functional expression of sodium iodide symporter (NIS) without success. Our objective was to assess the effect of alpha-lipoic acid (ALA), known as potential antioxidant, on expression of sodium iodide symporter in thyroid cancer cells. Methods: Human thyroid cancer-derived cell lines, TPC-1, were treated with ALA, and changes in NIS mRNA and protein expression were measured. ALA's effect on NIS gene promoter was evaluated, and functional NIS expression was assessed by iodide uptake assay. Results: Treatment with ALA increased NIS mRNA expression up to ten folds of control dose-dependently after 24 h of exposure. ALA increased NIS promoter activity, and increased iodide uptake by 1.6 fold. ALA induced expression of NIS protein, but had no significant effect on the plasma membrane trafficking. ALA increased phosphorylation of CREB and nuclear translocation of pCREB, and co-treatment of ALA and trichostatin A increased iodide uptake by three folds in TPC-1 cells. Conclusions: ALA is a potential agent to increase NIS transcription in TPC-1. It could be used as an adjunctive agent to increase efficacy of radioiodine therapy if combined with a strategy to increase NIS protein trafficking to cell membrane.

  2. Dynamic iodide trapping by tumor cells expressing the thyroidal sodium iodide symporter

    International Nuclear Information System (INIS)

    Dingli, David; Bergert, Elizabeth R.; Bajzer, Zeljko; O'Connor, Michael K.; Russell, Stephen J.; Morris, John C.

    2004-01-01

    The thyroidal sodium iodide symporter (NIS) in combination with various radioactive isotopes has shown promise as a therapeutic gene in various tumor models. Therapy depends on adequate retention of the isotope in the tumor. We hypothesized that in the absence of iodide organification, isotope trapping is a dynamic process either due to slow efflux or re-uptake of the isotope by cells expressing NIS. Iodide efflux is slower in ARH-77 and K-562 cells expressing NIS compared to a thyroid cell line. Isotope retention half times varied linearly with the number of cells expressing NIS. With sufficient NIS expression, iodide efflux is a zero-order process. Efflux kinetics in the presence or absence of perchlorate also supports the hypothesis that iodide re-uptake occurs and contributes to the retention of the isotope in tumor cells. Iodide organification was insignificant. In vivo studies in tumors composed of mixed cell populations confirmed these observations

  3. Feasibility of dual reporter gene in rat myoblast cell line using human sodium iodide symporter (hNIS) and enhanced green fluorescent protein (EGFP) gene

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Yong Jin; Lee, You La; Ahn, Sohn Joo; Choi, Chang Ik; Lee, Sang Woo; Ahn, Byeong Cheol; Lee, Jae Tae [School of Medicine, Kyungpook National University, Daegu (Korea, Republic of)

    2007-07-01

    To develop a non-invasive combined imaging method of gamma camera and optical imaging to assess rat myoblast cell line, H9c2, we constructed retrovirus containing hNIS and EGFP gene, and transfected to rat myoblast cell and monitored hNIS and EGFP expression. Rat myoblast cell line, H9C2, was transfected with hNIS and EGFP gene using retrovirus (H9C2-NG). The expression of hNIS and EGFP gene was determined by RT-PCR and fluorescence microscopy, respectively. The uptake and efflux of I-125 were measured in the transfected and wild type cell lines. Each cell line was injected to 4 flank sites (H9c2: 1X107 or 2X107, H9C2-NG: 1X107 or 2X107) in nude mouse. Scintigraphic image was performed at 3h, 1 day after H9C2 and H9C2-NG cell inoculation. We performed gamma camera and animal PET imaging to evaluate NIS expression. Also, GFP image obtained using optical imaging system. The expression of hNIS and EGFP gene was confirmed by RT-PCR. In iodide uptake, H9C2-NG cells accumulated 274.52.2 pmol/ mg protein at 30 min. But wild type cell line did not uptake iodide. In fluorescent microscopy, H9C2-NG cells were highly fluorescent than that of H9C2 cells. In iodide efflux study, 50% of radioactivity flowed out during the first 10min. Scintigraphy showed increased uptake of Tc-99m in H9c2-NG than in H9C2 for 1 day. Also, H9C2-NG cells showed high signal-to-background fluorescent spots in animal body. In this study, NIS and EGFP reporter gene were successfully transfected by a retrovirus in myoblast cell line, and the transfected cell can be easily visualized in vivo. These results suggest that NIS and EGFP gene has an excellent feasibility as a reporter gene, and it can be used to monitor cell trafficking for monitoring.

  4. Functional activity of human sodium/iodide symporter in tumor cell lines

    International Nuclear Information System (INIS)

    Petrich, T.; Knapp, W.H.; Poetter, E.

    2003-01-01

    Aim: The sodium/iodide symporter (NIS) actively transports iodide into thyrocytes. Thus, NIS represents a key protein for diagnosis and radioiodine therapy of differentiated thyroid cancer. Additionally, in the future the NIS gene may be used for cancer gene therapy of non-thyroid-derived malignancies. In this study we evaluated the functionality of NIS with respect to iodide uptake in a panel of tumor cell lines and compared this to gene transfer efficiency. Methods: A human NIS-containing expression vector and reporter-gene vectors encoding and beta;-Galactosidase- or EGFP were used for transient transfection of 13 tumor cell lines. Following transfection measurements of NIS-mediated radioiodide uptake using Na 125 I and of transfection efficiency were performed. The latter included β;-Galactosidase activity measurements using a commercial kit and observation by fluorescence microscopy for EGFP expression. Results: In contrast to respective parental cells, most NIS-transfected cell lines displayed high, perchlorate-sensitive radioiodide uptake. Differences in radioiodide uptake between cell lines apparently corresponded to transfection efficiencies, as judged from reporter-gene assays. Conclusion: With respect to iodide uptake we provide evidence that NIS is functional in different cellular context. As iodide uptake capacity appears to be well correlated to gene transfer efficiency, cell type-specific actions on NIS (e. g. post-translational modification such as glycosylation) are not inhibitory to NIS function. Our data support the promising role of NIS in cancer gene therapy strategies. (orig.)

  5. Transfer of the sodium/iodide symporter gene into gliomas for radioiodine therapy in vitro

    International Nuclear Information System (INIS)

    Tan Jian; Li Wei; Liu Xiaohua; Xiao Qian; Jia Qiang; Li Ning

    2008-01-01

    Objective: The most frequent brain tumors are the gliomas. Glioblastomas are largely incurable secondary, to their rapid, aggressive and diffusely infiltrative growth pattern and hypervascularity. This study aimed at investigating the possibility of transecting human sodium/iodide symporter (hNIS) gene into human glioma cell lines to facilitate radioactive iodide treatment in vitro. Methods: Transecting hNIS gene into human glioma cell lines U251 was performed by recombinant expression plasmids with lipofectamine 2000-plasmid complexes. The hNIS gene cell lines with stable expression (hNIS-U251) were selected through G418 antibiotic constraint. The hNIS-U251 gene cell lines were then evaluated for their biologic functions, including 125 I uptake assay, 125 I influx-course, 125 I-efflux-course, 131 I inhibitory effect on cellular proliferation by 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyhe-trazolium bromide (MTT) assay and flow cytometer. Results: We were successful in transecting hNIS gene into human glioma cell lines by recombinant expression plasmids, and were able to obtain hNIS gene cell lines (hNIS-U251) with stable expression. The hNIS-U251 cell lines could intake and bind radioactive iodide by hNIS gene. The uptakes of 125 I were 117 fold higher in hNIS-U251 cell lines than U251 cell lines [(50 469.88 ± 997.29), (432.92 ± 89.28) counts·min -1 , respectively]. And the proliferation index of hNIS-U251 cell lines was lower than U251 cell lines after incubating with 131 I. Conclusion: The hNIS gene with stable gene expression (hNIS- U251) cell lines could be labeled by 131 I with a high efficiency, thereby may function effectively in the treatment of glioma-related brain tumors. (authors)

  6. Expression of sodium/iodide symporter transgene in neural stem cells

    International Nuclear Information System (INIS)

    Kim, Yun Hui; Lee, Dong Soo; Kang, Joo Hyun; Lee, Yong Jin; Chung, June Key; Lee, Myung Chul

    2004-01-01

    The ability to noninvasively track the migration of neural progenitor cells would have significant clinical and research implications. We generated stably transfected F3 human neural progenitor cells with human sodium/iodide symporter (hNIS) for noninvasively tracking F3. In this study, the expression patterns of hNIS gene in F3-NIS were examined according to the cultured time and the epigenetic modulation. F3 human neural stem cells had been obtained from Dr. Seung U. Kim (Ajou University, Suwon, Korea). hNIS and hygromycin resistance gene were linked with IRES (internal Ribosome Entry Site) under control of CMV promoter. This construct was transfected to F3 with Liposome. To investigate the restoration of hNIS gene expression in F3-NIS, cells were treated with demethylating agent (5-Azacytidine) and Histone deacetylase inhibitor (Trichostatin A: TSA). The expression of hNIS was measured by I-125 uptake assay and RT-PCR analysis. The iodide uptake of the F3-NIS was higher 12.86 times than F3 cell line. According to the cell passage number, hNIS expression in F3-NIS gradually diminished. After treatment of 5-Azacytidine and TSA with serial doses (up to 20μM, up to 62.5nM, respectively) for 24 hours, I-125 uptake and mRNA of hNIS in F3-NIS were increased. These results suggest that hNIS transfected F3 might undergo a change in its biological characters by cell passage. Therefore, the gene expression of exogenous gene transferred human stem cell might be affected to the epigenetic modulation such as promoter methylation and Histone deacetylation and to the cell culture conditions

  7. Linking loss of sodium-iodide symporter expression to DNA damage

    International Nuclear Information System (INIS)

    Lyckesvärd, Madeleine Nordén; Kapoor, Nirmal; Ingeson-Carlsson, Camilla; Carlsson, Therese; Karlsson, Jan-Olof; Postgård, Per; Himmelman, Jakob; Forssell-Aronsson, Eva; Hammarsten, Ola; Nilsson, Mikael

    2016-01-01

    Radiotherapy of thyroid cancer with I-131 is abrogated by inherent loss of radioiodine uptake due to loss of sodium iodide symporter (NIS) expression in poorly differentiated tumor cells. It is also known that ionizing radiation per se down-regulates NIS (the stunning effect), but the mechanism is unknown. Here we investigated whether loss of NIS-mediated iodide transport may be elicited by DNA damage. Calicheamicin, a fungal toxin that specifically cleaves double-stranded DNA, induced a full scale DNA damage response mediated by the ataxia-telangiectasia mutated (ATM) kinase in quiescent normal thyrocytes. At sublethal concentrations (<1 nM) calicheamicin blocked NIS mRNA expression and transepithelial iodide transport as stimulated by thyrotropin; loss of function occurred at a much faster rate than after I-131 irradiation. KU-55933, a selective ATM kinase inhibitor, partly rescued NIS expression and iodide transport in DNA-damaged cells. Prolonged ATM inhibition in healthy cells also repressed NIS-mediated iodide transport. ATM-dependent loss of iodide transport was counteracted by IGF-1. Together, these findings indicate that NIS, the major iodide transporter of the thyroid gland, is susceptible to DNA damage involving ATM-mediated mechanisms. This uncovers novel means of poor radioiodine uptake in thyroid cells subjected to extrinsic or intrinsic genotoxic stress. - Highlights: • DNA damage inhibits polarized iodide transport in normal thyroid cells. • Down-regulation of NIS expression is mediated by activation of the ATM kinase. • Long-term ATM inhibition also represses NIS-mediated iodide transport. • IGF-1 rescues NIS expression and iodide transport in DNA-damaged cells.

  8. Linking loss of sodium-iodide symporter expression to DNA damage

    Energy Technology Data Exchange (ETDEWEB)

    Lyckesvärd, Madeleine Nordén [Sahlgrenska Cancer Center, University of Gothenburg, Göteborg (Sweden); Department of Medical Chemistry and Cell Biology, University of Gothenburg, Göteborg (Sweden); Kapoor, Nirmal [Department of Medical Chemistry and Cell Biology, University of Gothenburg, Göteborg (Sweden); Ingeson-Carlsson, Camilla; Carlsson, Therese [Sahlgrenska Cancer Center, University of Gothenburg, Göteborg (Sweden); Department of Medical Chemistry and Cell Biology, University of Gothenburg, Göteborg (Sweden); Karlsson, Jan-Olof [Department of Medical Chemistry and Cell Biology, University of Gothenburg, Göteborg (Sweden); Postgård, Per; Himmelman, Jakob; Forssell-Aronsson, Eva [Department of Radiation Physics, University of Gothenburg, Göteborg (Sweden); Hammarsten, Ola [Department of Clinical Chemistry, University of Gothenburg, Göteborg (Sweden); Nilsson, Mikael, E-mail: mikael.nilsson@gu.se [Sahlgrenska Cancer Center, University of Gothenburg, Göteborg (Sweden); Department of Medical Chemistry and Cell Biology, University of Gothenburg, Göteborg (Sweden)

    2016-05-15

    Radiotherapy of thyroid cancer with I-131 is abrogated by inherent loss of radioiodine uptake due to loss of sodium iodide symporter (NIS) expression in poorly differentiated tumor cells. It is also known that ionizing radiation per se down-regulates NIS (the stunning effect), but the mechanism is unknown. Here we investigated whether loss of NIS-mediated iodide transport may be elicited by DNA damage. Calicheamicin, a fungal toxin that specifically cleaves double-stranded DNA, induced a full scale DNA damage response mediated by the ataxia-telangiectasia mutated (ATM) kinase in quiescent normal thyrocytes. At sublethal concentrations (<1 nM) calicheamicin blocked NIS mRNA expression and transepithelial iodide transport as stimulated by thyrotropin; loss of function occurred at a much faster rate than after I-131 irradiation. KU-55933, a selective ATM kinase inhibitor, partly rescued NIS expression and iodide transport in DNA-damaged cells. Prolonged ATM inhibition in healthy cells also repressed NIS-mediated iodide transport. ATM-dependent loss of iodide transport was counteracted by IGF-1. Together, these findings indicate that NIS, the major iodide transporter of the thyroid gland, is susceptible to DNA damage involving ATM-mediated mechanisms. This uncovers novel means of poor radioiodine uptake in thyroid cells subjected to extrinsic or intrinsic genotoxic stress. - Highlights: • DNA damage inhibits polarized iodide transport in normal thyroid cells. • Down-regulation of NIS expression is mediated by activation of the ATM kinase. • Long-term ATM inhibition also represses NIS-mediated iodide transport. • IGF-1 rescues NIS expression and iodide transport in DNA-damaged cells.

  9. Molecular and structural characterisation of the human sodium/iodide symporter (h N.I.S.) C-terminus and the implication of this domain in the transporter regulation

    International Nuclear Information System (INIS)

    Huc, S.

    2007-12-01

    The human natrium iodide symporter (h N.I.S.) is an intrinsic membrane protein expressed in thyroid cells where it allows iodide uptake and accumulation. It is composed of thirteen transmembrane helices and its ninety- three amino acids long cytosolic C-terminus presents many potential post-translational regulatory sites. A first part of the PhD work has been dedicated to the expression in a bacterial system and to the purification of the cytosolic C-terminal fragment. Biochemical and structural characterisation have revealed that this C-terminus is very flexible but prone to dimerization. The fragment has also been used as a bait to test the interactions with PDZ domain proteins spotted on a membrane. Several proteins interacting with the (natrium/iodide symporter) N.I.S. C-terminus have thus been identified and the study of their implication in the protein regulation has been initiated. A second part of the work has underlined the existence of a N.I.S. fragment co-purified with the entire protein. This fragment has been found in cells in culture stably expressing N.I.S. and also in human thyroid extracts and in rodent thyroid cells. We observed that this fragment is spontaneously associated with the entire protein. It is composed of the last 131 amino acid of the protein and so comprises the last transmembrane domain and the C-terminal extremity. The expression of a truncated form of h N.I.S., lacking the last 131 amino acids, shows that this protein is not correctly addressed to the cell membrane and cells expressing this mutated symporter cannot accumulate iodide. However, our results show that the co-expression of the two N.I.S. parts, the truncated form lacking the last 131 amino acid, and the complementary C-terminal fragment, leads to cells presenting 10 % of the activity of cells expressing the whole N.I.S.. (author)

  10. Mammary radioiodine accumulation due to functional sodium iodide symporter expression in a benign fibroadenoma

    International Nuclear Information System (INIS)

    Berger, F.; Unterholzner, S.; Diebold, J.; Knesewitsch, P.; Hahn, K.; Spitzweg, C.

    2006-01-01

    The sodium iodide symporter (NIS) has been characterized to mediate the active transport of iodide not only in the thyroid gland but also in various non-thyroidal tissues, including lactating mammary gland and the majority of breast cancers, thereby offering the possibility of diagnostic and therapeutic radioiodine application in breast cancer. In this report, we present a 57-year-old patient with multifocal papillary thyroid carcinoma, who showed focal radioiodine accumulation in a lesion in the right breast on a posttherapy 131 I scan following radioiodine therapy. CT and MR-mammography showed a focal solid lesion in the right breast suggestive of a fibroadenoma, which was confirmed by histological examination. Immunostaining of paraffin-embedded tumor tissue sections using a human NIS antibody demonstrated NIS-specific immunoreactivity confined to epithelial cells of mammary ducts. In conclusion, in a thyroid cancer patient we identified a benign fibroadenoma of the breast expressing high levels of functionally active NIS protein as underlying cause of focal mammary radioiodine accumulation on a posttherapy 131 I scan. These data show for the first time that functional NIS expression is not restricted to lactating mammary gland and malignant breast tissue, but can also be detected in benign breast lesions, such as fibroadenomata of the breast

  11. Genetically targeted radiotherapy using the sodium-iodide symporter for treatment of head and neck cancer

    International Nuclear Information System (INIS)

    Gaut, A.W.; Niu, G.; Graham, M.M.; Domann, F.E.; Krager, K.J.

    2003-01-01

    Attempts at using gene therapy for cancer treatment have achieved limited success. Traditional in vivo gene therapy techniques are limited by relatively inefficient gene transfer, with only a small fraction of tumor cells transfected with the gene of interest. Gene therapy strategies yielding substantial bystander cytotoxicity are preferable and could yield significant clinical effect despite a lack of gene transfer to the entire tumor. We report the successful use of such a strategy in head and neck squamous cell carcinoma (HNSCC) cell lines. The sodium iodide symporter (NIS) gene, expressed primarily in the thyroid, is responsible for physiologic iodide accumulation. Expression of NIS in non-thyroid cell lines has been shown to confer iodide-concentrating ability. Using a recombinant adenovirus-NIS construct (Ad-NIS) delivered to HNSCC cell lines, we demonstrate radioiodide accumulation 15- to 30-fold higher than that of cell lines transduced with a control (Ad-Bgl II) adenovirus. Consistent with NIS-mediated uptake, this accumulation is inhibited by treatment with perchlorate. Using a clonogenic cell survival assay, we demonstrate a statistically significant, dose-dependent decrease in cell survival after delivery of Ad-NIS followed by administration of varying doses of I-131. Compared to a control, Ad-Bgl II-treated group, absolute survival was reduced by 80% at the highest dose of I-131 in Ad-NIS-treated cells. We also demonstrate the ability of NIS gene transfer followed by systemic administration of I-131 to dramatically attenuate tumor formation in nude mice. Three weeks after subcutaneous injection of tumor cells, tumors treated with Ad-NIS had decreased in size by 0.7±0.1 mm, whereas control tumors treated with Ad-Bgl II had increased in size by 7.4±1.7 mm. The relative accessibility of head and neck cancers make them attractive targets for gene therapy. Our data demonstrate the feasibility of genetically targeted radiotherapy using the NIS gene as a

  12. Evaluation of transcriptional activity of the oestrogen receptor with sodium iodide symporter as an imaging reporter gene.

    Science.gov (United States)

    Kang, Joo Hyun; Chung, June-Key; Lee, Yong Jin; Kim, Kwang Il; Jeong, Jae Min; Lee, Dong Soo; Lee, Myung Chul

    2006-10-01

    Oestrogen receptors are ligand-dependent transcription factors whose activity is modulated either by oestrogens or by an alternative signalling pathway. Oestrogen receptors interact via a specific DNA-binding domain, the oestrogen responsive element (ERE), in the promoter region of sensitive genes. This binding leads to an initiation of gene expression and hormonal effects. To determine the transcriptional activity of the oestrogen receptor, we developed a molecular imaging system using sodium iodide symporter (NIS) as a reporter gene. The NIS reporter gene was placed under the control of an artificial ERE derived from pERE-TA-SEAP and named as pERE-NIS. pERE-NIS was transferred to MCF-7, human breast cancer cells, which highly expressed oestrogen receptor-alpha with lipofectamine. Stably expressing cells were generated by selection with G418 for 14 days. After treatment of 17beta-oestradiol and tamoxifen with serial doses, the (125)I uptake was measured for the determination of NIS expression. The inhibition of NIS activity was performed with 50 micromol x l(-1) potassium perchlorate. The MCF7/pERE-NIS treated with 17beta-oestradiol accumulated (125)I up to 70-80% higher than did non-treated cells. NIS expression was increased according to increasing doses of 17beta-oestradiol. MCF7/pERE-NIS treated with tamoxifen also accumulated (125)I up to 50% higher than did non-treated cells. Potassium perchlorate completely inhibited (125)I uptake. When MDA-MB231 cells, the oestrogen receptor-negative breast cancer cells, were transfected with pERE-NIS, (125)I uptake of MDA-MB-231/pERE-NIS did not increase. This pERE-NIS reporter system is sufficiently sensitive for monitoring transcriptional activity of the oestrogen receptor. Therefore, cis-enhancer reporter systems with ERE will be applicable to the development of a novel selective oestrogen receptor modulator with low toxicity and high efficacy.

  13. PI3K activation is associated with intracellular sodium/iodide symporter protein expression in breast cancer

    International Nuclear Information System (INIS)

    Knostman, Katherine AB; McCubrey, James A; Morrison, Carl D; Zhang, Zhaoxia; Capen, Charles C; Jhiang, Sissy M

    2007-01-01

    The sodium/iodide symporter (NIS) is a membrane glycoprotein mediating active iodide uptake in the thyroid gland and is the molecular basis for radioiodide imaging and therapeutic ablation of thyroid carcinomas. NIS is expressed in the lactating mammary gland and in many human breast tumors, raising interest in similar use for diagnosis and treatment. However, few human breast tumors have clinically evident iodide uptake ability. We previously identified PI3K signaling as important in NIS upregulation in transgenic mouse models of breast cancer, and the PI3K pathway is commonly activated in human breast cancer. NIS expression, subcellular localization, and function were analyzed in MCF-7 human breast cancer cells and MCF-7 cells stably or transiently expressing PI3K p110alpha subunit using Western blot of whole cell lysate, cell surface biotinylation Western blot and immunofluorescence, and radioiodide uptake assay, respectively. NIS localization was determined in a human breast cancer tissue microarray using immunohistochemical staining (IHC) and was correlated with pre-existing pAkt IHC data. Statistical analysis consisted of Student's t-test (in vitro studies) or Fisher's Exact Test (in vivo correlational studies). In this study, we demonstrate that PI3K activation in MCF-7 human mammary carcinoma cells leads to expression of underglycosylated NIS lacking cell surface trafficking necessary for iodide uptake ability. PI3K activation also appears to interfere with cell surface trafficking of exogenous NIS as well as all-trans retinoic acid-induced endogenous NIS. A correlation between NIS expression and upregulation of PI3K signaling was found in a human breast cancer tissue microarray. Thus, the PI3K pathway likely plays a major role in the discordance between NIS expression and iodide uptake in breast cancer patients. Further study is warranted to realize the application of NIS-mediated radioiodide ablation in breast cancer

  14. Low Iodine in the Follicular Lumen Caused by Cytoplasm Mis-localization of Sodium Iodide Symporter may Induce Nodular Goiter.

    Science.gov (United States)

    Huang, Huibin; Shi, Yaxiong; Liang, Bo; Cai, Huiyao; Cai, Qingyan

    2017-10-01

    Iodine is a key ingredient in the synthesis of thyroid hormones and also a major factor in the regulation of thyroid function. A local reduction of iodine content in follicular lumen leads to overexpression of local thyroid-stimulating hormone receptor (TSHr), which in turn excessively stimulates the regional thyroid tissue, and result in the formation of nodular goiter. In this study, we investigated the relationship between iodine content and sodium iodide symporter (NIS) expression by using the clinical specimens from patients with nodular goiter and explored the pathogenesis triggered by iodine deficiency in nodular goiter. In total, 28 patients were clinically histopathologically confirmed to have nodular goiter and the corresponding adjacent normal thyroid specimens were harvested simultaneously. Western blot and immunohistochemistry were performed to assay NIS expression and localization in thyrocytes of both nodular goiter and adjacent normal thyroid tissues. NIS expression mediated by iodine in follicular lumen was confirmed by follicular model in vitro. Meanwhile, radioscan with iodine-131were conducted on both nodular goiter and adjacent normal thyroid. Our data showed that NIS expression in nodular goiter was significantly higher than that in adjacent normal tissues, which was associated with low iodine in the follicular lumen. Abnormal localization of NIS and lower amount of radioactive iodine-131 were also found in nodular goiter. Our data implied that low iodine in the follicular lumen caused by cytoplasm mis-localization of NIS may induce nodular goiter.

  15. Treatment of medulloblastoma using an oncolytic measles virus encoding the thyroidal sodium iodide symporter shows enhanced efficacy with radioiodine

    International Nuclear Information System (INIS)

    Hutzen, Brian; Pierson, Christopher R; Russell, Stephen J; Galanis, Evanthia; Raffel, Corey; Studebaker, Adam W

    2012-01-01

    Medulloblastoma is the most common malignant brain tumor of childhood. Although the clinical outcome for medulloblastoma patients has improved significantly, children afflicted with the disease frequently suffer from debilitating side effects related to the aggressive nature of currently available therapy. Alternative means for treating medulloblastoma are desperately needed. We have previously shown that oncolytic measles virus (MV) can selectively target and destroy medulloblastoma tumor cells in localized and disseminated models of the disease. MV-NIS, an oncolytic measles virus that encodes the human thyroidal sodium iodide symporter (NIS), has the potential to deliver targeted radiotherapy to the tumor site and promote a localized bystander effect above and beyond that achieved by MV alone. We evaluated the efficacy of MV-NIS against medulloblastoma cells in vitro and examined their ability to incorporate radioiodine at various timepoints, finding peak uptake at 48 hours post infection. The effects of MV-NIS were also evaluated in mouse xenograft models of localized and disseminated medulloblastoma. Athymic nude mice were injected with D283med-Luc medulloblastoma cells in the caudate putamen (localized disease) or right lateral ventricle (disseminated disease) and subsequently treated with MV-NIS. Subsets of these mice were given a dose of 131 I at 24, 48 or 72 hours later. MV-NIS treatment, both by itself and in combination with 131 I, elicited tumor stabilization and regression in the treated mice and significantly extended their survival times. Mice given 131 I were found to concentrate radioiodine at the site of their tumor implantations. In addition, mice with localized tumors that were given 131 I either 24 or 48 hours after MV-NIS treatment exhibited a significant survival advantage over mice given MV-NIS alone. These data suggest MV-NIS plus radioiodine may be a potentially useful therapy for the treatment of medulloblastoma

  16. Treatment of medulloblastoma using an oncolytic measles virus encoding the thyroidal sodium iodide symporter shows enhanced efficacy with radioiodine

    Directory of Open Access Journals (Sweden)

    Hutzen Brian

    2012-11-01

    Full Text Available Abstract Background Medulloblastoma is the most common malignant brain tumor of childhood. Although the clinical outcome for medulloblastoma patients has improved significantly, children afflicted with the disease frequently suffer from debilitating side effects related to the aggressive nature of currently available therapy. Alternative means for treating medulloblastoma are desperately needed. We have previously shown that oncolytic measles virus (MV can selectively target and destroy medulloblastoma tumor cells in localized and disseminated models of the disease. MV-NIS, an oncolytic measles virus that encodes the human thyroidal sodium iodide symporter (NIS, has the potential to deliver targeted radiotherapy to the tumor site and promote a localized bystander effect above and beyond that achieved by MV alone. Methods We evaluated the efficacy of MV-NIS against medulloblastoma cells in vitro and examined their ability to incorporate radioiodine at various timepoints, finding peak uptake at 48 hours post infection. The effects of MV-NIS were also evaluated in mouse xenograft models of localized and disseminated medulloblastoma. Athymic nude mice were injected with D283med-Luc medulloblastoma cells in the caudate putamen (localized disease or right lateral ventricle (disseminated disease and subsequently treated with MV-NIS. Subsets of these mice were given a dose of 131I at 24, 48 or 72 hours later. Results MV-NIS treatment, both by itself and in combination with 131I, elicited tumor stabilization and regression in the treated mice and significantly extended their survival times. Mice given 131I were found to concentrate radioiodine at the site of their tumor implantations. In addition, mice with localized tumors that were given 131I either 24 or 48 hours after MV-NIS treatment exhibited a significant survival advantage over mice given MV-NIS alone. Conclusions These data suggest MV-NIS plus radioiodine may be a potentially useful therapy for

  17. Molecular and structural characterisation of the human sodium/iodide symporter (h N.I.S.) C-terminus and the implication of this domain in the transporter regulation; Caracterisation moleculaire et structurale de l'extremite C-Terminale du co-transporteur sodium/iode humain (h N.I.S.): Implication de ce domaine dans la regulation du transporteur

    Energy Technology Data Exchange (ETDEWEB)

    Huc, S

    2007-12-15

    The human natrium iodide symporter (h N.I.S.) is an intrinsic membrane protein expressed in thyroid cells where it allows iodide uptake and accumulation. It is composed of thirteen transmembrane helices and its ninety- three amino acids long cytosolic C-terminus presents many potential post-translational regulatory sites. A first part of the PhD work has been dedicated to the expression in a bacterial system and to the purification of the cytosolic C-terminal fragment. Biochemical and structural characterisation have revealed that this C-terminus is very flexible but prone to dimerization. The fragment has also been used as a bait to test the interactions with PDZ domain proteins spotted on a membrane. Several proteins interacting with the (natrium/iodide symporter) N.I.S. C-terminus have thus been identified and the study of their implication in the protein regulation has been initiated. A second part of the work has underlined the existence of a N.I.S. fragment co-purified with the entire protein. This fragment has been found in cells in culture stably expressing N.I.S. and also in human thyroid extracts and in rodent thyroid cells. We observed that this fragment is spontaneously associated with the entire protein. It is composed of the last 131 amino acid of the protein and so comprises the last transmembrane domain and the C-terminal extremity. The expression of a truncated form of h N.I.S., lacking the last 131 amino acids, shows that this protein is not correctly addressed to the cell membrane and cells expressing this mutated symporter cannot accumulate iodide. However, our results show that the co-expression of the two N.I.S. parts, the truncated form lacking the last 131 amino acid, and the complementary C-terminal fragment, leads to cells presenting 10 % of the activity of cells expressing the whole N.I.S.. (author)

  18. Imaging of human sodium-iodide symporter gene expression mediated by recombinant adenovirus in skeletal muscle of living rats

    International Nuclear Information System (INIS)

    Yang, Hyun Suk; Park, Seong-Wook; Lee, Heuiran; Kim, Sung Jin; Lee, Won Woo; Yang, You-Jung; Moon, Dae Hyuk

    2004-01-01

    We evaluated the feasibility of non-invasive imaging of recombinant adenovirus-mediated human sodium-iodide symporter (hNIS) gene expression by 99m TcO 4 - scintigraphy in skeletal muscle of rats. Replication-defective recombinant adenovirus encoding hNIS gene [Rad-CMV-hNIS 5 x 10 7 , 2 x 10 8 or 1 x 10 9 plaque forming units (pfu)] or β-galactosidase gene (Rad-CMV-LacZ 1 x 10 9 pfu) was injected into the right biceps femoris muscle of rats (n=5-6 for each group). Three days after gene transfer, scintigraphy was performed using a gamma camera 30 min after injection of 99m TcO 4 - (1.85 MBq). An additional two rats injected with 1 x 10 9 pfu of Rad-CMV-hNIS underwent 99m TcO 4 - scintigraphy with sodium perchlorate. After the imaging studies, rats were sacrificed for assessment of the biodistribution of 99m TcO 4 - and measurement of hNIS mRNA expression. In all the rats injected with 1 x 10 9 pfu of Rad-CMV-hNIS, hNIS expression was successfully imaged by 99m TcO 4 - scintigraphy, while rats injected with Rad-CMV-LacZ or lower doses of Rad-CMV-hNIS failed to show uptake. The biodistribution studies indicated that a significantly different amount of 99m TcO 4 - was retained in the liver (p 9 pfu of Rad-CMV-hNIS. The muscular hNIS mRNA level quantified by real-time reverse transcription-polymerase chain reaction was significantly higher in rats injected with 1 x 10 9 pfu of Rad-CMV-hNIS (p 9 pfu of Rad-CMV-hNIS were specifically inhibited by sodium perchlorate. This study illustrated that 99m TcO 4 - scintigraphy can monitor Rad-CMV-hNIS-mediated gene expression in skeletal muscle of rats, non-invasively and quantitatively. (orig.)

  19. Imaging of human sodium-iodide symporter gene expression mediated by recombinant adenovirus in skeletal muscle of living rats

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Hyun Suk; Park, Seong-Wook [Department of Internal Medicine (Cardiology), Asan Medical Center, University of Ulsan College of Medicine, 388-1 Pungnap-dong, Songpa-gu, 138-736, Seoul (Korea); Lee, Heuiran; Kim, Sung Jin [Department of Microbiology, University of Ulsan College of Medicine, Seoul (Korea); Lee, Won Woo [Department of Nuclear Medicine, Seoul National University Bundang Hospital, Seongnam (Korea); Department of Nuclear Medicine, Asan Medical Center, University of Ulsan College of Medicine, Seoul (Korea); Yang, You-Jung; Moon, Dae Hyuk [Department of Nuclear Medicine, Asan Medical Center, University of Ulsan College of Medicine, Seoul (Korea)

    2004-09-01

    We evaluated the feasibility of non-invasive imaging of recombinant adenovirus-mediated human sodium-iodide symporter (hNIS) gene expression by {sup 99m}TcO{sub 4}{sup -} scintigraphy in skeletal muscle of rats. Replication-defective recombinant adenovirus encoding hNIS gene [Rad-CMV-hNIS 5 x 10{sup 7}, 2 x 10{sup 8} or 1 x 10{sup 9} plaque forming units (pfu)] or {beta}-galactosidase gene (Rad-CMV-LacZ 1 x 10{sup 9} pfu) was injected into the right biceps femoris muscle of rats (n=5-6 for each group). Three days after gene transfer, scintigraphy was performed using a gamma camera 30 min after injection of {sup 99m}TcO{sub 4}{sup -} (1.85 MBq). An additional two rats injected with 1 x 10{sup 9} pfu of Rad-CMV-hNIS underwent {sup 99m}TcO{sub 4}{sup -} scintigraphy with sodium perchlorate. After the imaging studies, rats were sacrificed for assessment of the biodistribution of {sup 99m}TcO{sub 4}{sup -} and measurement of hNIS mRNA expression. In all the rats injected with 1 x 10{sup 9} pfu of Rad-CMV-hNIS, hNIS expression was successfully imaged by {sup 99m}TcO{sub 4}{sup -} scintigraphy, while rats injected with Rad-CMV-LacZ or lower doses of Rad-CMV-hNIS failed to show uptake. The biodistribution studies indicated that a significantly different amount of {sup 99m}TcO{sub 4}{sup -} was retained in the liver (p<0.001) and the right muscle (p<0.05), with the highest uptake in rats injected with 1 x 10{sup 9} pfu of Rad-CMV-hNIS. The muscular hNIS mRNA level quantified by real-time reverse transcription-polymerase chain reaction was significantly higher in rats injected with 1 x 10{sup 9} pfu of Rad-CMV-hNIS (p<0.05), with a positive correlation with the imaging counts (r=0.810, p<0.05) and the biodistribution (r=0.847, p<0.001). Hot spots in rats injected with 1 x 10{sup 9} pfu of Rad-CMV-hNIS were specifically inhibited by sodium perchlorate. This study illustrated that {sup 99m}TcO{sub 4}{sup -} scintigraphy can monitor Rad-CMV-hNIS-mediated gene expression in

  20. In Vivo Imaging of Retinoic Acid Receptor Activity using a Sodium/Iodide Symporter and Luciferase Dual Imaging Reporter Gene

    Directory of Open Access Journals (Sweden)

    Min Kyung So

    2004-07-01

    Full Text Available Retinoic acids are natural derivatives of vitamin A, and play important roles in modulating tumor cell growth by regulating differentiation, thus suggesting the potential use of these derivatives in cancer therapy and prevention. To visualize the intranuclear responses of functional retinoic acid receptors, we have developed a dual-imaging reporter gene system based on the use of sodium/iodide symporter (NIS and luciferase in cancer cell lines. NIS and luciferase genes were linked with an internal ribosome entry site, and placed under the control of an artificial cis-acting retinoic acid responsive element (pRARE/NL. After retinoic acid treatment, I-125 uptake by pRARE/NL transfected cells was found to have increased by up to about five times that of nontreated cells. The bioluminescence intensity of pRARE/NL transfected cells showed dose-dependency. In vivo luciferase images showed higher intensity in retinoic acid treated SK-RARE/NL tumors, and scintigraphic images of SK-RARE/NL tumors showed increased Tc-99m uptake after retinoic acid treatment. The NIS/luciferase imaging reporter system was sufficiently sensitive to allow the visualization of intranuclear retinoic acid receptor activity. This cis-enhancer imaging reporter system may be useful in vitro and in vivo for the evaluation of retinoic acid responses in such areas as cellular differentiation and chemoprevention.

  1. Monitoring of macrophage accumulation in statin-treated atherosclerotic mouse model using sodium iodide symporter imaging system

    International Nuclear Information System (INIS)

    Yoo, Ran Ji; Kim, Min Hwan; Woo, Sang-Keun; Kim, Kwang Il; Lee, Tae Sup; Choi, Yang-Kyu; Kang, Joo Hyun; Lim, Sang Moo; Lee, Yong Jin

    2017-01-01

    Introduction: Macrophages play a key role in atherosclerotic plaque formation in atherosclerosis, but its detailed understanding has poorly investigated until now. Thus, we sought to demonstrate a noninvasive technique for macrophage tracking to atherosclerotic lesions in apolipoprotein E −/− (ApoE −/− ) mice with an imaging system based on sodium iodide symporter (NIS) gene coupled with 99m Tc-single-photon emission computed tomography (SPECT). Methods and results: Macrophage cells (RAW264.7) were stably transduced with retrovirus expressing NIS gene (RAW-NIS). In RAW-NIS cells, uptake of 125 I was higher than the parental cells. [ 18 F]FDG signals in the aorta at 30 weeks on an ApoE −/− mice with high cholesterol diet were higher (1.7 ± 0.12% injected dose (ID)) than those in control group (0.84 ± 0.06% ID). Through 99m Tc-SPECT/computed tomography (CT), in the RAW-NIS cell injected group, the 99m Tc-pertechnetate uptake in aorta was higher than control groups. However, according to atorvastatin treatment, RAW-NIS cell recruitment reduced to the aorta. Area of 99m Tc-pertechnetate uptake was positively correlated with immunostaining results against macrophage antigen (CD68). Cholesterol and low-density lipoprotein levels of atorvastatin-treated group showed lower than those of atorvastatin-untreated group, but did not reach statistical difference. Conclusions: This novel approach to tracking macrophages to atherosclerotic plaques in vivo can be applied for studies of arterosclerotic vascular disease.

  2. The feasibility of using a baculovirus vector to deliver the sodium-iodide symporter gene as a reporter

    Energy Technology Data Exchange (ETDEWEB)

    Zhou Xiang; Li Biao; Wang Jun; Yin Hongyan [Department of Nuclear Medicine, Ruijin Hospital, School of Medicine, Shanghai Jiao Tong University, Shanghai 200025 (China); Zhang Yifan [Department of Nuclear Medicine, Ruijin Hospital, School of Medicine, Shanghai Jiao Tong University, Shanghai 200025 (China)], E-mail: zhangyifan1992@yahoo.com.cn

    2010-04-15

    Purpose: To evaluate the efficiency of baculovirus vectors in transducing FTC-133 cells and to examine the feasibility of using baculovirus vectors for the delivery of the sodium-iodide symporter (NIS) gene as a reporter through co-transduction to monitor the expression of the target gene. Method: Two recombinant baculoviruses were constructed to express NIS and green fluorescent protein (GFP) respectively. FTC-133, 8050C, SW1116, A549 cells, were infected with Bac-GFP. The infection efficiency of Bac-GFP and the intensity of fluorescence, in either the presence or absence of sodium butyrate, were monitored by flow cytometry. The iodine uptake by FTC-133 cells infected with Bac-NIS was measured using a {gamma} counter. FTC-133 cells were infected with a mixture of equal amounts of Bac-NIS and Bac-GFP at different setting of multiplicity of infection (MOI). The changes of GFP fluorescence intensity and iodine uptake were monitored 24 h after infection in the coinfected cells. Results: We have successfully constructed recombinant baculoviruses carrying NIS and GFP under the control of the cytomegalovirus IE-1 promoter. We found that transduced efficiency of baculovirus in 8505C, SW1116, A549 cells are low in absence of sodium butyrate. Yet Bac-GFP infects FTC-133 cells at a high efficiency, 77.67%, 85.57% and 93.23% with MOI of 100, 200 and 400, respectively. The fluorescence intensity of the Bac-GFP infected tumor cells correlated positively with the MOI of the virus. Sodium butyrate induction increased both the infection efficiency and the fluorescence intensity, but increase of infection efficiency was insignificant in FTC-133 cells. Reporter gene (GFP) expression in FTC-133 is stable within 7 days after infection. The radioactivity incorporated by the tumor cells infected with Bac-NIS correlated positively with the MOI of Bac-NIS as well. In tumor cells co-infected with Bac-NIS and Bac-GFP, the amount of radioactivity incorporated significantly correlated with

  3. The effect of tanespimycin (17-AAG) on radioiodine accumulation in sodium iodide symporter expressing cells

    International Nuclear Information System (INIS)

    Yu, Kyoung Hyun; Youn, Hyewon; Song, Myung Geun; Lee, Dong Soo; Chung, June Key

    2012-01-01

    The heat shock protein 90 inhibitor, tanespimycin, is an anticancer agent known to increase iodine accumulation in normal and cancerous thyroid cells. Iodine accumulation is regulated by membrane proteins such as sodium iodide sym porter (NIS) and pendrin (PDS), and thus we attempted to characterize the effects of tanespimycin on those genes. Cells were incubated with tanespimycin in order to evaluate 125 I accumulation and efflux ability. Radioiodine uptake and efflux were measured by a gamma counter and normalized by protein amount. RT PCR were performed to measure the level of gene expression. After tanespimycin treatment, 125 uptake was in creased by ∼2.5 fold in FRTL 5, hNIS ARO. and hNIS MDA MB 231 cells, but no changes were detected in the hNIS HeLa cells. Tanespimycin significantly reduced the radioiodine efflux rate only in the FRTL 5 cell. in the FRTL 5 and hNIS ARO cells, PDS mRNA levels were markedly reduced; the only other observed alteration in the levels of NIS mRNA after tanespimtycin treatment was an observed increase in the h hNIS ARO cells. These results indicate that cellular responses against tanespimycin treatment differed between the normal rat thyroid cells and human cancer cells, and the reduction in the 125I efflux rate by tanespimycin in the normal rat thyroid cells might be attributable to reduced PDS gene expression

  4. Sterol regulatory element-binding proteins are regulators of the sodium/iodide symporter in mammary epithelial cells.

    Science.gov (United States)

    Wen, G; Pachner, L I; Gessner, D K; Eder, K; Ringseis, R

    2016-11-01

    The sodium/iodide symporter (NIS), which is essential for iodide concentration in the thyroid, is reported to be transcriptionally regulated by sterol regulatory element-binding proteins (SREBP) in rat FRTL-5 thyrocytes. The SREBP are strongly activated after parturition and throughout lactation in the mammary gland of cattle and are important for mammary epithelial cell synthesis of milk lipids. In this study, we tested the hypothesis that the NIS gene is regulated also by SREBP in mammary epithelial cells, in which NIS is functionally expressed during lactation. Regulation of NIS expression and iodide uptake was investigated by means of inhibition, silencing, and overexpression of SREBP and by reporter gene and DNA-binding assays. As a mammary epithelial cell model, the human MCF-7 cell line, a breast adenocarcinoma cell line, which shows inducible expression of NIS by all-trans retinoic acid (ATRA), and unlike bovine mammary epithelial cells, is widely used to investigate the regulation of mammary gland NIS and NIS-specific iodide uptake, was used. Inhibition of SREBP maturation by treatment with 25-hydroxycholesterol (5 µM) for 48h reduced ATRA (1 µM)-induced mRNA concentration of NIS and iodide uptake in MCF-7 cells by approximately 20%. Knockdown of SREBP-1c and SREBP-2 by RNA interference decreased the mRNA and protein concentration of NIS by 30 to 50% 48h after initiating knockdown, whereas overexpression of nuclear SREBP (nSREBP)-1c and nSREBP-2 increased the expression of NIS in MCF-7 cells by 45 to 60%, respectively, 48h after initiating overexpression. Reporter gene experiments with varying length of NIS promoter reporter constructs revealed that the NIS 5'-flanking region is activated by nSREBP-1c and nSREBP-2 approximately 1.5- and 4.5-fold, respectively, and activation involves a SREBP-binding motif (SRE) at -38 relative to the transcription start site of the NIS gene. Gel shift assays using oligonucleotides spanning either the wild-type or the

  5. Small-molecule inhibitors of sodium iodide sym-porter function

    International Nuclear Information System (INIS)

    Lecat-Guillet, N.; Merer, G.; Lopez, R.; Rousseau, B.; Ambroise, Y.; Pourcher, T.

    2008-01-01

    The Na + /l - sym-porter (NIS) mediates iodide uptake into thyroid follicular cells. Although NIS has been cloned and thoroughly studied at the molecular level, the biochemical processes involved in post-translational regulation of NIS are still unknown. The purpose of this study was to identify and characterize inhibitors of NIS function. These small organic molecules represent a starting point in the identification of pharmacological tools for the characterization of NIS trafficking and activation mechanisms. screening of a collection of 17020 drug-like compounds revealed new chemical inhibitors with potencies down to 40 nM. Fluorescence measurement of membrane potential indicates that these inhibitors do not act by disrupting the sodium gradient. They allow immediate and total iodide discharge from preloaded cells in accord with a specific modification of NIS activity, probably through distinct mechanisms. (authors)

  6. Small-molecule inhibitors of sodium iodide sym-porter function

    Energy Technology Data Exchange (ETDEWEB)

    Lecat-Guillet, N.; Merer, G.; Lopez, R.; Rousseau, B.; Ambroise, Y. [CEA, DSV, Dept Bioorgan Chem et Isotop Labelling, Inst Biol et Biotechnol iBiTecS, F-91191 Gif Sur Yvette (France); Pourcher, T. [Univ Nice Sophia Antipolis, Dept Biochem et Nucl Toxicol, F-06107 Nice (France)

    2008-07-01

    The Na{sup +}/l{sup -} sym-porter (NIS) mediates iodide uptake into thyroid follicular cells. Although NIS has been cloned and thoroughly studied at the molecular level, the biochemical processes involved in post-translational regulation of NIS are still unknown. The purpose of this study was to identify and characterize inhibitors of NIS function. These small organic molecules represent a starting point in the identification of pharmacological tools for the characterization of NIS trafficking and activation mechanisms. screening of a collection of 17020 drug-like compounds revealed new chemical inhibitors with potencies down to 40 nM. Fluorescence measurement of membrane potential indicates that these inhibitors do not act by disrupting the sodium gradient. They allow immediate and total iodide discharge from preloaded cells in accord with a specific modification of NIS activity, probably through distinct mechanisms. (authors)

  7. Feasibility of sodium/iodide symporter gene as a new imaging reporter gene: comparison with HSV1-tk

    International Nuclear Information System (INIS)

    Shin, Jae Hoon; Chung, June-Key; Lee, Yong Jin; Kim, Kwang Il; Kang, Joo Hyun; Jeong, Jae Min; Lee, Dong Soo; Kim, Chul Woo; Lee, Myung Chul

    2004-01-01

    Positron emission tomography (PET) imaging reporter genes, such as HSV1-tk and D 2 receptor genes, make it possible to visualise gene expression non-invasively and repetitively in vivo. However, these systems require the synthesis of complicated substrates and the availability of expensive PET equipment. Expression of the sodium/iodide symporter (NIS) gene can be easily monitored with radioiodines and technetium-99m using a gamma camera. To evaluate the possibility of using NIS as an imaging reporter gene, we compared its characteristics with those of the conventional HSV1-tk gene. The CM cell line was made by transfecting the HSV1-tk gene into CT-26 (mouse colon carcinoma cell line). The CTN and CMN cell lines were then made by transfecting the NIS gene into CT-26 and CM. We measured the uptake of iodine-125 iodovinyldeoxyuridine ([ 125 I]IVDU) and 125 I to evaluate the expression of the HSV1-tk and NIS genes, respectively. Each cell line was injected into four flank sites in Balb/c mice. The biodistribution study was performed after intravenously injecting [ 125 I]IVDU and 131 I, and 131 I scintigraphy was performed for the evaluation of NIS expression. In vitro studies indicated that CTN and CMN had 40- to 79-fold and 150- to 256-fold higher uptake of 125 I than CT-26 and CM, respectively. Furthermore, CM and CMN showed 57- to 69-fold higher uptake of [ 125 I]IVDU than CT-26 and CTN. NIS gene expression and 125 I accumulation were found to be directly correlated (R 2 =0.923), as were HSV1-tk gene expression and [ 125 I]IVDU accumulation (R 2 =0.956). Calculated signal per unit NIS and HSV1-tk mRNA expression was 23,240±3,755 cpm and 34,039±5,346 cpm, respectively. In vivo study indicated that CTN and CMN had 2.3- and 5.8-fold higher uptake of 131 I than CT-26 and CM, and 1.8- and 3.5-fold higher uptake of [ 125 I]IVDU than CT-26 and CTN. Scintigraphy using 131 I easily visualised CTN and CMN tumours. In conclusion, the NIS gene may be viewed as an imaging

  8. Evaluation of Lentiviral-Mediated Expression of Sodium Iodide Symporter in Anaplastic Thyroid Cancer and the Efficacy of In Vivo Imaging and Therapy

    Directory of Open Access Journals (Sweden)

    Chien-Chih Ke

    2011-01-01

    Full Text Available Anaplastic thyroid carcinoma (ATC is one of the most deadly cancers. With intensive multimodalities of treatment, the survival remains low. ATC is not sensitive to 131I therapy due to loss of sodium iodide symporter (NIS gene expression. We have previously generated a stable human NIS-expressing ATC cell line, ARO, and the ability of iodide accumulation was restored. To make NIS-mediated gene therapy more applicable, this study aimed to establish a lentiviral system for transferring hNIS gene to cells and to evaluate the efficacy of in vitro and in vivo radioiodide accumulation for imaging and therapy. Lentivirus containing hNIS cDNA were produced to transduce ARO cells which do not concentrate iodide. Gene expression, cell function, radioiodide imaging and treatment were evaluated in vitro and in vivo. Results showed that the transduced cells were restored to express hNIS and accumulated higher amount of radioiodide than parental cells. Therapeutic dose of 131I effectively inhibited the tumor growth derived from transduced cells as compared to saline-treated mice. Our results suggest that the lentiviral system efficiently transferred and expressed hNIS gene in ATC cells. The transduced cells showed a promising result of tumor imaging and therapy.

  9. Congenital Hypothyroidism Caused by a PAX8 Gene Mutation Manifested as Sodium/Iodide Symporter Gene Defect

    Directory of Open Access Journals (Sweden)

    Wakako Jo

    2010-01-01

    Full Text Available Loss-of-function mutations of the PAX8 gene are considered to mainly cause congenital hypothyroidism (CH due to thyroid hypoplasia. However, some patients with PAX8 mutation have demonstrated a normal-sized thyroid gland. Here we report a CH patient caused by a PAX8 mutation, which manifested as iodide transport defect (ITD. Hypothyroidism was detected by neonatal screening and L-thyroxine replacement was started immediately. Although 123I scintigraphy at 5 years of age showed that the thyroid gland was in the normal position and of small size, his iodide trapping was low. The ratio of the saliva/plasma radioactive iodide was low. He did not have goiter; however laboratory findings suggested that he had partial ITD. Gene analyses showed that the sodium/iodide symporter (NIS gene was normal; instead, a mutation in the PAX8 gene causing R31H substitution was identified. The present report demonstrates that individuals with defective PAX8 can have partial ITD, and thus genetic analysis is useful for differential diagnosis.

  10. 1,25-(OH)2-vitamin D3 enhances the cytotoxic effect of radioiodine therapy in prostate cancer cells expressing the sodium iodide symporter

    International Nuclear Information System (INIS)

    Spitzweg, Christine; Hirschmann, Martin; Unterholzner, Stefanie; Cengic, Neziha; Eckel, Petra; Sharif-Samani, Bibi-Rana; Willhauck, Michael J.; Goeke, Burkhard; Morris, John C.

    2005-01-01

    Full text: We reported recently the induction of androgen-dependent iodide uptake activity in human prostate cancer cells (LNCaP) utilizing a prostate-specific antigen (PSA)-promoter directed expression of the sodium iodide symporter (NIS) gene. This offers the potential to treat prostate cancer with radioiodine. In the current study we examined the regulation of PSA-promoter directed NIS expression and therapeutic effectiveness of 131 I in LNCaP cells by 1,25-(OH)2-Vitamin D3 (Vit D3). For this purpose, NIS mRNA and protein expression levels in the NIS-transfected LNCaP cell line NP-1 were examined by Northern and Western blot analysis following incubation with Vit D3 (10 -9 M - 10 -5 M) in the presence of mibolerone (10 -9 M). In addition, NIS functional activity was measured by iodide uptake assay, and in vitro cytotoxicity of 131 I was examined by in vitro clonogenic assay. Following incubation with Vit D3, NIS mRNA levels in NP-1 cells were stimulated 1.2-fold, whereas NIS protein levels increased 1.65-fold and iodide accumulation was stimulated 1.4-fold in a concentration-dependent manner. Further, the selective killing effect of 131 I in NP-1 cells was significantly increased from 55% in NP-1 cells incubated with mibolerone alone to 86 % in NP-1 cells treated with Vit D3 (10 -5 M) in the presence of mibolerone. In the absence of androgen, with or without Vit D3 no functional NIS expression was detected. Conclusion: Treatment with Vit D3 increases androgen-induced NIS expression levels and selective killing effect of 131 I in prostate cancer cells stably expressing NIS under the control of the PSA promoter. Vit D3 may therefore be used to enhance the therapeutic response to radioiodine in prostate cancer cells following PSA-promoter directed NIS gene delivery. (author)

  11. Synthesis and biological evaluation of [18F]tetrafluoroborate: a PET imaging agent for thyroid disease and reporter gene imaging of the sodium/iodide symporter

    International Nuclear Information System (INIS)

    Jauregui-Osoro, Maite; Sunassee, Kavitha; Weeks, Amanda J.; Berry, David J.; Paul, Rowena L.; Cleij, Marcel; O'Doherty, Michael J.; Marsden, Paul K.; Szanda, Istvan; Blower, Philip J.; Banga, Jasvinder Paul; Clarke, Susan E.M.; Ballinger, James R.; Cheng, Sheue-Yann

    2010-01-01

    The human sodium/iodide symporter (hNIS) is a well-established target in thyroid disease and reporter gene imaging using gamma emitters 123 I-iodide, 131 I-iodide and 99m Tc-pertechnetate. However, no PET imaging agent is routinely available. The aim of this study was to prepare and evaluate 18 F-labelled tetrafluoroborate ([ 18 F]TFB) for PET imaging of hNIS. [ 18 F]TFB was prepared by isotopic exchange of BF 4 - with [ 18 F]fluoride in hot hydrochloric acid and purified using an alumina column. Its identity, purity and stability in serum were determined by HPLC, thin-layer chromatography (TLC) and mass spectrometry. Its interaction with NIS was assessed in vitro using FRTL-5 rat thyroid cells, with and without stimulation by thyroid-stimulating hormone (TSH), in the presence and absence of perchlorate. Biodistribution and PET imaging studies were performed using BALB/c mice, with and without perchlorate inhibition. [ 18 F]TFB was readily prepared with specific activity of 10 GBq/mg. It showed rapid accumulation in FRTL-5 cells that was stimulated by TSH and inhibited by perchlorate, and rapid specific accumulation in vivo in thyroid (SUV = 72 after 1 h) and stomach that was inhibited 95% by perchlorate. [ 18 F]TFB is an easily prepared PET imaging agent for rodent NIS and should be evaluated for hNIS PET imaging in humans. (orig.)

  12. In vitro radionuclide therapy and in vivo scintigraphic imaging of alpha fetoprotein producing hepatocellular carcinoma by targeted sodium iodide symporter gene expression

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Kwang Il; Lee, Yong Jin; Lee, Tae Sup; Song, Inho; Cheon, Gi Jeong; Lim, Sang Moo; Kang, Joo Hyun [Korea Institute of Radiological and Medical and Medical Sciences, Seoul (Korea, Republic of); Chung, June Key [Seoul National Univ. College of Medicine, Seoul (Korea, Republic of)

    2012-03-15

    This study aimed to develop a gene expression targeting method for specific imaging and therapy of alpha fetoprotein (AFP) producing hepatocellular carcinoma (HCC) cells, using an adenovirus vector containing the human sodium/iodide symporter (hNIS) gene driven by an AFP enhancer/promoter. The recombinant adenovirus vector, AdAFPhNIS (containing the hNIS gene driven by human AFP enhancer/promoter) was prepared. After in vitro infection by the adenovirus, hNIS gene expression in AFP producing cells and in AFP nonproducing cells was investigated using {sup 125}I uptake assay and semi quantitative reverse transcription polymerase chain reaction (RT-PCR). The killing effect of {sup 131}I vitro clonogenic assay. In addition, tumor bearing mice were intravenously injected with the adenovirus, and scintigraphic images were obtained. The expression of hNIS was efficiently demonstrated by {sup 125}I uptake assay in AFP producing cells, but not in AFP nonproducing cells. AFP producing HCC targeted gene expression was confirmed at the mRNA level. Furthermore, in vitro clonogenic assay showed that hNIS gene expression induced by AdAFPhNIS infection in AFP producing cells caused more sensitivity to {sup 131}I than that in AFP nonproducing cells. Injected intravenously in HuH-7 tumor xenografts mice by adenovirus, the functional hNIS gene expression was confirmed in tumor by in vivo scintigraphic imaging. An AFP producing HCC was targeted with an adenovirus vector containing the hNIS gene using the AFP enhancer/promoter in vitro and in vivo. These findings demonstrate that AFP producing HCC specific molecular imaging and radionuclide gene therapy are feasible using this recombinant adenovirus vector system.

  13. In vitro radionuclide therapy and in vivo scintigraphic imaging of alpha fetoprotein producing hepatocellular carcinoma by targeted sodium iodide symporter gene expression

    International Nuclear Information System (INIS)

    Kim, Kwang Il; Lee, Yong Jin; Lee, Tae Sup; Song, Inho; Cheon, Gi Jeong; Lim, Sang Moo; Kang, Joo Hyun; Chung, June Key

    2012-01-01

    This study aimed to develop a gene expression targeting method for specific imaging and therapy of alpha fetoprotein (AFP) producing hepatocellular carcinoma (HCC) cells, using an adenovirus vector containing the human sodium/iodide symporter (hNIS) gene driven by an AFP enhancer/promoter. The recombinant adenovirus vector, AdAFPhNIS (containing the hNIS gene driven by human AFP enhancer/promoter) was prepared. After in vitro infection by the adenovirus, hNIS gene expression in AFP producing cells and in AFP nonproducing cells was investigated using 125 I uptake assay and semi quantitative reverse transcription polymerase chain reaction (RT-PCR). The killing effect of 131 I vitro clonogenic assay. In addition, tumor bearing mice were intravenously injected with the adenovirus, and scintigraphic images were obtained. The expression of hNIS was efficiently demonstrated by 125 I uptake assay in AFP producing cells, but not in AFP nonproducing cells. AFP producing HCC targeted gene expression was confirmed at the mRNA level. Furthermore, in vitro clonogenic assay showed that hNIS gene expression induced by AdAFPhNIS infection in AFP producing cells caused more sensitivity to 131 I than that in AFP nonproducing cells. Injected intravenously in HuH-7 tumor xenografts mice by adenovirus, the functional hNIS gene expression was confirmed in tumor by in vivo scintigraphic imaging. An AFP producing HCC was targeted with an adenovirus vector containing the hNIS gene using the AFP enhancer/promoter in vitro and in vivo. These findings demonstrate that AFP producing HCC specific molecular imaging and radionuclide gene therapy are feasible using this recombinant adenovirus vector system

  14. The iodide sym-porter (NIS): new perspectives in nuclear oncology

    International Nuclear Information System (INIS)

    Pourcher, Th.; Lindenthal, S.; Basquin, C.; Ferhat, O.; Marsault, R.; Carrier, P.; Koulibaly, M.; Bussiere, F.; Darcourt, J.

    2005-01-01

    The sodium iodide sym-porter (NIS) is the plasma membrane protein that mediates uptake of iodide in the thyroid and other organs such as the stomach and the salivary gland. The cloning of its cDNA allows the targeting of NIS expression into any cell using gene therapy. This enables iodide uptake and thus NIS can be used as reporter imaging for live animals. More intriguingly, this new technique has potential using radio-iodide therapy to selectively destroy tumour cells. These two approaches employ common techniques in nuclear medicine. Many experiments on cultured cells and on animals have been carried out; they established clearly the advantages of this genetically targeted radiotherapy. Recent studies employing this therapy on multiple myeloma cell lines implanted in mice or on hepato-carcinoma-bearing rats, resulted in important tumour remission. However, additional studies on NIS regulation and the use of alternative radioisotopes transported by NIS are required to further develop this promising approach. (author)

  15. Imaging characteristics, tissue distribution, and spread of a novel oncolytic vaccinia virus carrying the human sodium iodide symporter.

    Directory of Open Access Journals (Sweden)

    Dana Haddad

    Full Text Available INTRODUCTION: Oncolytic viruses show promise for treating cancer. However, to assess therapy and potential toxicity, a noninvasive imaging modality is needed. This study aims to determine the in vivo biodistribution, and imaging and timing characteristics of a vaccinia virus, GLV-1h153, encoding the human sodium iodide symporter (hNIS. METHODS: GLV-1h153 was modified from GLV-1h68 to encode the hNIS gene. Timing of cellular uptake of radioiodide (131I in human pancreatic carcinoma cells PANC-1 was assessed using radiouptake assays. Viral biodistribution was determined in nude mice bearing PANC-1 xenografts, and infection in tumors confirmed histologically and optically via Green Fluorescent Protein (GFP and bioluminescence. Timing characteristics of enhanced radiouptake in xenografts were assessed via (124I-positron emission tomography (PET. Detection of systemic administration of virus was investigated with both (124I-PET and 99m-technecium gamma-scintigraphy. RESULTS: GLV-1h153 successfully facilitated time-dependent intracellular uptake of (131I in PANC-1 cells with a maximum uptake at 24 hours postinfection (P<0.05. In vivo, biodistribution profiles revealed persistence of virus in tumors 5 weeks postinjection at 10(9 plaque-forming unit (PFU/gm tissue, with the virus mainly cleared from all other major organs. Tumor infection by GLV-1h153 was confirmed via optical imaging and histology. GLV-1h153 facilitated imaging virus replication in tumors via PET even at 8 hours post radiotracer injection, with a mean %ID/gm of 3.82 ± 0.46 (P<0.05 2 days after intratumoral administration of virus, confirmed via tissue radiouptake assays. One week post systemic administration, GLV-1h153-infected tumors were detected via (124I-PET and 99m-technecium-scintigraphy. CONCLUSION: GLV-1h153 is a promising oncolytic agent against pancreatic cancer with a promising biosafety profile. GLV-1h153 facilitated time-dependent hNIS-specific radiouptake in pancreatic

  16. High-Throughput Screening and Quantitative Chemical Ranking for Sodium-Iodide Symporter Inhibitors in ToxCast Phase I Chemical Library.

    Science.gov (United States)

    Wang, Jun; Hallinger, Daniel R; Murr, Ashley S; Buckalew, Angela R; Simmons, Steven O; Laws, Susan C; Stoker, Tammy E

    2018-05-01

    Thyroid uptake of iodide via the sodium-iodide symporter (NIS) is the first step in the biosynthesis of thyroid hormones that are critical for health and development in humans and wildlife. Despite having long been a known target of endocrine disrupting chemicals such as perchlorate, information regarding NIS inhibition activity is still unavailable for the vast majority of environmental chemicals. This study applied a previously validated high-throughput approach to screen for NIS inhibitors in the ToxCast phase I library, representing 293 important environmental chemicals. Here 310 blinded samples were screened in a tiered-approach using an initial single-concentration (100 μM) radioactive-iodide uptake (RAIU) assay, followed by 169 samples further evaluated in multi-concentration (0.001 μM-100 μM) testing in parallel RAIU and cell viability assays. A novel chemical ranking system that incorporates multi-concentration RAIU and cytotoxicity responses was also developed as a standardized method for chemical prioritization in current and future screenings. Representative chemical responses and thyroid effects of high-ranking chemicals are further discussed. This study significantly expands current knowledge of NIS inhibition potential in environmental chemicals and provides critical support to U.S. EPA's Endocrine Disruptor Screening Program (EDSP) initiative to expand coverage of thyroid molecular targets, as well as the development of thyroid adverse outcome pathways (AOPs).

  17. Sodium Iodide Symporter PET and BLI Noninvasively Reveal Mesoangioblast Survival in Dystrophic Mice

    Directory of Open Access Journals (Sweden)

    Bryan Holvoet

    2015-12-01

    Full Text Available Muscular dystrophies are a heterogeneous group of myopathies, characterized by muscle weakness and degeneration, without curative treatment. Mesoangioblasts (MABs have been proposed as a potential regenerative therapy. To improve our understanding of the in vivo behavior of MABs and the effect of different immunosuppressive therapies, like cyclosporine A or co-stimulation-adhesion blockade therapy, on cell survival noninvasive cell monitoring is required. Therefore, cells were transduced with a lentiviral vector encoding firefly luciferase (Fluc and the human sodium iodide transporter (hNIS to allow cell monitoring via bioluminescence imaging (BLI and small-animal positron emission tomography (PET. Non-H2 matched mMABs were injected in the femoral artery of dystrophic mice and were clearly visible via small-animal PET and BLI. Based on noninvasive imaging data, we were able to show that co-stim was clearly superior to CsA in reducing cell rejection and this was mediated via a reduction in cytotoxic T cells and upregulation of regulatory T cells.

  18. Insertion of the human sodium iodide symporter to facilitate deep tissue imaging does not alter oncolytic or replication capability of a novel vaccinia virus

    Directory of Open Access Journals (Sweden)

    Mittra Arjun

    2011-03-01

    Full Text Available Abstract Introduction Oncolytic viruses show promise for treating cancer. However, to assess therapeutic efficacy and potential toxicity, a noninvasive imaging modality is needed. This study aimed to determine if insertion of the human sodium iodide symporter (hNIS cDNA as a marker for non-invasive imaging of virotherapy alters the replication and oncolytic capability of a novel vaccinia virus, GLV-1h153. Methods GLV-1h153 was modified from parental vaccinia virus GLV-1h68 to carry hNIS via homologous recombination. GLV-1h153 was tested against human pancreatic cancer cell line PANC-1 for replication via viral plaque assays and flow cytometry. Expression and transportation of hNIS in infected cells was evaluated using Westernblot and immunofluorescence. Intracellular uptake of radioiodide was assessed using radiouptake assays. Viral cytotoxicity and tumor regression of treated PANC-1tumor xenografts in nude mice was also determined. Finally, tumor radiouptake in xenografts was assessed via positron emission tomography (PET utilizing carrier-free 124I radiotracer. Results GLV-1h153 infected, replicated within, and killed PANC-1 cells as efficiently as GLV-1h68. GLV-1h153 provided dose-dependent levels of hNIS expression in infected cells. Immunofluorescence detected transport of the protein to the cell membrane prior to cell lysis, enhancing hNIS-specific radiouptake (P In vivo, GLV-1h153 was as safe and effective as GLV-1h68 in regressing pancreatic cancer xenografts (P 124I-PET. Conclusion Insertion of the hNIS gene does not hinder replication or oncolytic capability of GLV-1h153, rendering this novel virus a promising new candidate for the noninvasive imaging and tracking of oncolytic viral therapy.

  19. Radiochemotherapy of hepatocarcinoma via lentivirus-mediated transfer of human sodium iodide symporter gene and herpes simplex virus thymidine kinase gene

    Energy Technology Data Exchange (ETDEWEB)

    Chen Libo, E-mail: libochen888@hotmail.com [Department of Nuclear Medicine, Shanghai Sixth People' s Hospital, Shanghai Jiao Tong University, Shanghai 200233 (China); Guo Guoying [Xinyuan Institute of Medicine and Biotechnology, School of Life Sciences, Zhejiang Sci-Tech University, Hangzhou 310018 (China); Liu Tianjing; Guo Lihe [Division of Biochemistry and Cell Biology, Shanghai Institute for Biological Sciences, Chinese Academy of Sciences, Shanghai 200031 (China); Zhu Ruisen [Department of Nuclear Medicine, Shanghai Sixth People' s Hospital, Shanghai Jiao Tong University, Shanghai 200233 (China)

    2011-07-15

    Herpes simplex virus thymidine kinase (HSV-TK) gene/ganciclovir (GCV) system has been widely used as a traditional gene therapy modality, and the sodium/iodide symporter gene (NIS) has been found to be a novel therapeutic gene. Since the therapeutic effects of radioiodine therapy or prodrug chemotherapy on cancers following NIS or HSV-TK gene transfer need to be enhanced, this study was designed to investigate the feasibility of radiochemotherapy for hepatocarcinoma via coexpression of NIS gene and HSV-TK gene. Methods: HepG2 cells were stably transfected with NIS, TK and GFP gene via recombinant lentiviral vector and named HepG2/NTG. Gene expression was examined by reverse transcriptase polymerase chain reaction, fluorescence imaging and iodide uptake. The therapeutic effects were assessed by MTT assay and clonogenic assay. Results: HepG2/NTG cells concentrated {sup 125}I{sup -} up to 76-fold higher than the wild-type cells within 20 min, and the efflux happened with a T{sub 1/2eff} of less than 10 min. The iodide uptake in HepG2/NTG cells was specifically inhibited by sodium perchlorate. Dose-dependent toxicity to HepG2/NTG cells by either GCV or {sup 131}I was revealed by clonogenic assay and MTT assay, respectively. The survival rate of HepG2/NTG cells decreased to 49.7%{+-}2.5%, 43.4%{+-}2.8% and 8.6%{+-}1.2% after exposure to {sup 131}I, GCV and combined therapy, respectively. Conclusion: We demonstrate that radiochemotherapy of hepatocarcinoma via lentiviral-mediated coexpression of NIS gene and HSV-TK gene leads to stronger killing effect than single treatment, and in vivo studies are needed to verify these findings.

  20. Synthesis and biological evaluation of [{sup 18}F]tetrafluoroborate: a PET imaging agent for thyroid disease and reporter gene imaging of the sodium/iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Jauregui-Osoro, Maite; Sunassee, Kavitha; Weeks, Amanda J.; Berry, David J.; Paul, Rowena L.; Cleij, Marcel; O' Doherty, Michael J.; Marsden, Paul K.; Szanda, Istvan; Blower, Philip J. [King' s College London, Division of Imaging Sciences, London (United Kingdom); Banga, Jasvinder Paul [King' s College London, Division of Cell and Gene Based Therapy, London (United Kingdom); Clarke, Susan E.M.; Ballinger, James R. [Guy' s and St Thomas' NHS Trust, Department of Nuclear Medicine, London (United Kingdom); Cheng, Sheue-Yann [National Cancer Institute, Laboratory of Molecular Biology, Bethesda (United States)

    2010-11-15

    The human sodium/iodide symporter (hNIS) is a well-established target in thyroid disease and reporter gene imaging using gamma emitters {sup 123}I-iodide, {sup 131}I-iodide and {sup 99m}Tc-pertechnetate. However, no PET imaging agent is routinely available. The aim of this study was to prepare and evaluate {sup 18}F-labelled tetrafluoroborate ([{sup 18}F]TFB) for PET imaging of hNIS. [{sup 18}F]TFB was prepared by isotopic exchange of BF{sub 4} {sup -} with [{sup 18}F]fluoride in hot hydrochloric acid and purified using an alumina column. Its identity, purity and stability in serum were determined by HPLC, thin-layer chromatography (TLC) and mass spectrometry. Its interaction with NIS was assessed in vitro using FRTL-5 rat thyroid cells, with and without stimulation by thyroid-stimulating hormone (TSH), in the presence and absence of perchlorate. Biodistribution and PET imaging studies were performed using BALB/c mice, with and without perchlorate inhibition. [{sup 18}F]TFB was readily prepared with specific activity of 10 GBq/mg. It showed rapid accumulation in FRTL-5 cells that was stimulated by TSH and inhibited by perchlorate, and rapid specific accumulation in vivo in thyroid (SUV = 72 after 1 h) and stomach that was inhibited 95% by perchlorate. [{sup 18}F]TFB is an easily prepared PET imaging agent for rodent NIS and should be evaluated for hNIS PET imaging in humans. (orig.)

  1. Radiochemotherapy of hepatocarcinoma via lentivirus-mediated transfer of human sodium iodide symporter gene and herpes simplex virus thymidine kinase gene

    International Nuclear Information System (INIS)

    Chen Libo; Guo Guoying; Liu Tianjing; Guo Lihe; Zhu Ruisen

    2011-01-01

    Herpes simplex virus thymidine kinase (HSV-TK) gene/ganciclovir (GCV) system has been widely used as a traditional gene therapy modality, and the sodium/iodide symporter gene (NIS) has been found to be a novel therapeutic gene. Since the therapeutic effects of radioiodine therapy or prodrug chemotherapy on cancers following NIS or HSV-TK gene transfer need to be enhanced, this study was designed to investigate the feasibility of radiochemotherapy for hepatocarcinoma via coexpression of NIS gene and HSV-TK gene. Methods: HepG2 cells were stably transfected with NIS, TK and GFP gene via recombinant lentiviral vector and named HepG2/NTG. Gene expression was examined by reverse transcriptase polymerase chain reaction, fluorescence imaging and iodide uptake. The therapeutic effects were assessed by MTT assay and clonogenic assay. Results: HepG2/NTG cells concentrated 125 I - up to 76-fold higher than the wild-type cells within 20 min, and the efflux happened with a T 1/2eff of less than 10 min. The iodide uptake in HepG2/NTG cells was specifically inhibited by sodium perchlorate. Dose-dependent toxicity to HepG2/NTG cells by either GCV or 131 I was revealed by clonogenic assay and MTT assay, respectively. The survival rate of HepG2/NTG cells decreased to 49.7%±2.5%, 43.4%±2.8% and 8.6%±1.2% after exposure to 131 I, GCV and combined therapy, respectively. Conclusion: We demonstrate that radiochemotherapy of hepatocarcinoma via lentiviral-mediated coexpression of NIS gene and HSV-TK gene leads to stronger killing effect than single treatment, and in vivo studies are needed to verify these findings.

  2. Evaluation of the therapeutic efficacy of a VEGFR2-blocking antibody using sodium-iodide symporter molecular imaging in a tumor xenograft model

    Energy Technology Data Exchange (ETDEWEB)

    Cheong, Su-Jin; Lee, Chang-Moon; Kim, Eun-Mi [Department of Nuclear Medicine, Chonbuk National University Medical School, Jeonju-si, Jeonbuk 561-712 (Korea, Republic of); Research Institute of Clinical Medicine, Chonbuk National University Medical School, Jeonju-si, Jeonbuk 561-712 (Korea, Republic of); Cyclotron Research Center, Chonbuk National University Hospital, Jeonju-si, Jeonbuk 561-712 (Korea, Republic of); Uhm, Tai-Boong [Faculty of Biological Science, Chonbuk National University, Jeonju-si, jeonbuk 561-756 (Korea, Republic of); Jeong, Hwan-Jeong, E-mail: jayjeong@chonbuk.ac.k [Department of Nuclear Medicine, Chonbuk National University Medical School, Jeonju-si, Jeonbuk 561-712 (Korea, Republic of); Research Institute of Clinical Medicine, Chonbuk National University Medical School, Jeonju-si, Jeonbuk 561-712 (Korea, Republic of); Cyclotron Research Center, Chonbuk National University Hospital, Jeonju-si, Jeonbuk 561-712 (Korea, Republic of); Kim, Dong Wook; Lim, Seok Tae; Sohn, Myung-Hee [Department of Nuclear Medicine, Chonbuk National University Medical School, Jeonju-si, Jeonbuk 561-712 (Korea, Republic of); Research Institute of Clinical Medicine, Chonbuk National University Medical School, Jeonju-si, Jeonbuk 561-712 (Korea, Republic of); Cyclotron Research Center, Chonbuk National University Hospital, Jeonju-si, Jeonbuk 561-712 (Korea, Republic of)

    2011-01-15

    Purpose: Vascular endothelial growth factor receptor 2-blocking antibody (DC101) has inhibitory effects on tumor growth and angiogenesis in vivo. The human sodium/iodide symporter (hNIS) gene has been shown to be a useful molecular imaging reporter gene. Here, we investigated the evaluation of therapeutic efficacy by molecular imaging in reporter gene transfected tumor xenografts using a gamma imaging system. Methods: The hNIS gene was transfected into MDA-MB-231 cells using Lipofectamine. The correlation between the number of MDA-MB-231-hNIS cells and the uptake of {sup 99m}Tc-pertechnetate or {sup 125}I was investigated in vitro by gamma imaging and counting. MDA-MB-231-hNIS cells were injected subcutaneously into mice. When the tumor volume reached 180-200 mm{sup 3}, we randomly assigned five animals to each of three groups representing different tumor therapies; no DC101 (control), 100 {mu}g, or 150 {mu}g DC101/mouse. One week and 2 weeks after the first injection of DC101, gamma imaging was performed. Mice were sacrificed 2 weeks after the first injection of DC101. The tumor tissues were used for reverse transcriptase-polymerase chain reaction (RT-PCR) and CD31 staining. Results: Uptake of {sup 125}I and {sup 99m}Tc-pertechnetate into MDA-MB-231-hNIS cells in vitro showed correlation with the number of cells. In DC101 treatment groups, the mean tumor volume was smaller than that of the control mice. Furthermore, tumor uptake of {sup 125}I was lower than in the controls. The CD31 staining and RT-PCR assay results showed that vessel formation and expression of the hNIS gene were significantly reduced in the tumor tissues of treatment groups. Conclusion: This study demonstrated the power of molecular imaging using a gamma imaging system for evaluating the therapeutic efficacy of an antitumor treatment. Molecular imaging systems may be useful in evaluation and development of effective diagnostic and/or therapeutic antibodies for specific target molecules.

  3. Genetically Targeted Radiotherapy Utilizing the Human Sodium Iodide Symporter in Human Breast Carcinoma Cells

    National Research Council Canada - National Science Library

    Krager, Kimberly; Domann, Frederick E

    2006-01-01

    .... Clones were grown and are currently being screen for radioactive accumulation. The stable NIS-expressing cells will then be utilized in determining the level of NIS expression necessary to elicit a bystander effect...

  4. Effects of trichostatin a on the expression of sodium/iodide symporter mRNA and the uptake of iodide in human thyroid cancer cell lines

    International Nuclear Information System (INIS)

    Bao Jiandong; Lin Xiufeng; Yu Huixin; Tan Cheng; Zhang Li

    2010-01-01

    Objective: To investigate the sodium/iodide symporter (NIS) expression and iodide uptake in thyroid cancer cells induced by the histone deacetyltransferase inhibitors (HDACi), Trichostatin A (TSA). Methods: Both the thyroid cancer cell lines, follicular thyroid carcinoma cell line FTC-133 and papillary thyroid carcinoma cell line K1, were firstly induced with TSA for 48 h. Then, the expression of NIS mRNA was analysed with reverse transcription-polymerase chain reaction (RT-PCR), the densitometric ratio of NIS/glyceraldehyde 3-phosphate dehydrogenase (GAPDH) was calculated, and the iodide uptake in the thyroid cancer cells was also measured. Independent-sample t-test and one-way analysis of variance (ANOVA) were used to analyze the data. Results: For FTC-133 cells, increased NIS mRNA expression was detected after 48 h of TSA treatment, and the changes were dose-dependent (F=32.56, P 0.05). Furthermore, FTC-133 cells showed the ability of accumulating radioiodide with 50 and 75 nmol/L TSA induction for 48 h: (15.42 ± 0.42) x 10 3 counts · min -1 · 10 -5 cells vs (8.46 ± 0.84) x 10 3 counts · min -1 · 10 -5 cells, t=3.018, P 3 counts · min -1 · 10 -5 cells vs (8.46 ± 0.84) x 10 3 counts · min -1 · 10 -5 cells, t=3.557, P 3 counts · min -1 · 10 -5 cells, (6.97 ± 0.65) x 10 3 counts · min -1 · 10 -5 cells vs (5.37 ± 0.88) x 10 3 counts · min -1 · 10 -5 cells, t=0.185, P> 0.05 and t = 0.332, P > 0.05, respectively. Conclusion: TSA induced upregulated NIS mRNA expression in follicular thyroid cancer cells and augmented radioiodide uptake in thyroid cancer cells, while TSA had no remarkable effect on papillary thyroid carcinoma cell. (authors)

  5. Comparison of expressed human and mouse sodium/iodide sym-porters reveals differences in transport properties and subcellular localization

    Energy Technology Data Exchange (ETDEWEB)

    Dayem, M.; Basquin, C.; Navarro, V.; Carrier, P.; Marsault, R.; Lindenthal, S.; Pourcher, T. [Univ Nice Sophia Antipolis, Sch Med, CEA, DSV, iBEB, SBTN, TIRO, F-06107 Nice (France); Chang, P. [CNRS, UPMC Biol Dev, UMR 7009, F-06230 Villefranche Sur Mer (France); Huc, S.; Darrouzet, E. [CEA Valrho, DSV, iBEB, SBTN, F-30207 Bagnols Sur Ceze (France)

    2008-07-01

    The active transport of iodide from the blood stream into thyroid follicular cells is mediated by the Na{sup +}/I{sup -} sym-porter (NIS). We studied mouse NIS (mNIS) and found that it catalyzes iodide transport into transfected cells more efficiently than human NIS (hNIS). To further characterize this difference,we compared {sup 125}I, uptake in the transiently transfected human embryonic kidney (HEK) 293 cells. We found that the Vmax for mNIS was four times higher than that for hNIS, and that the iodide transport constant (Km) was 2-5-fold lower for hNIS than mNIS. We also performed immuno-cyto-localization studies and observed that the subcellular distribution of the two ortho-logs differed. While the mouse protein was predominantly found at the plasma membrane, its human ortho-log was intracellular in {approx} 40% of the expressing cells. Using cell surface protein-labeling assays, we found that the plasma membrane localization frequency of the mouse protein was only 2-5-fold higher than that of the human protein, and therefore cannot alone account for,x values. We reasoned that the difference in the obtained Vmax the observed difference could also be caused by a higher turnover number for iodide transport in the mouse protein. We then expressed and analyzed chimeric proteins. The data obtained with these constructs suggest that the iodide recognition site could be located in the region extending from the N-terminus to transmembrane domain 8, and that the region between transmembrane domain 5 and the C-terminus could play a role in the subcellular localization of the protein. (authors)

  6. Comparison of expressed human and mouse sodium/iodide sym-porters reveals differences in transport properties and subcellular localization

    International Nuclear Information System (INIS)

    Dayem, M.; Basquin, C.; Navarro, V.; Carrier, P.; Marsault, R.; Lindenthal, S.; Pourcher, T.; Chang, P.; Huc, S.; Darrouzet, E.

    2008-01-01

    The active transport of iodide from the blood stream into thyroid follicular cells is mediated by the Na + /I - sym-porter (NIS). We studied mouse NIS (mNIS) and found that it catalyzes iodide transport into transfected cells more efficiently than human NIS (hNIS). To further characterize this difference,we compared 125 I, uptake in the transiently transfected human embryonic kidney (HEK) 293 cells. We found that the Vmax for mNIS was four times higher than that for hNIS, and that the iodide transport constant (Km) was 2-5-fold lower for hNIS than mNIS. We also performed immuno-cyto-localization studies and observed that the subcellular distribution of the two ortho-logs differed. While the mouse protein was predominantly found at the plasma membrane, its human ortho-log was intracellular in ∼ 40% of the expressing cells. Using cell surface protein-labeling assays, we found that the plasma membrane localization frequency of the mouse protein was only 2-5-fold higher than that of the human protein, and therefore cannot alone account for,x values. We reasoned that the difference in the obtained Vmax the observed difference could also be caused by a higher turnover number for iodide transport in the mouse protein. We then expressed and analyzed chimeric proteins. The data obtained with these constructs suggest that the iodide recognition site could be located in the region extending from the N-terminus to transmembrane domain 8, and that the region between transmembrane domain 5 and the C-terminus could play a role in the subcellular localization of the protein. (authors)

  7. Sodium Iodide Symporter Gene Transfer for Imaging and Ablation of Prostate Cancer

    National Research Council Canada - National Science Library

    Jhiang, Sissy M

    2005-01-01

    .... The specific aims of this project are to: (1) confirm metastatic progression to distant lymph nodes and lungs following subcutaneous inoculation of rats with MATLyLu prostatic adenocarcinoma cells expressing hNIS; (2...

  8. An extremely high dietary iodide supply forestalls severe hypothyroidism in Na+/I- symporter (NIS) knockout mice.

    Science.gov (United States)

    Ferrandino, Giuseppe; Kaspari, Rachel R; Reyna-Neyra, Andrea; Boutagy, Nabil E; Sinusas, Albert J; Carrasco, Nancy

    2017-07-13

    The sodium/iodide symporter (NIS) mediates active iodide (I - ) accumulation in the thyroid, the first step in thyroid hormone (TH) biosynthesis. Mutations in the SLC5A5 gene encoding NIS that result in a non-functional protein lead to congenital hypothyroidism due to I - transport defect (ITD). ITD is a rare autosomal disorder that, if not treated promptly in infancy, can cause mental retardation, as the TH decrease results in improper development of the nervous system. However, in some patients, hypothyroidism has been ameliorated by unusually large amounts of dietary I - . Here we report the first NIS knockout (KO) mouse model, obtained by targeting exons 6 and 7 of the Slc5a5 gene. In NIS KO mice, in the thyroid, stomach, and salivary gland, NIS is absent, and hence there is no active accumulation of the NIS substrate pertechnetate ( 99m TcO 4 - ). NIS KO mice showed undetectable serum T 4 and very low serum T 3 levels when fed a diet supplying the minimum I - requirement for rodents. These hypothyroid mice displayed oxidative stress in the thyroid, but not in the brown adipose tissue or liver. Feeding the mice a high-I - diet partially rescued TH biosynthesis, demonstrating that, at high I - concentrations, I - enters the thyroid through routes other than NIS.

  9. Expression of the Na+/l- symporter (NIS is markedly decreased or absent in gastric cancer and intestinal metaplastic mucosa of Barrett esophagus

    Directory of Open Access Journals (Sweden)

    Wapnir Irene L

    2007-01-01

    Full Text Available Abstract Background The sodium/iodide symporter (NIS is a plasma membrane glycoprotein that mediates iodide (I- transport in the thyroid, lactating breast, salivary glands, and stomach. Whereas NIS expression and regulation have been extensively investigated in healthy and neoplastic thyroid and breast tissues, little is known about NIS expression and function along the healthy and diseased gastrointestinal tract. Methods Thus, we investigated NIS expression by immunohistochemical analysis in 155 gastrointestinal tissue samples and by immunoblot analysis in 17 gastric tumors from 83 patients. Results Regarding the healthy Gl tract, we observed NIS expression exclusively in the basolateral region of the gastric mucin-producing epithelial cells. In gastritis, positive NIS staining was observed in these cells both in the presence and absence of Helicobacter pylori. Significantly, NIS expression was absent in gastric cancer, independently of its histological type. Only focal faint NIS expression was detected in the direct vicinity of gastric tumors, i.e., in the histologically intact mucosa, the expression becoming gradually stronger and linear farther away from the tumor. Barrett mucosa with junctional and fundic-type columnar metaplasia displayed positive NIS staining, whereas Barrett mucosa with intestinal metaplasia was negative. NIS staining was also absent in intestinalized gastric polyps. Conclusion That NIS expression is markedly decreased or absent in case of intestinalization or malignant transformation of the gastric mucosa suggests that NIS may prove to be a significant tumor marker in the diagnosis and prognosis of gastric malignancies and also precancerous lesions such as Barrett mucosa, thus extending the medical significance of NIS beyond thyroid disease.

  10. Positive radionuclide imaging of miRNA expression using RILES and the human sodium iodide symporter as reporter gene is feasible and supports a protective role of miRNA-23a in response to muscular atrophy.

    Directory of Open Access Journals (Sweden)

    Viorel Simion

    Full Text Available MicroRNAs (miRNAs are key players in many biological processes and are considered as an emerging class of pharmacology drugs for diagnosis and therapy. However to fully exploit the therapeutic potential of miRNAs, it is becoming crucial to monitor their expression pattern using medical imaging modalities. Recently, we developed a method called RILES, for RNAi-Inducible Luciferase Expression System that relies on an engineered regulatable expression system to switch-ON the expression of the luciferase gene when a miRNA of interest is expressed in cells. Here we investigated whether replacing the luciferase reporter gene with the human sodium iodide symporter (hNIS reporter gene will be also suited to monitor the expression of miRNAs in a clinical setting context. We provide evidence that radionuclide imaging of miRNA expression using hNIS is feasible although it is not as robust as when the luciferase reporter gene is used. However, under appropriate conditions, we monitored the expression of several miRNAs in cells, in the liver and in the tibialis anterior muscle of mice undergoing muscular atrophy. We demonstrated that radiotracer accumulation in transfected cells correlated with the induction of hNIS and with the expression of miRNAs detected by real time PCR. We established the kinetic of miRNA-23a expression in mice and demonstrated that this miRNA follows a biphasic expression pattern characterized by a loss of expression at a late time point of muscular atrophy. At autopsy, we found an opposite expression pattern between miRNA-23a and one of the main transcriptional target of this miRNA, APAF-1, and as downstream target, Caspase 9. Our results report the first positive monitoring of endogenously expressed miRNAs in a nuclear medicine imaging context and support the development of additional work to establish the potential therapeutic value of miRNA-23 to prevent the damaging effects of muscular atrophy.

  11. Positive radionuclide imaging of miRNA expression using RILES and the human sodium iodide symporter as reporter gene is feasible and supports a protective role of miRNA-23a in response to muscular atrophy.

    Science.gov (United States)

    Simion, Viorel; Sobilo, Julien; Clemoncon, Rudy; Natkunarajah, Sharuja; Ezzine, Safia; Abdallah, Florence; Lerondel, Stephanie; Pichon, Chantal; Baril, Patrick

    2017-01-01

    MicroRNAs (miRNAs) are key players in many biological processes and are considered as an emerging class of pharmacology drugs for diagnosis and therapy. However to fully exploit the therapeutic potential of miRNAs, it is becoming crucial to monitor their expression pattern using medical imaging modalities. Recently, we developed a method called RILES, for RNAi-Inducible Luciferase Expression System that relies on an engineered regulatable expression system to switch-ON the expression of the luciferase gene when a miRNA of interest is expressed in cells. Here we investigated whether replacing the luciferase reporter gene with the human sodium iodide symporter (hNIS) reporter gene will be also suited to monitor the expression of miRNAs in a clinical setting context. We provide evidence that radionuclide imaging of miRNA expression using hNIS is feasible although it is not as robust as when the luciferase reporter gene is used. However, under appropriate conditions, we monitored the expression of several miRNAs in cells, in the liver and in the tibialis anterior muscle of mice undergoing muscular atrophy. We demonstrated that radiotracer accumulation in transfected cells correlated with the induction of hNIS and with the expression of miRNAs detected by real time PCR. We established the kinetic of miRNA-23a expression in mice and demonstrated that this miRNA follows a biphasic expression pattern characterized by a loss of expression at a late time point of muscular atrophy. At autopsy, we found an opposite expression pattern between miRNA-23a and one of the main transcriptional target of this miRNA, APAF-1, and as downstream target, Caspase 9. Our results report the first positive monitoring of endogenously expressed miRNAs in a nuclear medicine imaging context and support the development of additional work to establish the potential therapeutic value of miRNA-23 to prevent the damaging effects of muscular atrophy.

  12. Experiment study with baculovirus-mediated transfer of the thyroid sodium/iodide symporter gene into thyroid cancer for a targeted radiotherapy

    International Nuclear Information System (INIS)

    Zhang Yifan; Li Biao; Zhao Long; You Bei; Yin Guizhi; Zhu Chengmo

    2004-01-01

    Objective: To explore the feasibility of thyroid cancers for radiotherapy by using baculoviral vector to deliver the NIS gene into the tumor cells. Method: Constructed a recombinant baculovirus encoding the human NIS gene under the control of the cytomegalovirus promoter. Using a mouse monoclonal antibody and a FITC-labeled antimouse antibody to confirm expression of the NIS protein of infected tumor cells by immunofluorescence. In vitro iodide uptake experiments were carded out on BacNIS-infected tumor cells to further characterize the BacNIS virus, and cell killing with 131I and clonogenic assay were performed on BacNIS-infected cell to observe the selective killing effect of 1311 on NIS-expressing cells. Results: Infection of thyroidcancer cells (FTC-133, W3) with BacNIS resulted in perchlorate-sensitive 125I uptake by these cells to a higher level than that in noninfected cells. But 1251 uptake of 8505C is very low. Demonstrating that the BacNIS vector can function in tumor cells. In addition, AdNIS-infected tumor cells were selectively killed by exposure to 1311, as revealed by clonogenicassays, higher than that in nontreated tumors. Conclusions: AdNIS is very efficient in triggering iodide uptake by infected tumor cell, outlining the potential of this novel cancer gene therapy approach for a targeted radiotherapy. (authors)

  13. In vitro and in vivo characteristics of a human colon cancer cell line, SNU-C5N, expressing sodium-iodide symporter

    International Nuclear Information System (INIS)

    Min, Jung-Jun; Chung, June-Key; Jin Lee, Yong; Hoon Shin, Jae; Seok Yeo, Jeong; Min Jeong, Jae; Bom, Dong Soo Leea Hee-Seung; Chul Lee, Myung

    2002-01-01

    Rat NIS (rNIS) genes were transfected into a human colon cancer cell line (SNU-C5) by lipofection. The transfected cells (SNU-C5N) exhibited an increase 125 I uptake to a level 10 times higher than the untransfected SNU-C5 cells. The addition of 300 μM DIDS, an anion channel blocker, to the culture media led to a 2.35 times increase of 125 I uptake in the cells. For the first 10 minutes, up to 70% of the cellular radioactivity was released into the medium. In the biodistribution study using SNU-C5N-xenografted mice, the %ID/g of the SNU-C5N tumors at 1, 3, 6, and 12 h after the 125 I injection were 4.43%, 1.09%, 1.05%, and 0.05%, respectively, which were significantly higher than those for the SNU-C5 tumors (P<0.05). In tumor imaging, the SNU-C5N-xenografted tumor was clearly visible. In this study, NIS lipofection is efficient for triggering significant iodide uptake by a nonthyroidal tumor. However, for an increased therapeutic effect, the key issue is iodide retention in the target tissue

  14. In vitro and in vivo characteristics of a human colon cancer cell line, SNU-C5N, expressing sodium-iodide symporter

    Energy Technology Data Exchange (ETDEWEB)

    Min, Jung-Jun; Chung, June-Key E-mail: jkchung@plaza.snu.ac.kr; Jin Lee, Yong; Hoon Shin, Jae; Seok Yeo, Jeong; Min Jeong, Jae; Bom, Dong Soo Leea Hee-Seung; Chul Lee, Myung

    2002-07-01

    Rat NIS (rNIS) genes were transfected into a human colon cancer cell line (SNU-C5) by lipofection. The transfected cells (SNU-C5N) exhibited an increase {sup 125}I uptake to a level 10 times higher than the untransfected SNU-C5 cells. The addition of 300 {mu}M DIDS, an anion channel blocker, to the culture media led to a 2.35 times increase of {sup 125}I uptake in the cells. For the first 10 minutes, up to 70% of the cellular radioactivity was released into the medium. In the biodistribution study using SNU-C5N-xenografted mice, the %ID/g of the SNU-C5N tumors at 1, 3, 6, and 12 h after the {sup 125}I injection were 4.43%, 1.09%, 1.05%, and 0.05%, respectively, which were significantly higher than those for the SNU-C5 tumors (P<0.05). In tumor imaging, the SNU-C5N-xenografted tumor was clearly visible. In this study, NIS lipofection is efficient for triggering significant iodide uptake by a nonthyroidal tumor. However, for an increased therapeutic effect, the key issue is iodide retention in the target tissue.

  15. Auger recombination in sodium iodide

    Science.gov (United States)

    McAllister, Andrew; Kioupakis, Emmanouil; Åberg, Daniel; Schleife, André

    2014-03-01

    Scintillators are an important tool used to detect high energy radiation - both in the interest of national security and in medicine. However, scintillator detectors currently suffer from lower energy resolutions than expected from basic counting statistics. This has been attributed to non-proportional light yield compared to incoming radiation, but the specific mechanism for this non-proportionality has not been identified. Auger recombination is a non-radiative process that could be contributing to the non-proportionality of scintillating materials. Auger recombination comes in two types - direct and phonon-assisted. We have used first-principles calculations to study Auger recombination in sodium iodide, a well characterized scintillating material. Our findings indicate that phonon-assisted Auger recombination is stronger in sodium iodide than direct Auger recombination. Computational resources provided by LLNL and NERSC. Funding provided by NA-22.

  16. The potential of 211Astatine for NIS-mediated radionuclide therapy in prostate cancer

    International Nuclear Information System (INIS)

    Willhauck, Michael J.; Sharif Samani, Bibi-Rana; Goeke, Burkhard; Wolf, Ingo; Senekowitsch-Schmidtke, Reingard; Stark, Hans-Juergen; Meyer, Geerd J.; Knapp, Wolfram H.; Morris, John C.; Spitzweg, Christine

    2008-01-01

    We reported recently the induction of selective iodide uptake in prostate cancer cells (LNCaP) by prostate-specific antigen (PSA) promoter-directed sodium iodide symporter (NIS) expression that allowed a significant therapeutic effect of 131 I. In the current study, we studied the potential of the high-energy alpha-emitter 211 At, also transported by NIS, as an alternative radionuclide after NIS gene transfer in tumors with limited therapeutic efficacy of 131 I due to rapid iodide efflux. We investigated uptake and therapeutic efficacy of 211 At in LNCaP cells stably expressing NIS under the control of the PSA promoter (NP-1) in vitro and in vivo. NP-1 cells concentrated 211 At in a perchlorate-sensitive manner, which allowed a dramatic therapeutic effect in vitro. After intrapertoneal injection of 211 At (1 MBq), NP-1 tumors accumulated approximately 16% ID/g 211 At (effective half-life 4.6 h), which resulted in a tumor-absorbed dose of 1,580 ± 345 mGy/MBq and a significant tumor volume reduction of up to 82 ± 19%, while control tumors continued their growth exponentially. A significant therapeutic effect of 211 At has been demonstrated in prostate cancer after PSA promoter-directed NIS gene transfer in vitro and in vivo suggesting a potential role for 211 At as an attractive alternative radioisotope for NIS-targeted radionuclide therapy, in particular in smaller tumors with limited radionuclide retention time. (orig.)

  17. Recovery of NIS expression in thyroid cancer cells by overexpression of Pax8 gene

    International Nuclear Information System (INIS)

    Presta, Ivan; Filetti, Sebastiano; Russo, Diego; Arturi, Franco; Ferretti, Elisabetta; Mattei, Tiziana; Scarpelli, Daniela; Tosi, Emanuele; Scipioni, Angela; Celano, Marilena; Gulino, Alberto

    2005-01-01

    Recovery of iodide uptake in thyroid cancer cells by means of obtaining the functional expression of the sodium/iodide symporter (NIS) represents an innovative strategy for the treatment of poorly differentiated thyroid cancer. However, the NIS gene expression alone is not always sufficient to restore radioiodine concentration ability in these tumour cells. In this study, the anaplastic thyroid carcinoma ARO cells were stably transfected with a Pax8 gene expression vector. A quantitative RT-PCR was performed to assess the thyroid specific gene expression in selected clones. The presence of NIS protein was detected by Western blot and localized by immunofluorescence. A iodide uptake assay was also performed to verify the functional effect of NIS induction and differentiation switch. The clones overexpressing Pax8 showed the re-activation of several thyroid specific genes including NIS, Pendrin, Thyroglobulin, TPO and TTF1. In ARO-Pax8 clones NIS protein was also localized both in cell cytoplasm and membrane. Thus, the ability to uptake the radioiodine was partially restored, associated to a high rate of efflux. In addition, ARO cells expressing Pax8 presented a lower rate of cell growth. These finding demonstrate that induction of Pax8 expression may determine a re-differentiation of thyroid cancer cells, including a partial recovery of iodide uptake, fundamental requisite for a radioiodine-based therapeutic approach for thyroid tumours

  18. Comparison of Na+/I- symporter expression rate in malignant and benign thyroid diseases: immunohistochemical study

    International Nuclear Information System (INIS)

    Kang, Do Young; Jeong, Young Jin; Lee, Kyung Eun; Park, Heon Soo; Yoo, Young Hyun; Roh, Mee Sook

    2006-01-01

    Previous studies have not showed consistent results for the level of expression of sodium/iodide symporter (NIS) in thyroid diseases, especially malignant tumor. We undertook this study to evaluate the distribution of NIS expression in malignant thyroid diseases and compare with that in benign thyoid disease. Total patients were 119 cases (Men 15, 48±13 yrs). Total number of samples were 205 pieces. In malignant thyroid disease, there were 153 samples: 90 in papillary carcinoma, 4 in follicular carcinoma, 2 in medullary carcinoma and 57 in metastatic lymph node. In benign thyroid disease, there were 52 samples: 36 in goiter/cyst, 11 in thyroiditis and 5 in follicular adenoma. Using immunohistochemical methods, we probed 205 samples with monoclonal anti-NIS Ab. Grading of staining was scored as 0 (negative or absent), 1 (weakly positive), 2 (moderately positive) or 3 (strongly positive). Expression rate (ER) of NIS positivity in individual disease entity was expressed as percentage of total number divided by number in 2 plus 3 grade. ERs of malignant thyroid diseases were 63% in papillary carcinoma, 81% in metastatic lymph node, 71% in follicular carcinoma and 100% in medullary carcinoma. ERs of benign thyroid disease were 53% in goiter/cyst, 64% in thyroiditis and 40% in follicular adenoma. ER of benign thyroid deceases was higher than benign thyroid diseases (71% vs 54%). Grading of NIS expression in papillary carcinoma or goiter/cyst was heterogeneously distributed in considerable cases. Normal tissue also showed heterogeneous distribution or NIS expression, which was not correlated with that of primary lesion. In papillary thyroid carcinoma, distribution of NIS expression was heterogeneous and increased, and not different compared with that of benign thyroid disease

  19. Feasibility of a novel positive feedback effect of 131I-promoted Bac-Egr1-hNIS expression in malignant glioma via baculovirus

    International Nuclear Information System (INIS)

    Guo Rui; Tian Lipeng; Han Bing; Xu Haoping; Zhang Miao; Li Biao

    2011-01-01

    Purpose: As intracellular iodine is released rapidly, increased expression of sodium/iodide symporter (NIS) is required for effective radioiodine treatment of tumor. As Egr1 promoter is activated by 131 I and may promote human NIS (hNIS) expression, hNIS also induces 131 I uptake and activates Egr1, so the existence of a positive feedback effect of 131 I-promoted Egr1-hNIS expression is possible. Our purpose was to investigate the possible existence of this positive feedback effect through a series of in vitro pioneer studies. Method: Recombinant baculovirus (Bac-Egr1-hNIS) encoding the hNIS gene under the control of a radiation-inducible Egrl promoter was constructed. To test 131 I-promoted hNIS expression, human malignant glioma U87 cells were transfected with Bac-Egr1-hNIS, stimulated with or without 131 I; the expression of hNIS protein was detected by immunofluorescence and flow cytometry test. In addition, the uptake and efflux of 131 I were determined after the incubation of Bac-Egr1-hNIS-transfected U87 cells with or without 131 I. Results: Immunocytochemical staining and flow cytometry test showed a higher hNIS protein expression in Bac-Egr1-hNIS-transfected U87 cells with 131 I stimulation than in cells without stimulation. Bac-Egr1-hNIS-transfected U87 cells accumulated up to about 4.05 times of 131 I after 131 I stimulation. The amount of 131 I uptake in both groups showed a baculovirus dose-dependent manner. However, rapid efflux of radioactivity was observed in both groups, with 50% lost during the first 2 min after the 131 I-containing medium had been replaced by a nonradioactive medium. Conclusion: Our results indicated that an improved transgene expression of 131 I-stimulated hNIS in U87 cells using a baculovirus vector containing the Egr1 promoter is possible, and the increased expression of hNIS is responsible for a higher 131 I uptake. It might provide a reference for the existence of a positive feedback effect in 131 I-promoted Bac-Egr1-hNIS

  20. The construction and identification of hypoxia-regulated recombinant plasmid with reporter gene hNIS

    International Nuclear Information System (INIS)

    Hu Qunchao; Wu Jinchang; Zhou Jundong; Gu Ke

    2011-01-01

    Objective: To construct pShuttle-5 × HRE-CMV-NIS recombinant plasmid regulated by hypoxia-responsive element, which can possibly by used to detect the expression of hypoxia induced factor-α (HIF-1α) gene under hypoxia condition. Methods: Artificially synthesize the nucleotide sequences of five copies of hypoxia response elements (HREs) were cloned into pGL3-promoter vector to construct pGL3-promoter-5 × HRE vector. Human sodium/iodide symporter (hNIS) gene cDNA was amplified from human genome by RT-PCR, and subcloned into pGL3-promoter-5 × HRE vector then was sequenced. After treated with CoCl 2 as hypoxia mimic, HEK293 cells were transfected with recombinant plasmid with hNIS gene, while cells treated with DMSO as the control. Meanwhile, pcDNA3.1-HIF-1α and recombinant hNIS gene vectors were transfected into HEK293 cells at the ratio of 3 to 1, while co-transfection with pcDNA3.1 and pShuttle-NIS vectors cells were taken as the control. NIS mRNA expression was analyzed by qRT-PCR while function of NIS protein was tested by 99m TcO 4 - -uptake. Results: The sequence data of hNIS gene in recombinant plasmid were in accordance with those reported in the literatures. Compared with control groups, HEK293 cells co-transfected with both pShuttle-5 × HRE-CMV-NIS and HIF-1α gene vectors and CoCl 2 -treated after pShuttle-NIS transfecting presented higher mRNA expressions of NIS and 99m TcO 4 - uptake (P<0.01). Conclusion: HIF-1α can be bound to and activate pShuttle-5 × HRE-CMV-NIS in cells to accumulate radioactive nuclide 99m TcO 4 - and this technique is potential for detection of expression and activity of HIF-1α, the indicator of cell hypoxia. (authors)

  1. Study of rNIS as a reporter gene monitoring rBMSC transplanted to rat myocardium

    International Nuclear Information System (INIS)

    Hu Shou; Lan Xiaoli; Cao Wei; Cao Guoxiang; Zhang Guopeng; Zhang Binqing; Wu Tao; Chang Wei; Zhang Yongxue

    2010-01-01

    Objective: To investigate the feasibility of rat sodium/iodide symporter (rNIS) as a reporter gene monitoring rat bone marrow mesenchymal cells (rBMSC) transplanted to rat myocardium in vivo. Methods: Recombinated adenovirus vector was constructed by rNIS/enhanced green fluorescence protein (EGFP) (Ad-rNIS/EGFP). rBMSC transfected by Ad-rNIS/EGFP were studied using fluorescence microscope. Fifteen rats were transplanted with rBMSC and randomly divided into three groups: rNIS group (with rNIS transfection), blocked group (with rNIS transfection) by oral intake of perchloric sodium before planar imaging (GE Millennium MPR SPECT), and control group (without rNIS transfection). All rats underwent 99 Tc m -pertechnetate planar imaging. The biological distribution of 99 Tc m -pertechnetate was studied. The expressions of rNIS gene and protein in myocardium were measured by real time polymerase chain reaction (PCR) and western blot, respectively. The expressions of CD 29 , CD 44 , CD 90 , CD 11 b, CD 34 and CD 45 were measured by immunohistochemistry. Results: rBMSC transfected by Ad-rNIS/EGFP showed EGFP expression under fluorescence microscope. The transplanted rat myocardium could be visualized on 99 Tc m -pertechnetate planar imaging in rNIS group. The relative uptake ratio (R heart /R hmb , RUR) was 6.7 ±0.4. RUR in control group (3.0 ±0.2) was lower than that in rNIS group (t =2.78, P=0.03). The percentage injection dose per gram of tissue (% ID/g) of the transplanted myocardium was 60.2 ± 20.8 in rNIS group, which was higher than that (2.5 ± 0.4) % ID/g of control group ( t = 7.13, P 29 , CD 44 and CD 90 were positive, CD 45 and CD 45 negative CD 11 b mildly positive in the myocardium transplanted with infective rBMSC. Conclusion: rNIS can efficiently monitor rBMSC transplanted to rat myocardium. (authors)

  2. Radiostatine and radioiodine uptake characterization in sodium iodine symporter-expressing cell lines

    International Nuclear Information System (INIS)

    Petrich, T.; Helmeke, H.J.; Meyer, G.J.; Knapp, W.H.; Poetter, E.

    2002-01-01

    Full text: The sodium iodide symporter (NIS) has been recognized as an attractive target for cancer gene therapy. Here we investigated NIS-mediated transport of the high LET α-emitter astatine, 211 At, in comparison to radioiodine. A constitutive expression vector harbouring the human NIS cDNA was used in combination with reporter gene vectors for transient transfection of 13 different human cancer cell lines. Radioiodine uptake was measured as well as transfection efficiencies. Six stable NIS-expressing cell lines (3 derived from thyroid carcinomas, 2 colon carcinoma, 1 glioblastoma) were generated by antibiotic selection. NIS expression was monitored by immunohistochemistry and RT-PCR. Subsequently the radioastatine and radioiodine uptake characteristics of genetically modified cells were studied in comparison to the respective control cells. After xenotransplantation in nude mice in vivo tumor imaging by scintigraphy and biodistribution studies following organ removal were performed. Transient transfection of NIS cDNA led to high specific sodium perchlorate-sensitive radioiodine uptake in NIS-expressing cells that roughly correlates to transfection efficiencies. Similarly, stable NIS-expressing cell lines were able to concentrate high levels of radioiodine and in addition showed comparable transport capacity for radioastatine. Accumulation of 211 At was inhibited by sodium perchlorate like iodide uptake and displayed dependency an extracellular Na + - and I - -ions as well. Compared to wash-out experiments in cell culture the effective half life of radioiodine and radioastatine in vivo was significantly prolonged. Preliminary dose calculations by MIRD concepts indicated higher tumor radiation doses for 211 At compared to 131 I. Tumor cells of different origins transfected with the NIS-expression vector specifically and significantly take-up radioiodine and radioastatine in vitro and in vivo. The data provide direct evidence that the NIS efficiently transports

  3. Comparison of Na{sup +}/I{sup -} symporter expression rate in malignant and benign thyroid diseases: immunohistochemical study

    Energy Technology Data Exchange (ETDEWEB)

    Kang, Do Young; Jeong, Young Jin; Lee, Kyung Eun; Park, Heon Soo; Yoo, Young Hyun; Roh, Mee Sook [Donga University College of Medicine, Busan (Korea, Republic of)

    2006-02-15

    Previous studies have not showed consistent results for the level of expression of sodium/iodide symporter (NIS) in thyroid diseases, especially malignant tumor. We undertook this study to evaluate the distribution of NIS expression in malignant thyroid diseases and compare with that in benign thyoid disease. Total patients were 119 cases (Men 15, 48{+-}13 yrs). Total number of samples were 205 pieces. In malignant thyroid disease, there were 153 samples: 90 in papillary carcinoma, 4 in follicular carcinoma, 2 in medullary carcinoma and 57 in metastatic lymph node. In benign thyroid disease, there were 52 samples: 36 in goiter/cyst, 11 in thyroiditis and 5 in follicular adenoma. Using immunohistochemical methods, we probed 205 samples with monoclonal anti-NIS Ab. Grading of staining was scored as 0 (negative or absent), 1 (weakly positive), 2 (moderately positive) or 3 (strongly positive). Expression rate (ER) of NIS positivity in individual disease entity was expressed as percentage of total number divided by number in 2 plus 3 grade. ERs of malignant thyroid diseases were 63% in papillary carcinoma, 81% in metastatic lymph node, 71% in follicular carcinoma and 100% in medullary carcinoma. ERs of benign thyroid disease were 53% in goiter/cyst, 64% in thyroiditis and 40% in follicular adenoma. ER of benign thyroid deceases was higher than benign thyroid diseases (71% vs 54%). Grading of NIS expression in papillary carcinoma or goiter/cyst was heterogeneously distributed in considerable cases. Normal tissue also showed heterogeneous distribution or NIS expression, which was not correlated with that of primary lesion. In papillary thyroid carcinoma, distribution of NIS expression was heterogeneous and increased, and not different compared with that of benign thyroid disease.

  4. hNIS-IRES-eGFP Dual Reporter Gene Imaging

    Directory of Open Access Journals (Sweden)

    Jiantu Che

    2005-04-01

    Full Text Available The human and rodent sodium iodide symporters (NIS have recently been cloned and are being investigated as potential therapeutic and reporter genes. We have extended this effort by constructing an internal ribosomal entry site (IRES-linked human NIS (hNIS-enhanced green fluorescent protein (eGFP hybrid reporter gene for both nuclear and optical imaging. A self-inactivating retroviral vector, termed pQCNIG, containing hNIS-IRES-eGFP dual reporter gene, driven by a constitutive CMV promoter, was constructed and used to generate RG2-pQCNIG cells and RG2-pQCNIG tumors. 131I-iodide and 99mTcO4-pertechnetate accumulation studies plus fluorescence microscopy and intensity assays were performed in vitro, and gamma camera imaging studies in RG2-pQCNIG and RG2 tumor-bearing athymic rats were performed. RG2-pQCNIG cells expressed high levels of hNIS protein and showed high intensity of eGFP fluorescence compared with RG2 wild-type cells. RG2-pQCNIG cells accumulated Na131I and 99mTcO4– to a 50:1 and a 170:1 tissue/medium ratio at 10 min, compared with 0.8:1.2 tissue/medium ratio in wild-type RG2 cells. A significant correlation between radiotracer accumulation and eGFP fluorescence intensity was demonstrated. RG2-pQCNIG and RG2 tumors were readily differentiated by in vivo gamma camera imaging; radiotracer uptake increased in RG2-pQCNIG but declined in RG2 tumors over the 50-min imaging period. Stomach and thyroid were the major organs of radionuclide accumulation. The IRES-linked hNIS-eGFP dual reporter gene is functional and stable in transduced RG2-pQCNIG cells. Optical and nuclear imaging of tumors produced from these cell lines provides the opportunity to monitor tumor growth and response to therapy. These studies indicate the potential for a wider application of hNIS reporter imaging and translation into patient studies using radioisotopes that are currently available for human use for both SPECT and PET imaging.

  5. 99Tcm pertechnetate uptake by hepatoma cells induced by tissue specific hNIS gene expression

    International Nuclear Information System (INIS)

    Chen Libo; Luo Quanyong; Yu Yongli; Yuan Zhibin; Lu Hankui; Zhu Ruisen; Guo Lihe

    2007-01-01

    Objective: Human sodium/iodide symporter (hNIS) gene could be used both as an ideal reporter gene and promising therapeutic gene. Rather than radioiodine, 99 Tc m pertechnetate has been proven to be a better radiopharmaceutical for tracing and imaging purposes. Herein, the authors investigated the feasibility of monitoring hNIS gene expression in hepatoma cells using 99 Tc m pertechnetate as a tracer. Methods: Hepatoma cells MH3924A were stably transfected with recombinant retroviral vector in which hNIS cDNA was driven by murine albumin enhancer/promoter (mAlb) and coupled to hygromycin resistance gene. The uptake and efflux of 99 Tc m pertechnetate by transfected hepatoma cells were tested with 99 Tc m pertechnetate (74 kBq) solution adulterated into the culture media and counted after media suspension discharge at different intervals. In further tests, 50 μmol/L NaClO 4 and 500 μmol/L Ouabain were added into the media for 99 Tc m inhibition tests. For in vive studies, five ACI rats bearing NIS transfected hepatoma xenografts were injected with 99 Tc m pertechnetate (15.8 MBq) and followed by dynamic acquisition (0.57 1, 2 and 4 h) with small gamma camera to semi-quantitatively analyze the radioactivity distribution. Results: In vitro tests, the peak uptake of 99 Tc m pertechnetate by cultured transfected MH3924A cells was up to 254 folds higher than that by the wild type cells. 99 Tc m uptake by transfected cells were significantly inhibited by NaClO 4 down to 2.44% (P 99 Tc m pertechnetate out of cultured transfected cells became rapid immediately after renewal of culture media (half life 99 Tc m accumulations by hNIS transfected tumor xenografts were obvious in early phases of the acquisition with peak uptake at 12 min and gradually declining later on. Conclusions: hNIS transfected hepatoma cells can avidly uptake 99 Tc m pertechnetate both in vitro and in vive. It is feasible to utilize 99 Tc m pertechnetate for monitoring and even quantitatively analyzing

  6. Growth and fabrication of large size sodium iodide crystal scintillator

    International Nuclear Information System (INIS)

    Sabharwal, S.C.; Karandikar, S.C.; Mirza, T.; Ghosh, B.; Deshpande, R.Y.

    1979-01-01

    The growth of 80 - 135 mm dia. Sodium iodide crystals activated with thallium is described in the present report. The growth is effected in a glazed porcelain crucible in a protective ambient of dry nitrogen. The technical details of the equipment developed have been fully described. The results of measurements on the rate of growth of crystal and the optimization of different growth parameters are reported. The dependence of various factors upon the performance characteristics of the scintillator detectors made using these crystals is also discussed. The energy resolution obtained for a typical detector of dimensions 76 mm dia x 76 mm ht. is 10 percent. (auth.)

  7. Production of high quality sodium iodide preparations labelled with carrier free iodine-125

    International Nuclear Information System (INIS)

    Abdukayumov, M.N.; Chistyakov, P.G.; Shilin, E.A.

    2001-01-01

    Work is related to the problem of high-quality Sodium Iodide preparation production and to the choice of the peptids iodination methods with the purpose of control test developing to determine the Biological activity of the above mentioned preparation

  8. Method for ion exchange purification of sodium iodide solution from heavy metals and potassium microimpurities

    International Nuclear Information System (INIS)

    Smirnov, G.I.; Kachur, N.Ya.; Kostromina, O.N.; Ogorodnikova, A.A.; Khajnakov, S.A.

    1990-01-01

    A method of deep ion exchange purification of sodium iodide solution from heavy metals (iron, nickel, copper, lead) and potassium microimpurities is developed. The method includes multiple sorption of microimpurities on titanium phosphate with their subsequent desorption by sorbent processing with a solution with a solution of 3-6 N nitric acid, first, and then with a neutral solution of 2 % sodium thiosulfate. The given method permits to increase the purification degree of sodium iodide solution by 25-30 %. 2 tabs

  9. THERAPY OF GRAVES’ DISEASE WITH SODIUM IODIDE-131

    Directory of Open Access Journals (Sweden)

    I Wayan Hartadi Noor

    2013-11-01

    Full Text Available Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 Graves’ disease is the most common form of thyrotoxicosis, with a peak incidence in the 20-40 year of age group. Females are involved about five times more commonly than male. The easiest sign to recognize patients with Graves’ disease is the present of Graves’ ophthalmopathy. The diagnosis of Graves’ disease may sometimes base only on a physical examination and a medical history. Diffuse thyroid enlargement and sign of thyrotoxicosis, mainly ophthalmopathy and to lesser extent dermopathy, usually adequate for diagnosis. TSH test combined with FT4 test is usually the first laboratory test performs in these patients. The patients suffered Graves’ disease can be treated with antithyroid drug therapy or undergo subtotal Thyroidectomy. Another therapy is by using sodium iodide-131, where this therapy has advantages including easy administration, effectiveness, low expense, and absence of pain. /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;}

  10. Treatment with rhenium-188-perrhenate and iodine-131 of NIS-expressing mammary cancer in a mouse model remarkably inhibited tumor growth

    Energy Technology Data Exchange (ETDEWEB)

    Dadachova, Ekaterina [Department of Nuclear Medicine, Albert Einstein College of Medicine, Bronx, NY 10461 (United States)]. E-mail: edadacho@aecom.yu.edu; Nguyen, Andrew [Department of Microbiology and Immunology, Albert Einstein College of Medicine, Bronx, NY 10461 (United States); Lin, Elaine Y. [Department of Developmental and Molecular Biology, Albert Einstein College of Medicine, Bronx, NY 10461 (United States); Gnatovskiy, Leo [Department of Developmental and Molecular Biology, Albert Einstein College of Medicine, Bronx, NY 10461 (United States); Lu, Ping [Department of Nuclear Medicine, Albert Einstein College of Medicine, Bronx, NY 10461 (United States); Pollard, Jeffrey W. [Department of Developmental and Molecular Biology, Albert Einstein College of Medicine, Bronx, NY 10461 (United States)

    2005-10-01

    Introduction: Novel therapeutic modalities are needed for breast cancer patients in whom standard treatments are not effective. Mammary gland sodium/iodide symporter has been identified as a molecular target in breast cancers in humans and in some transgenic mouse models. We report the results of a therapy study with {sup 131}I{sup -} and {sup 188}ReO{sub 4} {sup -} of breast cancer in polyoma middle T oncoprotein (PyMT) transgenic mice endogenously expressing the Na{sup +}/I{sup -} symporter (NIS). Methods: PyMT mice (12-13 weeks old) with one palpable tumor of 0.5-0.8 cm in diameter were used. For the therapy studies, PyMT mice were (1) treated with two intraperitoneal injections of 1.5 mCi of {sup 188}ReO{sub 4} {sup -} 1 week apart, (2) pretreated for 1 week with 5 {mu}g of triiodothyronine (T3) followed by two intraperitoneal injections of 1.5 mCi of {sup 131}I{sup -} 1 week apart or (3) left untreated. The tumor and normal organ uptakes were assessed by scintigraphic imaging. The thyroid function of treated and control animals was evaluated at the completion of the study by measuring the T3/thyroxine (T4) ratio in their blood. Results: There was significant uptake of {sup 131}I{sup -} and {sup 188}ReO{sub 4} {sup -} in the primary palpable tumors as well as in nonpalpable tumors, stomachs and thyroids. The tumor uptake after the second injection was 10 times lower in comparison with the first injection. Tumor growth was significantly inhibited in both the {sup 131}I{sup -} and {sup 188}ReO{sub 4} {sup -} groups in comparison with the control group, and tumors in the {sup 188}ReO{sub 4} {sup -} group increased in size significantly less than in the {sup 131}I{sup -} group. The T3/T4 ratios were calculated to be 27 and 25 for the control group and the {sup 188}ReO{sub 4} {sup -} group, respectively; for {sup 131}I{sup -}, both the T3 and T4 levels were below detection limit, demonstrating much less effect on the thyroids of treatment with {sup 188}ReO{sub 4

  11. Treatment with rhenium-188-perrhenate and iodine-131 of NIS-expressing mammary cancer in a mouse model remarkably inhibited tumor growth

    International Nuclear Information System (INIS)

    Dadachova, Ekaterina; Nguyen, Andrew; Lin, Elaine Y.; Gnatovskiy, Leo; Lu, Ping; Pollard, Jeffrey W.

    2005-01-01

    Introduction: Novel therapeutic modalities are needed for breast cancer patients in whom standard treatments are not effective. Mammary gland sodium/iodide symporter has been identified as a molecular target in breast cancers in humans and in some transgenic mouse models. We report the results of a therapy study with 131 I - and 188 ReO 4 - of breast cancer in polyoma middle T oncoprotein (PyMT) transgenic mice endogenously expressing the Na + /I - symporter (NIS). Methods: PyMT mice (12-13 weeks old) with one palpable tumor of 0.5-0.8 cm in diameter were used. For the therapy studies, PyMT mice were (1) treated with two intraperitoneal injections of 1.5 mCi of 188 ReO 4 - 1 week apart, (2) pretreated for 1 week with 5 μg of triiodothyronine (T3) followed by two intraperitoneal injections of 1.5 mCi of 131 I - 1 week apart or (3) left untreated. The tumor and normal organ uptakes were assessed by scintigraphic imaging. The thyroid function of treated and control animals was evaluated at the completion of the study by measuring the T3/thyroxine (T4) ratio in their blood. Results: There was significant uptake of 131 I - and 188 ReO 4 - in the primary palpable tumors as well as in nonpalpable tumors, stomachs and thyroids. The tumor uptake after the second injection was 10 times lower in comparison with the first injection. Tumor growth was significantly inhibited in both the 131 I - and 188 ReO 4 - groups in comparison with the control group, and tumors in the 188 ReO 4 - group increased in size significantly less than in the 131 I - group. The T3/T4 ratios were calculated to be 27 and 25 for the control group and the 188 ReO 4 - group, respectively; for 131 I - , both the T3 and T4 levels were below detection limit, demonstrating much less effect on the thyroids of treatment with 188 ReO 4 - than with 131 I - . Conclusions: These results prove that NIS expression in breast tumors in animal models allows specific, efficient and safe treatment with a variety of

  12. Determination of microamounts of potassium in sodium iodide by atomic absorption spectrometry

    International Nuclear Information System (INIS)

    Ogasawara, Ken; Ohta, Masatoshi; Abe, Kenzo

    1980-01-01

    Microdetermination of potassium in sodium iodide was developed by the standard addition method. Twenty grams of sample were dissolved in 50 ml of water in a quartz beaker. To the solution, 30 ml of concentrated hydrochloric acid and 30 ml of 30% hydrogen peroxide were added, and evaporated to dryness. By this process sodium iodide was converted into sodium chloride. The cake thus obtained was dissolved in water and diluted to exactly 200 ml. To 25 ml aliquots of the solution, the standard potassium and cesium chloride solutions were added and diluted to 50 ml with water; the concentration of potassium was 0 -- 1 mg/l and that of cesium 4 mM. These solutions were introduced into an air-propane flame and the absorbances were measured at 769.9 nm. During the conversion reaction, hydrochloric acid was completely decomposed, and remained hydrogen peroxide had no influence for absorbance, and other backgrounds were negligible. The linear calibration curve was obtained in the range 0 -- 2 mg of potassium per liter. Potassium in sodium iodide was determined by this method within the coefficient of variation of +-(20 -- 3)% in the range (1.7 -- 32.5) ppm. (author)

  13. Complex crystals formed in the aqueous solution of copper(I) iodide and sodium iodide

    International Nuclear Information System (INIS)

    Sugasaka, Kazuhiko; Fujii, Ayako

    1977-01-01

    Crystals of different crystal habits were separated from the copper(I) iodide and sodium iodide solution and the thermal changes of the composition of copper(I) iodide and sodium iodide complexes were studied by chemical analysis, thermal analysis and X-ray diffractometry. Granular and columnar crystals were determined to be copper(I) iodide and sodium iodide dihydrate by X-ray diffraction analysis, respectively. Needle crystal (A) which was separated from the solution at 25 0 C was assumed to be Na 2 CuI 3 .6H 2 O. (A) was stable in its appearance in the air, but the X-ray diffraction pattern of (A) changed. Needle crystal (B) which was recrystallized at 10 0 C from mother liquor after the separation of crystal (A) was assumed to be NaCuI 2 .4H 2 O. (B) was hygroscopic and decomposed to precipitate copper(I) iodide with moisture in the air. (A) and (B) were found to change by heating and or drying, respectively, as follows: Na 2 CuI 3 .6H 2 O → (-2H 2 O, 80 0 C) → 2NaI.2H 2 O + CuI → (-4H 2 O, 160 0 C) → 2NaI + CuI → (+1/2O 2 , 450 0 C) → 2NaI + CuO + 1/2I 2 , NaCuI 2 .4H 2 O → (-4H 2 O, Dried) → NaI + CuI. (auth.)

  14. Calibration of sodium iodide crystal (NaI) gamma ray detector

    International Nuclear Information System (INIS)

    Azwah Jaafar; Juhari Yusof

    2005-01-01

    Sodium Iodide crystal gamma ray detector are widely used to detect leak in the pipeline linkage study, the complete mixing substances in of industrial processes, to measure the river and stream discharges and other usage in estuary and coastal sediment studies. These instruments are more sensitive as compared to other types of counters like Geiger Muller or plastic scintillation component. This calibration is to ensure the correct voltage for each detector. The characteristics of detector are different from each other. Once the operating voltage (HV) is determined it can be used effectively to measure the radiation in the application of nuclear techniques. (Author)

  15. An investigation of sodium iodide solubility in sodium-stainless steel systems

    International Nuclear Information System (INIS)

    Sagawa, Norihiko; Tashiro, Suguru

    1996-01-01

    Sodium iodide and major constituents of stainless steel in sodium are determined by using the steel capsules to obtain a better understanding on contribution of the constituents to the apparent iodide solubility in sodium. The capsule loaded with 20 g sodium and 0.1 - 0.3 g powder of sodium iodide is heated at its upper part in a furnace and cooled at its bottom on brass plates to establish a large temperature gradient along the capsule tube. After a given period of equilibration, the iodide and constituents are fixed in solidified sodium by quick quenching of the capsules. Sodium samples are taken from the sectioned capsule tube and submitted to sodium dissolution by vaporized water for determination of the iodine and to vacuum distillation for determination of the metal elements. Iron and nickel concentrations are observed to be lower in the samples at higher iodine concentrations. Chromium and manganese concentrations are seen to be insensitive to the iodine concentrations. The observations can be interpreted by a model that sodium oxide combines with metal iodide in sodium to form a complex compound and with consideration that the compound will fall and deposit onto the bottom of the capsule by thermal diffusion. (author)

  16. Instrumental basis utilizing a sodium iodide detector for radioactive soil evaluations for site remediation

    International Nuclear Information System (INIS)

    Davis, A.I.

    1996-07-01

    This document provides the design rational for using a 5.08 by 5.08 cm (2 by 2 in.) sodium iodide detector to aid in boundary mapping of the radioactive contaminated soils at the Hanford Site. The detector can provide adequate response to a homogeneously contaminated soil volume of at least 1.22 to 1.52 m in diameter and up to 45.7 cm deep. The gamma activity basis is described by a soil column in a right circular cylinder that is uniformly isotopic. The detection techniques and characteristics are used to define contaminated areas requiring excavation by locating regions where gamma activities exceed cleanup standards. To determine the areas and boundary of contamination, the boundary and adjacent surfaces will be mapped using the detector operated in a windowed gross-gamma mode

  17. On the refractive index of sodium iodide solutions for index matching in PIV

    Science.gov (United States)

    Bai, Kunlun; Katz, Joseph

    2014-04-01

    Refractive index matching has become a popular technique for facilitating applications of modern optical diagnostic techniques, such as particle image velocimetry, in complex systems. By matching the refractive index of solid boundaries with that of the liquid, unobstructed optical paths can be achieved for illumination and image acquisition. In this research note, we extend previously provided data for the refractive index of aqueous solutions of sodium iodide (NaI) for concentrations reaching the temperature-dependent solubility limit. Results are fitted onto a quadratic empirical expression relating the concentration to the refractive index. Temperature effects are also measured. The present range of indices, 1.333-1.51, covers that of typical transparent solids, from silicone elastomers to several recently introduced materials that could be manufactured using rapid prototyping. We also review briefly previous measurements of the refractive index, viscosity, and density of NaI solutions, as well as prior research that has utilized this fluid.

  18. Determination of radiation dose rates and urinary activity of patients received Sodium Iodide-131 for treatment of differentiated thyroid carcinoma

    International Nuclear Information System (INIS)

    Beiki, D.; Shahhosseini, S.; Dadashzadeh, S.; Eftekhari, M.; Tayebi, H.; Moosazadeh-Rashti, G.

    2004-01-01

    Sodium Iodide-131 is administrated for treatment of hyperthyroidism and thyroid cancer. Iodine-131 has multiple routs of excretion (urine, saliva, sweat, milk, feces, exhalation) from the body. Patients receiving Sodium Iodide-131 therapy exposes other persons and the environment to unwanted radiation and contamination. The major sources of radiation dose from administration of Iodine-131 is external radiation , also there is a potential for exposure via contamination.Precautions are necessary to limit the radiation dose to family members, nursing staff and members of public and waste treatment workers to less than 1mSv. Patients received Sodium Iodide-131 may come into close contact with other persons. In order to derive appropriate recommendations, dose rates were measured from the anterior mid-trunk of 29 patients in the upright position with 15 minutes post-dose administration at 3 meters and just before they left the nuclear medicine department at 0.5, 1, and 3 meters. We have also measured urinary iodide excretion in 29 patients to estimate Sodium Iodide-131 urinary excretion pattern in iranian patients. Based on results, the maximum cumulative dose to nursing staff was on third day (leaving day) still less than recommended dose bye ICRP. The cumulative dose family members will be more but regarding the time and distance in close contact it will be also less than recommended dose by ICRP.Radiation dose rate was decreased significantly on third day. The urinary excretion patterns in all patients were similar. The urinary excretion rate-time curve in all patients showed multiple peaks due to retention and redistribution of Iodine-131 or enterohepatic cycle of radioiodinated thyroid hormones, which didn't allow calculation of urinary excretion rate constant. The results also showed that 67 hours post administration of Sodium Iodide-131 about 70% of radiopharmaceutical was excreted through urine, 28% physically decayed or eliminated through other biological

  19. Radioiodine uptake of undifferentiated thyroid cancer cells by adenovirus-mediated Na+/ I- symporter gene transfer

    Energy Technology Data Exchange (ETDEWEB)

    So, Y.; Lee, Y. J.; Shin, J. H.; Oh, H. J.; Chung, J. K.; Lee, M. C.; Cho, B. Y. [College of Medicine, Univ. of Seoul National, Seoul (Korea, Republic of); Lee, K. H. [Samsung Medical Center, Seoul (Korea, Republic of)

    2003-07-01

    To increase radioiodine uptake on undifferentiated thyroid cancer cell (ARO cells) by adenovirus-mediated human Na+/I- symporter (hNIS) gene transfer. Recombinant adenovirus Ad-hNIS was manufactured successfully. After transfecting Ad-hNIS on ARO cells, in vitro I-125 uptake and efflux studies were performed. For in vivo studies, 1.510'8 p.f.u. (50 1) of Ad-hNIS was injected into xenograft ARO tumors on the R thigh of BALB/c nu/nu mice (n=12), and same amount of normal saline was injected into xenograft ARO tumors on the L thigh. Two, 3, 4 and 6 days after intratumoral injection of Ad-hNIS, I-131 images (3 mice per day) were taken and xenograft tumors on both thighs were all excised. Total RNA was extracted from each tumor tissue and RT-PCR was performed to confirm the hNIS expression of Ad-hNIS injected xenograft ARO tumors. I-125 uptake of Ad-hNIS transfected ARO cells was increased up to 233 folds at 120 minutes in vitro. I-125 efflux study revealed rapid washout of I-125 from Ad-hNIS transfected ARO cells. On dynamic image, I-131 uptake of Ad-hNIS injected ARO tumor was continuously increased until 60 minutes. Mean count ratios of xenograft ARO tumors (R/L) of 60 minutes I-131 images at 2, 3, 4 and 6 days after Ad-hNIS injection were 2.85, 2.54, 2.31, and 2.18, each. On RT-PCR, hNIS expression of Ad-hNIS transfected ARO xenograft tumors was confirmed. Radioiodine uptake was successfully increased in ARO cells by adenovirus-mediated hNIs gene transfer both in vitro and in vivo.

  20. TRIPLICATE SODIUM IODIDE GAMMA RAY MONITORS FOR THE SMALL COLUMN ION EXCHANGE PROGRAM

    Energy Technology Data Exchange (ETDEWEB)

    Couture, A.

    2011-09-20

    This technical report contains recommendations from the Analytical Development (AD) organization of the Savannah River National Laboratory (SRNL) for a system of triplicate Sodium Iodide (NaI) detectors to be used to monitor Cesium-137 ({sup 137}Cs) content of the Decontaminated Salt Solution (DSS) output of the Small Column Ion Exchange (SCIX) process. These detectors need to be gain stabilized with respect to temperature shifts since they will be installed on top of Tank 41 at the Savannah River Site (SRS). This will be accomplished using NaI crystals doped with the alpha-emitting isotope, Americium-241({sup 241}Am). Two energy regions of the detector output will be monitored using single-channel analyzers (SCAs), the {sup 137}Cs full-energy {gamma}-ray peak and the {sup 241}Am alpha peak. The count rate in the gamma peak region will be proportional to the {sup 137}Cs content in the DSS output. The constant rate of alpha decay in the NaI crystal will be monitored and used as feedback to adjust the high voltage supply to the detector in response to temperature variation. An analysis of theoretical {sup 137}Cs breakthrough curves was used to estimate the gamma activity expected in the DSS output during a single iteration of the process. Count rates arising from the DSS and background sources were predicted using Microshield modeling software. The current plan for shielding the detectors within an enclosure with four-inch thick steel walls should allow the detectors to operate with the sensitivity required to perform these measurements. Calibration, testing, and maintenance requirements for the detector system are outlined as well. The purpose of SCIX is to remove and concentrate high-level radioisotopes from SRS salt waste resulting in two waste streams. The concentrated high-level waste containing {sup 137}Cs will be sent to the Defense Waste Processing Facility (DWPF) for vitrification and the low-level DSS will be sent to the Saltstone Production Facility (SPF

  1. Triplicate Sodium Iodide Gamma Ray Monitors For The Small Column Ion Exchange Program

    International Nuclear Information System (INIS)

    Couture, A.

    2011-01-01

    This technical report contains recommendations from the Analytical Development (AD) organization of the Savannah River National Laboratory (SRNL) for a system of triplicate Sodium Iodide (NaI) detectors to be used to monitor Cesium-137 ( 137 Cs) content of the Decontaminated Salt Solution (DSS) output of the Small Column Ion Exchange (SCIX) process. These detectors need to be gain stabilized with respect to temperature shifts since they will be installed on top of Tank 41 at the Savannah River Site (SRS). This will be accomplished using NaI crystals doped with the alpha-emitting isotope, Americium-241( 241 Am). Two energy regions of the detector output will be monitored using single-channel analyzers (SCAs), the 137 Cs full-energy γ-ray peak and the 241 Am alpha peak. The count rate in the gamma peak region will be proportional to the 137 Cs content in the DSS output. The constant rate of alpha decay in the NaI crystal will be monitored and used as feedback to adjust the high voltage supply to the detector in response to temperature variation. An analysis of theoretical 137 Cs breakthrough curves was used to estimate the gamma activity expected in the DSS output during a single iteration of the process. Count rates arising from the DSS and background sources were predicted using Microshield modeling software. The current plan for shielding the detectors within an enclosure with four-inch thick steel walls should allow the detectors to operate with the sensitivity required to perform these measurements. Calibration, testing, and maintenance requirements for the detector system are outlined as well. The purpose of SCIX is to remove and concentrate high-level radioisotopes from SRS salt waste resulting in two waste streams. The concentrated high-level waste containing 137 Cs will be sent to the Defense Waste Processing Facility (DWPF) for vitrification and the low-level DSS will be sent to the Saltstone Production Facility (SPF) to be incorporated into grout.

  2. P(MMA-EMA Random Copolymer Electrolytes Incorporating Sodium Iodide for Potential Application in a Dye-Sensitized Solar Cell

    Directory of Open Access Journals (Sweden)

    Nurul Akmaliah Dzulkurnain

    2015-02-01

    Full Text Available Polymer electrolytes based on 90 wt% of methyl methacrylate and 10 wt% of ethyl methacrylate (90MMA-co-10EMA incorporating different weight ratios of sodium iodide were prepared using the solution casting method. The complexation between salt and copolymer host has been investigated using Fourier transform infrared spectroscopy. The ionic conductivity and thermal stability of the electrolytes were measured using impedance spectroscopy and differential scanning calorimetry, respectively. Scanning electron microscopy was used to study the morphology of the polymer electrolytes. The ionic conductivity and glass transition temperature increased up to 20 wt% of sodium iodide (5.19 × 10−6 S·cm−1 and decreased with the further addition of salt concentration, because of the crosslinked effect. The morphology behavior of the highest conducting sample also showed smaller pores compared to the other concentration. The total ionic transference number proved that this system was mainly due to ions, and the electrochemical stability window was up to 2.5 V, which is suitable for a dye-sensitized solar cell application. This sample was then tested in a dye-sensitized solar cell and exhibited an efficiency of 0.62%.

  3. Real-Time Remediation Utilizing The Backpack Sodium Iodide System And The U.S. EPA Triad Approach

    International Nuclear Information System (INIS)

    John R. Giles; Michael V. Carpenter; Lyle G. Roybal; C. P. Oertel; J. J. Jacobson; D. L. Eaton; G. L. Schwendiman

    2006-01-01

    Real-time characterization during remediation activities is being accomplished at the Idaho National Laboratory (INL) with the use of the backpack sodium iodide system (BaSIS). The BaSIS is comprised of a 3-in. by 5-in. sodium iodide (NaI) detector, differential corrected global positioning system (GPS), and portable computer, integrated into a lightweight backpack deployment platform. The system is operated with specialized software that allows the operator and/or remediation field manager to view data as they are collected. Upon completion of planned excavation stages, the area is surveyed for residual radiological contamination. After data collection is complete, data is available to the remediation field manager as a contour map showing the area(s) that require further excavation. The use of real-time measurement systems, rapid turn-around time of data, and dynamic work strategy support the U.S. Environmental Protection Agency's (EPA) Triad approach. Decisions are made in real-time as to the need for further remediation. This paper describes the BaSIS system calibration, testing and use, and outlines negotiations with the appropriate CERCLA regulatory agencies (U.S. Environmental Protection Agency, Idaho Department of Environmental Quality, and U.S. Department of Energy Idaho Operations Office) to allow the use of real-time instrumentation during the remediation process, and for confirmation surveys. By using the BaSIS in such a manner, the INL seeks to demonstrate compliance with remediation objectives

  4. Development of a kinetic model and calculation of radiation dose estimates for sodium iodide-131I in athyroid individuals

    International Nuclear Information System (INIS)

    Rodriguez, M.

    1997-07-01

    The treatment for some thyroid carcinomas involves surgically removing the thyroid gland and administering the radiopharmaceutical Sodium iodide- 131 I (NaI). A diagnostic dose of NaI is given to the patient to determine if remnant tissue from the gland remains or larger doses are administered in order to treat the malignant tissue. Past research regarding NaI uptake and retention in euthyroid individuals (normal functioning thyroid) reveal that radioiodine concentrates mainly in the thyroid tissue and the remaining material is excreted from the body. The majority of radioiodine in athyroid (without thyroid) individuals is also eliminated from the body; however, there has been recent evidence of a long-term retention phase for individuals with no radioiodine concentrating tissue. The general purpose of this study was to develop a kinetic model and estimate the absorbed dose to athyroid individuals regarding the distribution and retention of NaI

  5. Chemical conversion of cisplatin and carboplatin with histidine in a model protein crystallized under sodium iodide conditions

    Energy Technology Data Exchange (ETDEWEB)

    Tanley, Simon W. M.; Helliwell, John R., E-mail: john.helliwell@manchester.ac.uk [University of Manchester, Brunswick Street, Manchester M13 9PL (United Kingdom)

    2014-08-29

    Crystals of HEWL with cisplatin and HEWL with carboplatin grown in sodium iodide conditions both show a partial chemical transformation of cisplatin or carboplatin to a transiodoplatin (PtI{sub 2}X{sub 2}) form. The binding is only at the N{sup δ} atom of His15. A further Pt species (PtI{sub 3}X) is also seen, in both cases bound in a crevice between symmetry-related protein molecules. Cisplatin and carboplatin are platinum anticancer agents that are used to treat a variety of cancers. Previous X-ray crystallographic studies of carboplatin binding to histidine in hen egg-white lysozyme (HEWL) showed a partial chemical conversion of carboplatin to cisplatin owing to the high sodium chloride concentration used in the crystallization conditions. Also, the co-crystallization of HEWL with carboplatin in sodium bromide conditions resulted in the partial conversion of carboplatin to the transbromoplatin form, with a portion of the cyclobutanedicarboxylate (CBDC) moiety still present. The results of the co-crystallization of HEWL with cisplatin or carboplatin in sodium iodide conditions are now reported in order to determine whether the cisplatin and carboplatin converted to the iodo form, and whether this took place in a similar way to the partial conversion of carboplatin to cisplatin in NaCl conditions or to transbromoplatin in NaBr conditions as seen previously. It is reported here that a partial chemical transformation has taken place to a transplatin form for both ligands. The NaI-grown crystals belonged to the monoclinic space group P2{sub 1} with two molecules in the asymmetric unit. The chemically transformed cisplatin and carboplatin bind to both His15 residues, i.e. in each asymmetric unit. The binding is only at the N{sup δ} atom of His15. A third platinum species is also seen in both conditions bound in a crevice between symmetry-related molecules. Here, the platinum is bound to three I atoms identified based on their anomalous difference electron densities

  6. Rate theory of ion pairing at the water liquid-vapor interface: A case of sodium iodide

    Science.gov (United States)

    Dang, Liem X.; Schenter, Gregory K.

    2018-06-01

    Studies on ion pairing at interfaces have been intensified recently because of their importance in many chemical reactive phenomena, such as ion-ion interactions that are affected by interfaces and their influence on kinetic processes. In this study, we performed simulations to examine the thermodynamics and kinetics of small polarizable sodium iodide ions in the bulk and near the water liquid-vapor interface. Using classical transition state theory, we calculated the dissociation rates and corrected them with transmission coefficients obtained from the reactive flux formalism and Grote-Hynes theory. Our results show that in addition to affecting the free energy of ions in solution, the interfacial environments significantly influence the kinetics of ion pairing. The results on the relaxation time obtained using the reactive flux formalism and Grote-Hynes theory present an unequivocal picture that the interface suppresses ion dissociation. The effects of the use of molecular models on the ion interactions as well as the ion-pair configurations at the interface are also quantified and discussed.

  7. Solitary pulmonary nodules: accuracy and cost-effectiveness of sodium iodide FDG-PET using Australian data

    International Nuclear Information System (INIS)

    Keith, C.J.; Miles, K.A.; Griffiths, M.R.; Wong, D.; Pitman, A.G.; Hicks, R.J.

    2002-01-01

    This study uses Australian data to confirm the accuracy of dedicated sodium iodide (NaI) fluorine-18 fluorodeoxyglucose positron emission tomography (FDG-PET) in evaluating indeterminate solitary pulmonary nodules (SPNs) and to determine the conditions under which PET could play a cost-effective role in this evaluation. Ninety-two patients from two Australian hospitals in different states underwent FDG-PET for evaluation of an SPN. Observed values for prior probability of malignancy and diagnostic accuracy of PET were applied to previously published decision tree models using published Australian health care costs. The accuracy of FDG-PET was 93% with a sensitivity of 92% and a specificity of 95%. The prior probability of malignancy (0.54), PET sensitivity and PET specificity indicated cost savings per patient of up to EUR 455 (A$ 774) based on a PET cost of EUR 706 (A$ 1,200). PET would remain cost-effective for levels of prior probability up to 0.8-0.9 and a PET cost of EUR 736-1,161 (A$ 1,252-A$ 1,974). It is concluded that NaI PET is accurate, cost saving and cost-effective for the characterisation of indeterminate pulmonary nodules in Australia. Comparison with previous reports from the United States confirms that FDG-PET can remain cost-effective despite population differences in medical costs, disease prevalence and PET diagnostic performance. (orig.)

  8. Photon mass energy absorption coefficients from 0.4 MeV to 10 MeV for silicon, carbon, copper and sodium iodide

    International Nuclear Information System (INIS)

    Oz, H.; Gurler, O.; Gultekin, A.; Yalcin, S.; Gundogdu, O.

    2006-01-01

    The absorption coefficients have been widely used for problems and applications involving dose calculations. Direct measurements of the coefficients are difficult, and theoretical computations are usually employed. In this paper, analytical equations are presented for determining the mass energy absorption coefficients for gamma rays with an incident energy range between 0.4 MeV and 10 MeV in silicon, carbon, copper and sodium iodide. The mass energy absorption coefficients for gamma rays were calculated, and the results obtained were compared with the values reported in the literature.

  9. Photon mass energy absorption coefficients from 0.4 MeV to 10 MeV for silicon, carbon, copper and sodium iodide

    Energy Technology Data Exchange (ETDEWEB)

    Oz, H.; Gurler, O.; Gultekin, A. [Uludag University, Bursa (Turkmenistan); Yalcin, S. [Kastamonu University, Kastamonu (Turkmenistan); Gundogdu, O. [University of Surrey, Guildford (United Kingdom)

    2006-07-15

    The absorption coefficients have been widely used for problems and applications involving dose calculations. Direct measurements of the coefficients are difficult, and theoretical computations are usually employed. In this paper, analytical equations are presented for determining the mass energy absorption coefficients for gamma rays with an incident energy range between 0.4 MeV and 10 MeV in silicon, carbon, copper and sodium iodide. The mass energy absorption coefficients for gamma rays were calculated, and the results obtained were compared with the values reported in the literature.

  10. A novel sodium iodide and ammonium molybdate co-catalytic system for the efficient synthesis of 2-benzimidazoles using hydrogen peroxide under ultrasound irradiation.

    Science.gov (United States)

    Bai, Guo-Yi; Lan, Xing-Wang; Chen, Guo-Feng; Liu, Xiao-Fang; Li, Tian-Yu; Shi, Ling-Juan

    2014-03-01

    The reaction of aldehydes and o-phenylenediamine for the preparation of 2-benzimidazoles has been studied using hydrogen peroxide as an oxidant under ultrasound irradiation at room temperature in this paper. The combination of substoichiometric sodium iodide and ammonium molybdate as co-catalysts, together with using small amounts of hydrogen peroxide, makes this transformation very efficient and attractive under ultrasound. Thus, a mild, green and efficient method is established to carry out this reaction in high yield. Copyright © 2013 Elsevier B.V. All rights reserved.

  11. Assessment of the Na/I symporter as a reporter gene to visualize oncolytic adenovirus propagation in peritoneal tumours

    International Nuclear Information System (INIS)

    Merron, Andrew; McNeish, Iain A.; Baril, Patrick; Tran, Lucile; Vassaux, Georges; Martin-Duque, Pilar; Vieja, Antonio de la; Briat, Arnaud; Harrington, Kevin J.

    2010-01-01

    In vivo imaging of the spread of oncolytic viruses using the Na/I symporter (NIS) has been proposed. Here, we assessed whether the presence of NIS in the viral genome affects the therapeutic efficacy of the oncolytic adenovirus dl922-947 following intraperitoneal administration, in a mouse model of peritoneal ovarian carcinoma. We generated AdAM7, a dl922-947 oncolytic adenovirus encoding the NIS coding sequence. Iodide uptake, NIS expression, infectivity and cell-killing activity of AdAM7, as well as that of relevant controls, were determined in vitro. In vivo, the propagation of this virus in the peritoneal cavity of tumour-bearing mice was determined using SPECT/CT imaging and its therapeutic efficacy was evaluated. In vitro infection of ovarian carcinoma IGROV-1 cells with ADAM7 led to functional expression of NIS. However, the insertion of NIS into the viral genome resulted in a loss of efficacy of the virus in terms of replication and cytotoxicity. In vivo, on SPECT/CT imaging AdAM7 was only detectable in the peritoneal cavity of animals bearing peritoneal ovarian tumours for up to 5 days after intraperitoneal administration. Therapeutic experiments in vivo demonstrated that AdAM7 is as potent as its NIS-negative counterpart. This study demonstrated that despite the detrimental effect observed in vitro, insertion of the reporter gene NIS in an oncolytic adenovirus did not affect its therapeutic efficacy in vivo. We conclude that NIS is a highly relevant reporter gene to monitor the fate of oncolytic adenovectors in live subjects. (orig.)

  12. Assessment of the Na/I symporter as a reporter gene to visualize oncolytic adenovirus propagation in peritoneal tumours

    Energy Technology Data Exchange (ETDEWEB)

    Merron, Andrew; McNeish, Iain A. [Queen Mary' s School of Medicine and Dentistry, Centre for Molecular Oncology, Institute of Cancer, London (United Kingdom); Baril, Patrick; Tran, Lucile; Vassaux, Georges [CHU Hotel Dieu, INSERM, Nantes (France); CHU de Nantes, Institut des Maladies de l' Appareil Digestif, Nantes (France); Martin-Duque, Pilar [Instituto Aragones de Ciencias de la Salud, Zaragoza (Spain); Vieja, Antonio de la [Instituto de Investigaciones Biomedicas, Madrid (Spain); Briat, Arnaud [INSERM U877, Grenoble (France); Harrington, Kevin J. [Chester Beatty Laboratories, Institute of Cancer Research, London (United Kingdom)

    2010-07-15

    In vivo imaging of the spread of oncolytic viruses using the Na/I symporter (NIS) has been proposed. Here, we assessed whether the presence of NIS in the viral genome affects the therapeutic efficacy of the oncolytic adenovirus dl922-947 following intraperitoneal administration, in a mouse model of peritoneal ovarian carcinoma. We generated AdAM7, a dl922-947 oncolytic adenovirus encoding the NIS coding sequence. Iodide uptake, NIS expression, infectivity and cell-killing activity of AdAM7, as well as that of relevant controls, were determined in vitro. In vivo, the propagation of this virus in the peritoneal cavity of tumour-bearing mice was determined using SPECT/CT imaging and its therapeutic efficacy was evaluated. In vitro infection of ovarian carcinoma IGROV-1 cells with ADAM7 led to functional expression of NIS. However, the insertion of NIS into the viral genome resulted in a loss of efficacy of the virus in terms of replication and cytotoxicity. In vivo, on SPECT/CT imaging AdAM7 was only detectable in the peritoneal cavity of animals bearing peritoneal ovarian tumours for up to 5 days after intraperitoneal administration. Therapeutic experiments in vivo demonstrated that AdAM7 is as potent as its NIS-negative counterpart. This study demonstrated that despite the detrimental effect observed in vitro, insertion of the reporter gene NIS in an oncolytic adenovirus did not affect its therapeutic efficacy in vivo. We conclude that NIS is a highly relevant reporter gene to monitor the fate of oncolytic adenovectors in live subjects. (orig.)

  13. Development of a kinetic model and calculation of radiation dose estimates for sodium iodide-{sup 131}I in athyroid individuals

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez, M.

    1997-07-01

    The treatment for some thyroid carcinomas involves surgically removing the thyroid gland and administering the radiopharmaceutical Sodium iodide-{sup 131}I (NaI). A diagnostic dose of NaI is given to the patient to determine if remnant tissue from the gland remains or larger doses are administered in order to treat the malignant tissue. Past research regarding NaI uptake and retention in euthyroid individuals (normal functioning thyroid) reveal that radioiodine concentrates mainly in the thyroid tissue and the remaining material is excreted from the body. The majority of radioiodine in athyroid (without thyroid) individuals is also eliminated from the body; however, there has been recent evidence of a long-term retention phase for individuals with no radioiodine concentrating tissue. The general purpose of this study was to develop a kinetic model and estimate the absorbed dose to athyroid individuals regarding the distribution and retention of NaI.

  14. Sensitivity and Specificity of Dual-Isotope 99mTc-Tetrofosmin and 123I Sodium Iodide Single Photon Emission Computed Tomography (SPECT) in Hyperparathyroidism.

    Science.gov (United States)

    Sommerauer, Michael; Graf, Carmen; Schäfer, Niklaus; Huber, Gerhard; Schneider, Paul; Wüthrich, Rudolf; Schmid, Christoph; Steinert, Hans

    2015-01-01

    Despite recommendations for 99mTc-tetrofosmin dual tracer imaging for hyperparathyroidism in current guidelines, no report was published on dual-isotope 99mTc-tetrofosmin and 123I sodium iodide single-photon-emission-computed-tomography (SPECT). We evaluated diagnostic accuracy and the impact of preoperative SPECT on the surgical procedures and disease outcomes. Analysis of 70 consecutive patients with primary hyperparathyroidism and 20 consecutive patients with tertiary hyperparathyroidism. Imaging findings were correlated with surgical results. Concomitant thyroid disease, pre- and postoperative laboratory measurements, histopathological results, type and duration of surgery were assessed. In primary hyperparathyroidism, SPECT had a sensitivity of 80% and a positive predictive value of 93% in patient-based analysis. Specificity was 99% in lesion-based analysis. Patients with positive SPECT elicit higher levels of parathyroid hormone and higher weight of resected parathyroids than SPECT-negative patients. Duration of parathyroid surgery was on average, approximately 40 minutes shorter in SPECT-positive than in SPECT-negative patients (89 ± 46 vs. 129 ± 41 minutes, p = 0.006); 86% of SPECT-positive and 50% of SPECT-negative patients had minimal invasive surgery (p = 0.021). SPECT had lower sensitivity (60%) in patients with tertiary hyperparathyroidism; however, 90% of these patients had multiple lesions and all of these patients had bilateral lesions. Dual-isotope SPECT with 99mTc-tetrofosmin and 123I sodium iodide has a high diagnostic value in patients with primary hyperparathyroidism and allows for saving of operation time. Higher levels of parathyroid hormone and higher glandular weight facilitated detection of parathyroid lesion. Diagnostic accuracy of preoperative imaging was lower in patients with tertiary hyperparathyroidism.

  15. Replacement of a photomultiplier tube in a 2-inch thallium-doped sodium iodide gamma spectrometer with silicon photomultipliers and a light guide

    Directory of Open Access Journals (Sweden)

    Chankyu Kim

    2015-06-01

    Full Text Available The thallium-doped sodium iodide [NaI(Tl] scintillation detector is preferred as a gamma spectrometer in many fields because of its general advantages. A silicon photomultiplier (SiPM has recently been developed and its application area has been expanded as an alternative to photomultiplier tubes (PMTs. It has merits such as a low operating voltage, compact size, cheap production cost, and magnetic resonance compatibility. In this study, an array of SiPMs is used to develop an NaI(Tl gamma spectrometer. To maintain detection efficiency, a commercial NaI(Tl 2′ × 2′ scintillator is used, and a light guide is used for the transport and collection of generated photons from the scintillator to the SiPMs without loss. The test light guides were fabricated with polymethyl methacrylate and reflective materials. The gamma spectrometer systems were set up and included light guides. Through a series of measurements, the characteristics of the light guides and the proposed gamma spectrometer were evaluated. Simulation of the light collection was accomplished using the DETECT 97 code (A. Levin, E. Hoskinson, and C. Moison, University of Michigan, USA to analyze the measurement results. The system, which included SiPMs and the light guide, achieved 14.11% full width at half maximum energy resolution at 662 keV.

  16. Neurotransmitter: Sodium Symporters: Caught in the Act!

    DEFF Research Database (Denmark)

    Malinauskaite, Lina

    The neurotransmitter: sodium symporters in the neurons. Communication between neurons is mediated by the release of molecules called neurotransmitters (blue dots) from first neuron and sensed by receptors on the surface of the second (purple sphere). The signal is ended by active reuptake...

  17. Chloride binding site of neurotransmitter sodium symporters

    DEFF Research Database (Denmark)

    Kantcheva, Adriana Krassimirova; Quick, Matthias; Shi, Lei

    2013-01-01

    Neurotransmitter:sodium symporters (NSSs) play a critical role in signaling by reuptake of neurotransmitters. Eukaryotic NSSs are chloride-dependent, whereas prokaryotic NSS homologs like LeuT are chloride-independent but contain an acidic residue (Glu290 in LeuT) at a site where eukaryotic NSSs...

  18. FOUNDING OF THE DISTRICT HOSPITAL IN NIS

    Directory of Open Access Journals (Sweden)

    Misa Zivic

    2007-01-01

    Full Text Available After the liberation of Nis from the Turks which took place on January 11th, 1878, there were two military hospitals: one was next to The Skull Tower and the other on the road to Leskovac and there was Islahana the civil institution which was not the forerunner of the district hospital in Nis. At first, they founded the military hospital in Nis in 1878 and then they founded The District Hospital on July 17th in 1881. The first director of the District hospital was Anton Zajicek. He is also the first graduated medical doctor in Nis. The District Hospital was situated on the left bank of the Nisava river in a private house.

  19. Training builds organizations in NIS.

    Science.gov (United States)

    1995-01-01

    The Centre for Development and Population Activities (CEDPA) has been using workshops to train nongovernmental organization (NGOs) managers in the Newly Independent States (NIS) of the former Soviet Union over the past year (1994). 7 were held in Ukraine and Moldova (with support from the Counterpart Foundation under an agreement with the US Agency for International Development), that covered skills for effective training and project proposal writing. The managers represented a variety of fields: environment, health, family planning, social services, consumer affairs, youth needs, women's programs, disabilities, education, and culture. Ralph Stone is CEDPA training director. Adrienne Allison, vice president of CEDPA, is a member of the Volunteer Executive Service Team (VEST), which conducts study tours to the area. A collaborative effort of the US government and the US private sector, VEST supports the development of the independent, civil, and services sectors of the new countries. In Washington, CEDPA conducted workshops on women's reproductive health (February and March) and on business policy and regulation (November and December) for Russians involved in family planning and small business development respectively. These were organized in conjunction with the University of California at Riverside and the Academy for Educational Development.

  20. SPECT Imaging for in vivo tracking of NIS containing stem cells

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Zhenghong

    2013-04-02

    Na+/I- symporter (NIS) gene as a reporter gene (imagene) for non-invasive imaging of infused stem cells distribution and persistence in vivo on small animal models. NIS is an intrinsic membrane glycoprotein that mediates active iodide (I-) uptake into normal thyroid follicular cells and other cells. The advantages of using NIS for non-invasive and repeated scintigraphic imaging in this application are: a) NIS is not a foreign gene and thus eliminate the immunoresponse problem; b) radiotracer or substrate for NIS is simply radioiodide (I-125, I- 123, I-124, and I-124) or [Tc-99m]-pertechnetate, no radiosynthesis is needed. It has been shown that NIS gene transfer can induce radioactive iodide uptake in a variety of cells and that xenografts expressing exogenous NIS could be imaged by non-invasive scintigraphic imaging. The specific aims are: 1.Determine the feasibility, stability and physiological effects of human NIS gene expression on human HSCs and MSCs in vitro. 2.Determine the engraftment of human HSC and MSC co-infused in NOD-SCID mice. 3.Transduce both a drug resistance gene and an imagene into bone marrow stem cells, and follow the dynamics of engraftment after selection in real time.

  1. Characterization of new polyol/H+ symporters in Debaryomyces hansenii.

    Directory of Open Access Journals (Sweden)

    Iliana Pereira

    Full Text Available Debaryomyces hansenii is a halotolerant yeast that produces and assimilates a wide variety of polyols. In this work we evaluate polyol transport in D. hansenii CBS 767, detecting the occurrence of polyol/H(+ (and sugar/H(+ symporter activity, through the transient extracellular alkalinization of unbuffered starved cell suspensions. From the D. hansenii genome database, we selected nine ORFs encoding putative transporter proteins to clone in a centromeric plasmid with C-terminal GFP tagging and screened for polyol/H(+ symporters by heterologous expression in Saccharomyces cerevisiae. Five distinct D. hansenii polyol/H(+ symporters were identified and characterized, with different specificities and affinities for polyols, namely one glycerol-specific (DhStl1, one D-galactitol-specific (DhSgl1, Symporter galactitol/H(+ 1, one D-(+-chiro-inositol-specific (DhSyi1, Symporter D-(+-chiro-inositol/H(+ 1, one for D-sorbitol/D-mannitol/ribitol/D-arabitol/D-galactitol (DhSyl1, Symporter Polyols 1 and another for D-sorbitol/D-mannitol/ribitol/D-arabitol (DhSyl2, Symporter Polyols 2. This work contributed to the annotation of new yeast polyol transporters, including two specific for uncommon substrates as galactitol and D-(+-chiro-inositol.

  2. Visualization of gene expression in the live subject using the Na/I symporter as a reporter gene: applications in biotherapy.

    Science.gov (United States)

    Baril, Patrick; Martin-Duque, Pilar; Vassaux, Georges

    2010-02-01

    Biotherapies involve the utilization of antibodies, genetically modified viruses, bacteria or cells for therapeutic purposes. Molecular imaging has the potential to provide unique information that will guarantee their biosafety in humans and provide a rationale for the future development of new generations of reagents. In this context, non-invasive imaging of gene expression is an attractive prospect, allowing precise, spacio-temporal measurements of gene expression in longitudinal studies involving gene transfer vectors. With the emergence of cell therapies in regenerative medicine, it is also possible to track cells injected into subjects. In this context, the Na/I symporter (NIS) has been used in preclinical studies. Associated with a relevant radiotracer ((123)I(-), (124)I(-), (99m)TcO4(-)), NIS can be used to monitor gene transfer and the spread of selectively replicative viruses in tumours as well as in cells with a therapeutic potential. In addition to its imaging potential, NIS can be used as a therapeutic transgene through its ability to concentrate therapeutic doses of radionuclides in target cells. This dual property has applications in cancer treatment and could also be used to eradicate cells with therapeutic potential in the case of adverse events. Through experience acquired in preclinical studies, we can expect that non-invasive molecular imaging using NIS as a transgene will be pivotal for monitoring in vivo the exact distribution and pharmacodynamics of gene expression in a precise and quantitative way. This review highlights the applications of NIS in biotherapy, with a particular emphasis on image-guided radiotherapy, monitoring of gene and vector biodistribution and trafficking of stem cells.

  3. Inhibition of miR-146b expression increases radioiodine-sensitivity in poorly differential thyroid carcinoma via positively regulating NIS expression

    Energy Technology Data Exchange (ETDEWEB)

    Li, Luchuan; Lv, Bin; Chen, Bo [Department of General Surgery, Shandong University Qilu Hospital, Jinan, Shandong 250012 (China); Guan, Ming [Department of General Surgery, Qihe People' s Hospital, Qihe, Shandong 251100 (China); Sun, Yongfeng [Department of General Surgery, Licheng District People' s Hospital, Jinan, Shandong 250115 (China); Li, Haipeng [Department of General Surgery, Caoxian People' s Hospital, Caoxian, Shandong 274400 (China); Zhang, Binbin; Ding, Changyuan; He, Shan [Department of General Surgery, Shandong University Qilu Hospital, Jinan, Shandong 250012 (China); Zeng, Qingdong, E-mail: qingdz0201@163.com [Department of General Surgery, Shandong University Qilu Hospital, Jinan, Shandong 250012 (China)

    2015-07-10

    Dedifferentiated thyroid carcinoma (DTC) with the loss of radioiodine uptake (RAIU) is often observed in clinical practice under radioiodine therapy, indicating the challenge for poor prognosis. MicroRNA (miRNA) has emerged as a promising therapeutic target in many diseases; yet, the role of miRNAs in RAIU has not been generally investigated. Based on recent studies about miRNA expression in papillary or follicular thyroid carcinomas, the expression profiles of several thyroid relative miRNAs were investigated in one DTC cell line, derived from normal DTC cells by radioiodine treatment. The top candidate miR-146b, with the most significant overexpression profiles in dedifferentiated cells, was picked up. Further research found that miR-146b could be negatively regulated by histone deacetylase 3 (HDAC3) in normal cells, indicating the correlation between miR-146b and Na{sup +}/I{sup −} symporter (NIS)-mediated RAIU. Fortunately, it was confirmed that miR-146b could regulate NIS expression/activity; what is more important, miR-146b interference would contribute to the recovery of radioiodine-sensitivity in dedifferentiated cells via positively regulating NIS. In the present study, it was concluded that NIS-mediated RAIU could be modulated by miR-146b; accordingly, miR-146b might serve as one of targets to enhance efficacy of radioactive therapy against poorly differential thyroid carcinoma (PDTC). - Highlights: • Significant upregulated miR-146b was picked up from thyroid relative miRNAs in DTC. • MiR-146b was negatively regulated by HDAC3 in normal thyroid carcinoma cells. • NIS activity and expression could be regulated by miR-146b in thyroid carcinoma. • MiR-146b inhibition could recover the decreased radioiodine-sensitivity of DTC cells.

  4. Interaction of measles virus vectors with Auger electron emitting radioisotopes

    International Nuclear Information System (INIS)

    Dingli, David; Peng, K.-W.; Harvey, Mary E.; Vongpunsawad, Sompong; Bergert, Elizabeth R.; Kyle, Robert A.; Cattaneo, Roberto; Morris, John C.; Russell, Stephen J.

    2005-01-01

    A recombinant measles virus (MV) expressing the sodium iodide symporter (NIS) is being considered for therapy of advanced multiple myeloma. Auger electrons selectively damage cells in which the isotope decays. We hypothesized that the Auger electron emitting isotope 125 I can be used to control viral proliferation. MV was engineered to express both carcinoembryonic antigen and NIS (MV-NICE). Cells were infected with MV-NICE and exposed to 125 I with appropriate controls. MV-NICE replication in vitro is inhibited by the selective uptake of 125 I by cells expressing NIS. Auger electron damage is partly mediated by free radicals and abrogated by glutathione. In myeloma xenografts, control of MV-NICE with 125 I was not possible under the conditions of the experiment. MV-NICE does not replicate faster in the presence of radiation. Auger electron emitting isotopes effectively stop propagation of MV vectors expressing NIS in vitro. Additional work is necessary to translate these observations in vivo

  5. HCUP National (Nationwide) Inpatient Sample (NIS) - Restricted Access File

    Data.gov (United States)

    U.S. Department of Health & Human Services — The NIS is the largest publicly available all-payer inpatient care database in the United States. It contains data from approximately 8 million hospital stays each...

  6. Flavonoids, Thyroid Iodide Uptake and Thyroid Cancer-A Review.

    Science.gov (United States)

    Gonçalves, Carlos F L; de Freitas, Mariana L; Ferreira, Andrea C F

    2017-06-12

    Thyroid cancer is the most common malignant tumor of the endocrine system and the incidence has been increasing in recent years. In a great part of the differentiated carcinomas, thyrocytes are capable of uptaking iodide. In these cases, the main therapeutic approach includes thyroidectomy followed by ablative therapy with radioiodine. However, in part of the patients, the capacity to concentrate iodide is lost due to down-regulation of the sodium-iodide symporter (NIS), the protein responsible for transporting iodide into the thyrocytes. Thus, therapy with radioiodide becomes ineffective, limiting therapeutic options and reducing the life expectancy of the patient. Excessive ingestion of some flavonoids has been associated with thyroid dysfunction and goiter. Nevertheless, studies have shown that some flavonoids can be beneficial for thyroid cancer, by reducing cell proliferation and increasing cell death, besides increasing NIS mRNA levels and iodide uptake. Recent data show that the flavonoids apingenin and rutin are capable of increasing NIS function and expression in vivo. Herein we review literature data regarding the effect of flavonoids on thyroid cancer, besides the effect of these compounds on the expression and function of the sodium-iodide symporter. We will also discuss the possibility of using flavonoids as adjuvants for therapy of thyroid cancer.

  7. Flavonoids, Thyroid Iodide Uptake and Thyroid Cancer—A Review

    Science.gov (United States)

    Gonçalves, Carlos F. L.; de Freitas, Mariana L.; Ferreira, Andrea C. F.

    2017-01-01

    Thyroid cancer is the most common malignant tumor of the endocrine system and the incidence has been increasing in recent years. In a great part of the differentiated carcinomas, thyrocytes are capable of uptaking iodide. In these cases, the main therapeutic approach includes thyroidectomy followed by ablative therapy with radioiodine. However, in part of the patients, the capacity to concentrate iodide is lost due to down-regulation of the sodium-iodide symporter (NIS), the protein responsible for transporting iodide into the thyrocytes. Thus, therapy with radioiodide becomes ineffective, limiting therapeutic options and reducing the life expectancy of the patient. Excessive ingestion of some flavonoids has been associated with thyroid dysfunction and goiter. Nevertheless, studies have shown that some flavonoids can be beneficial for thyroid cancer, by reducing cell proliferation and increasing cell death, besides increasing NIS mRNA levels and iodide uptake. Recent data show that the flavonoids apingenin and rutin are capable of increasing NIS function and expression in vivo. Herein we review literature data regarding the effect of flavonoids on thyroid cancer, besides the effect of these compounds on the expression and function of the sodium-iodide symporter. We will also discuss the possibility of using flavonoids as adjuvants for therapy of thyroid cancer. PMID:28604619

  8. SMOKING HABITS OF NIS PRESCHOOL CHILDREN'S PARENTS

    Directory of Open Access Journals (Sweden)

    Miodrag Vucic

    2007-10-01

    Full Text Available The greatest threat for the public health in Serbia is definitively smoking. 1,3 billion of people in the world are smokers and 4,9 million of death at the global level are direct consequences of smoking. If this smoking rhythm continues until 2020. the number of deaths caused by smoking will have been doubled. There are 4000 identified substances in the tobacco smoke, 50 of which have been proven to be carcinogenic. Nowdays, 14000 to 15000 young people in the developed countries and 68000-84000 in the underdeveloped contries begin to smoke. 700 millions of children, the half of the whole children population, are exposed to the passive smoking.The prevalence of smoking in Serbia, although reduced by 6,9% compared to 2000 is still very high and makes 33,6% of the whole population (38,1% of men and 29,9% of women.The aim of this study was to investigate the smoking habits of preschool children's parents, motivated by the fact that the children of that age are highly sensitive and susceptible to the toxic influence of tobacco smoke, but also to check the necessity for an aggressive public health programme implementation in the aimed populations.This research, as a cross-sectional stady, is carried out among preschool children's parents, children being 4 to 6 years old that attend nursery schools in Nis.The prevalence of smoking in preschool children's parents is extremely high, and makes 46% (45,1% of men and 46,9% of women. Having taken into consideration the parental role in upbringing and education of children, as well as the influence of passive smoking, the main conclusion is that the children's health is seriously endangered. Education, making new and maintaining already existing programmes and legal obligations considering smoking are significant steps for reducing smoking and promoting health.

  9. Performance evaluation of lanthanum bromide and sodium iodide radiological identifiers for measurements in open environments; Avaliação de desempenho de identificadores radiológicos de brometo de lantânio e iodeto de sódio para medições em ambientes abertos

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Luciano Santa Rita; Amorim, Aneuri de; Balthar, Mario Cesar V.; Santos, Avelino dos; Vilela, Paulo Ricardo T. de; Silva, Thiago de Medeiros Silveira; Vieira, Fábio Gomes, E-mail: lucianosantarita@gmail.com [Centro Tecnológico do Exército (IDQBRN/CTEx), Rio de Janeiro, RJ (Brazil). Instituto de Defesa Química, Biológica, Radiológica e Nuclear; Cardoso, Domingos D’Oliveira; Izidório, Ana Carolina dos Anjos da Cruz [Instituto Militar de Engenharia (IME), Rio de Janeiro, RJ (Brazil); Arbach, Mayara Nascimento [Instituto de Radioproteção e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil)

    2017-07-01

    The identification of radionuclides in open environments using portable radiological identifiers (IRP) with scintillators is fundamental for the performance of the operational teams of the Brazilian Army Institute of Chemical, Biological, Radiological and Nuclear Defense (IDQBRN). The response of the IRPs used in these measurements is of great importance in the field actions of the operational team aiming at reducing exposure and also for the population. The purpose of this work is to analyze the reliability of the IRP response of lanthanum bromide and sodium iodide by the measurement of the I-152, Cs-137 and Co-60 radioactive standards. (author)

  10. Principles of classification of NIS reserves ampersand resources

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    The newly independent states of the former Soviet Union (NIS) control large resources of uranium. These resources have been the subject of substantial debate within several forums of the Western uranium industry because of confusion surrounding the degree of correlation between the Soviet and various Western classification systems. As illustrated in this article, although developed independently of Western systems, the classification system used by the NIS is very definitive and provides a sound basis for resource reporting. In 1981 a new open-quotes System of Classification of Reserves and Resources of Mineral Depositsclose quotes was adopted. This classification system, which is still used today in the newly independent states of the former Soviet Union (NIS), subdivides mineral deposits into seven categories in three major groups, based on the level of exploration performed: (1) Explored Reserves (A, B, C 1 ); (2) Evaluated Reserves (C 2 ); and (3) Predicted Resources (P 1 , P 2 , P 3 )

  11. The distribution of work performed on a NIS junction

    DEFF Research Database (Denmark)

    Santos, Jaime Eduardo Vieira da Silva Moutinho; Ribeiro, Pedro; Kirchner, Stefan

    2016-01-01

    We propose an experimental setup to measure the work performed in a normal-metal/insulator/superconducting (NIS) junction, subjected to a voltage change and in contact with a thermal bath. We compute the performed work and argue that the associated heat release can be measured experimentally. Our...... results are based on an equivalence between the dynamics of the NIS junction and that of an assembly of two-level systems subjected to a circularly polarised field, for which we can determine the work-characteristic function exactly. The average work dissipated by the NIS junction, as well as its...... fluctuations, are determined. From the work characteristic function, we also compute the work probability-distribution and show that it does not have a Gaussian character. Our results allow for a direct experimental test of the Crooks–Tasaki fluctuation relation....

  12. The distribution of work performed on a NIS junction

    International Nuclear Information System (INIS)

    Santos, Jaime E; Ribeiro, Pedro; Kirchner, Stefan

    2016-01-01

    We propose an experimental setup to measure the work performed in a normal-metal/insulator/superconducting (NIS) junction, subjected to a voltage change and in contact with a thermal bath. We compute the performed work and argue that the associated heat release can be measured experimentally. Our results are based on an equivalence between the dynamics of the NIS junction and that of an assembly of two-level systems subjected to a circularly polarised field, for which we can determine the work-characteristic function exactly. The average work dissipated by the NIS junction, as well as its fluctuations, are determined. From the work characteristic function, we also compute the work probability-distribution and show that it does not have a Gaussian character. Our results allow for a direct experimental test of the Crooks–Tasaki fluctuation relation. (paper)

  13. The presence of modifiable residues in the core peptide part of precursor nisin is not crucial for precursor nisin interactions with NisB- and NisC.

    Directory of Open Access Journals (Sweden)

    Rustem Khusainov

    Full Text Available Precursor nisin is a model posttranslationally modified precursor lantibiotic that can be structurally divided into a leader peptide sequence and a modifiable core peptide part. The nisin core peptide clearly plays an important role in the precursor nisin-nisin modification enzymes interactions, since it has previously been shown that the construct containing only the nisin leader sequence is not sufficient to pull-down the nisin modification enzymes NisB and NisC. Serines and threonines in the core peptide part are the residues that NisB specifically dehydrates, and cysteines are the residues that NisC stereospecifically couples to the dehydrated amino acids. Here, we demonstrate that increasing the number of negatively charged residues in the core peptide part of precursor nisin, which are absent in wild-type nisin, does not abolish binding of precursor nisin to the modification enzymes NisB and NisC, but dramatically decreases the antimicrobial potency of these nisin mutants. An unnatural precursor nisin variant lacking all serines and threonines in the core peptide part and an unnatural precursor nisin variant lacking all cysteines in the core peptide part still bind the nisin modification enzymes NisB and NisC, suggesting that these residues are not essential for direct interactions with the nisin modification enzymes NisB and NisC. These results are important for lantibiotic engineering studies.

  14. Nursing Information System (NIS): A Tool for Qualitative Nursing ...

    African Journals Online (AJOL)

    Increasing health care cost, nurse shortages, high patient acuity and the need for more accuracy in care create the need for an effective Nursing Information System. This paper therefore highlights the relevance of NIS in enhancing professional growth and efficiency in nursing practice. It also opens up the anticipated ...

  15. Dėl žem. jeĩnis

    Directory of Open Access Journals (Sweden)

    Zigmas Zinkevičius

    2011-05-01

    Full Text Available CONCERNING SAMOGITIAN jeĩnis SummaryThe pronoun jeĩnis, -ė ʽhe, she’, noticed by V. Grinaveckis in a Samogitian dialect of Lithu­anian, is treated as an emphatic pronoun by the author of this paper. The pronoun originated on the basis of the epenthetic forms Acc. Sg. fem. jeĩnę and Instr. Sg. fem. jéine, used side by side with the regular dialect jeñję, jénje (= Standard Lith. Ją̃ją, ją́ja. The Nom. Sg. fem. jeĩnė (next to jeĩnę : jéine appeared according to the pattern kárvė : karvę : kárve; the Nom. Sg. masc. jeĩnis arose (next to jeĩnė according to the pattern medìnis : medìnė.

  16. Cloning of nis gene and Nisin purification from Lactococcus lactis ...

    African Journals Online (AJOL)

    The purified nisin by chloroform extraction was analyzed on 20% SDS-PAGE and gave sharp band at ~ 3.4 kDa. The 3 dimension structure of the purified Nisin was studied by CPHModels as pdb with chimera program. Keywords: Lactococcus lactis, nis cloning, 16S rRNA, chloroform extraction and SDS-PAGE

  17. Specificity and Application of the Lantibiotic Protease NisP

    Directory of Open Access Journals (Sweden)

    Manuel Montalbán-López

    2018-02-01

    Full Text Available Lantibiotics are ribosomally produced and posttranslationally modified peptides containing several lanthionine residues. They exhibit substantial antimicrobial activity against Gram-positive bacteria, including relevant pathogens. The production of the model lantibiotic nisin minimally requires the expression of the modification and export machinery. The last step during nisin maturation is the cleavage of the leader peptide. This liberates the active compound and is catalyzed by the cell wall-anchored protease NisP. Here, we report the production and purification of a soluble variant of NisP. This has enabled us to study its specificity and test its suitability for biotechnological applications. The ability of soluble NisP to cleave leaders from various substrates was tested with two sets of nisin variants. The first set was designed to investigate the influence of amino acid variations in the leader peptide or variations around the cleavage site. The second set was designed to study the influence of the lanthionine ring topology on the proteolytic efficiency. We show that the substrate promiscuity is higher than has previously been suggested. Our results demonstrate the importance of the arginine residue at the end of the leader peptide and the importance of lanthionine rings in the substrate for specific cleavage. Collectively, these data indicate that NisP is a suitable protease for the activation of diverse heterologously expressed lantibiotics, which is required to release active antimicrobial compounds.

  18. Internal radiotherapy of liver cancer with rat hepato-carcinoma-intestine-pancreas gene as a liver tumor-specific promoter

    Energy Technology Data Exchange (ETDEWEB)

    Herve, J.; Cunha, A. Sa; Liu, B.; Valogne, Y.; Longuet, M.; Bregerie, O.; Guettier, C.; Samuel, D.; Brechot, C.; Faivre, J. [Hop Paul Brousse, INSERM, Hepatobiliary Ctr, U785, F-94800 Villejuif (France); Herve, J.; Cunha, A. Sa; Liu, B.; Valogne, Y.; Longuet, M.; Bregerie, O.; Guettier, C.; Samuel, D.; Brechot, C.; Faivre, J. [Univ Paris Sud, Fac Med, F-94800 Villejuif (France); Boisgard, R.; Tavitian, B. [INSERM, U803, F-91400 Orsay (France); Boisgard, R.; Tavitian, B. [CEA, Serv Hosp Frederic Joliot, Lab Imagerie Mol Expt, F-91400 Orsay (France); Roux, J.; Cales, P. [Univ Angers, UPRES EA 3859, Lab Hemodynam Interact Fibrose et Invas Tumorale H, Angers (France); Clerc, J. [Hop Cochin, AP HP, Dept Nucl Med, F-75014 Paris (France)

    2008-07-01

    The hepato-carcinoma-intestine-pancreas (HIP) gene, also called pancreatitis-associated protein-1 (PAP1) or Reg III {alpha}, is activated in most human hepatocellular carcinomas (HCCs) but not in normal liver, which suggests that HIP regulatory sequence could be used as efficient liver tumor-specific promoters to express a therapeutic polynucleotide in liver cancer. The sodium iodide sym-porter (NIS), which has recognized therapeutic and reporter gene properties, is appropriate to evaluate the transcriptional strength and specificity of the HIP promoter in HCC. For this purpose, we constructed a recombinant rat HIP-NIS adeno-viral vector (AdrHIP-NIS), and evaluated its performance as a mediator of selective radio-iodide uptake in tumor hepatocytes. Western blot, immunofluorescence, and iodide uptake assays were performed in AdrHIP-NIS-infected primary hepatocytes and transformed hepatic and non-hepatic cells. Nuclear imaging, tissue counting and immuno-histo-chemistry were performed in normal and HCC-bearing Wistar rats infected with AdrHIP-NIS intra-tumorally or via the hepatic artery. In AdrHIP-NIS-infected transformed hepatic cells, functional NIS was strongly expressed, as in cells infected with a cytomegalovirus-NIS vector. No NIS expression was found in AdrHIP-NIS-infected normal hepatocytes or transformed non-hepatic cells. In rats bearing multi-nodular HCC, AdrHIP-NIS triggered functional NIS expression that was preferential in tumor hepatocytes. Administration of 18 mCi of {sup 131}I resulted in the destruction of AdrHIP-NIS-injected nodules. This study has identified the rHIP regulatory sequence as a potent liver tumor-specific promoter for the transfer of therapeutic genes, and AdrHIP-NIS-mediated. {sup 131}I therapy as a valuable option for the treatment of multi-nodular HCC. (authors)

  19. Internal radiotherapy of liver cancer with rat hepato-carcinoma-intestine-pancreas gene as a liver tumor-specific promoter

    International Nuclear Information System (INIS)

    Herve, J.; Cunha, A. Sa; Liu, B.; Valogne, Y.; Longuet, M.; Bregerie, O.; Guettier, C.; Samuel, D.; Brechot, C.; Faivre, J.; Herve, J.; Cunha, A. Sa; Liu, B.; Valogne, Y.; Longuet, M.; Bregerie, O.; Guettier, C.; Samuel, D.; Brechot, C.; Faivre, J.; Boisgard, R.; Tavitian, B.; Boisgard, R.; Tavitian, B.; Roux, J.; Cales, P.; Clerc, J.

    2008-01-01

    The hepato-carcinoma-intestine-pancreas (HIP) gene, also called pancreatitis-associated protein-1 (PAP1) or Reg III α, is activated in most human hepatocellular carcinomas (HCCs) but not in normal liver, which suggests that HIP regulatory sequence could be used as efficient liver tumor-specific promoters to express a therapeutic polynucleotide in liver cancer. The sodium iodide sym-porter (NIS), which has recognized therapeutic and reporter gene properties, is appropriate to evaluate the transcriptional strength and specificity of the HIP promoter in HCC. For this purpose, we constructed a recombinant rat HIP-NIS adeno-viral vector (AdrHIP-NIS), and evaluated its performance as a mediator of selective radio-iodide uptake in tumor hepatocytes. Western blot, immunofluorescence, and iodide uptake assays were performed in AdrHIP-NIS-infected primary hepatocytes and transformed hepatic and non-hepatic cells. Nuclear imaging, tissue counting and immuno-histo-chemistry were performed in normal and HCC-bearing Wistar rats infected with AdrHIP-NIS intra-tumorally or via the hepatic artery. In AdrHIP-NIS-infected transformed hepatic cells, functional NIS was strongly expressed, as in cells infected with a cytomegalovirus-NIS vector. No NIS expression was found in AdrHIP-NIS-infected normal hepatocytes or transformed non-hepatic cells. In rats bearing multi-nodular HCC, AdrHIP-NIS triggered functional NIS expression that was preferential in tumor hepatocytes. Administration of 18 mCi of 131 I resulted in the destruction of AdrHIP-NIS-injected nodules. This study has identified the rHIP regulatory sequence as a potent liver tumor-specific promoter for the transfer of therapeutic genes, and AdrHIP-NIS-mediated. 131 I therapy as a valuable option for the treatment of multi-nodular HCC. (authors)

  20. Abnormal radioiodine uptake on post-therapy whole body scan and sodium/iodine symporter expression in a dermoid cyst of the ovary: report of a case and review of the literature

    Energy Technology Data Exchange (ETDEWEB)

    Campenni, Alfredo; Baldari, Sergio, E-mail: acampenni@unime.ittalia [Dipartimento di Scienze Biomediche e delle Immagini Morfologiche e Funzionali, Unità di Medicina Nucleare, Università degli Studi di Messina, Messina (Italy); Giovinazzo, Salvatore; Ruggeri, Rosaria M. [Dipartimento di Medicina Clinica e Sperimentale, Unità di Endocrinologia, Università degli Studi di Messina (Italy); Tuccari, Giovanni [Dipartimento di Patologia Umana, Università degli Studi di Messina (Italy); Fogliani, Simone [Unità di Scienze Radiologiche, Ospedale di Milazzo, Messina (Italy)

    2015-08-15

    In patients affected by differentiated thyroid cancer, the whole-body scan (WBS) with 131-radioiodine, especially when performed after a therapeutic activity of {sup 131}I, represents a sensitive procedure for detecting thyroid remnant and/or metastatic disease. Nevertheless, a wide spectrum of potentially pitfalls has been reported. Herein we describe a 63-year-old woman affected by follicular thyroid cancer, who was accidentally found to have an abdominal mass at post-dose WBS (pWBS). pWBS showed abnormal radioiodine uptake in the upper mediastinum, consistent with lymph-node metastases, and a slight radioiodine uptake in an abdominal focal area. Computed tomography revealed an inhomogeneous mass in the pelvis, previously unrecognized. The lesion, surgically removed, was found to be a typical dermoid cyst of the ovary, without any evidence of thyroid tissue. By immunohistochemistry, a moderate expression of the sodium-iodine symporter (NIS) was demonstrated in the epithelial cells, suggesting a NIS-dependent uptake of radioiodine by the cyst. (author)

  1. deNIS IIplus - computer-assisted crisis management system

    International Nuclear Information System (INIS)

    Corr, B.

    2007-01-01

    The management of catastrophes, as natural disasters or manmade disasters, will only be effective and successful if all relevant information is available in time for decision-makers. During previous large-scale disasters it became evident that information needed for the disaster management was only partially available and that there were fundamental deficits in regard to the flow of information between federal states (''Laender'') as well as communication problems between disaster response teams in the effected regions. On this account in summer 2001 the Federal Ministry of the Interior has decided to develop the ''German Emergency Preparedness Information System (deNIS)''. The aim of the enhanced version deNIS II plus is to built up a network for the civil and disaster response and to assist as an information and communication system for decision-makers of the Federal Government and the Laender Governments to better co-ordination relief and rescue teams in the event of a natural disaster or technical accident. Correspondingly the primary task of deNIS is to support the decision-making of disaster management authorities. (orig.)

  2. Preparation of a recombinant adenoviral encoding human NIS gene and its specific expression in cardiomyocytes

    International Nuclear Information System (INIS)

    Wang Lihua; Zhang Miao; Guo Rui; Shi Shuo; Li Biao

    2012-01-01

    Objective: To construct a recombinant adenovirus vector containing the human NIS gene with the myosin light chain-2(MLC-2v) gene as the promoter and evaluate its specific expression and feasibility as a reporter gene in cardiomyocytes. Methods: MLC-2v promoter and NIS were subcloned into an adenovirus shuttle vector, and forwarded by homologous recombination in the bacteria BJ5183 containing AdEasy-1 plasmid. Positive recombinant adenovirus vector was selected, packaged and amplified in the HEK293 cells to obtain recombinant adenovirus Ad-MLC-NIS. Ad-cytomegalovirus (CMV)-NIS with cytomegalovirus as the promoter, Ad-MLC without NIS and Ad-NIS without promoter were constructed as the controls. Cardiomyocytes and non-cardiomyocytes were then infected by the adenovirus. The protein expression was tested by Western blot analysis. The function and features of NIS protein were evaluated by dynamic iodide uptake and NaClO 4 iodine uptake inhibition test in vitro. The viability and proliferation of cardiomyocytes after adenovirus transfection and radioiodine incubation were checked by trypan blue staining. Results: Recombinant NIS adenovirus was successfully constructed. Western blot analysis showed that the NIS protein was highly expressed in cardiomyocytes transfected with Ad-MLC-NIS, and all cells transfected with Ad-CMV-NIS. However, in non-cardiomyocytes transfected with Ad-MLC-NIS, little NIS protein was detected. Dynamic iodine uptake tests showed that the peaks of iodide uptake of the three different cell lines (H9C2, A549, U87 cell) transfected with Ad-MLC-NIS were 5844.0, 833.6 and 846.0 counts · min -1 , respectively. The iodide uptake function of H9C2 was inhibited by NaClO 4 . There was almost no change in cell viability and proliferation when the MOI was 100. Conclusions: Ad-MLC-NIS allows myocardial specific expression of an external gene, and the cardiomyocytes with NIS expression are capable of iodine uptake. Further research of NIS as a reporter gene in

  3. In vitro evaluation of cardiomyogenic differentiation of bone marrow derived mesenchymal stem cells (MSCs)

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Min Hwan; Lee, Yong Jin; Kang, Joo Hyun [Korea Institute of Radiological and Medical Sciences, Seoul (Korea, Republic of)

    2010-10-15

    Bone marrow derived mesenchymal stem cells (MSCs) are excellent candidate as therapeutic agent for cell therapy. MSCs can be expanded in vitro rapidly (more than 3-5 fold in a weeks), and maintained their stem cell properties for a long culture period. Recently, many investigators have suggested that MSCs have ability to differentiate into cardiomyocytes by given appropriate condition in vitro or in vivo. Although, MSCs may be useful cell therapeutic agents in heart disease, there are still exist major barriers to track their capacity to differentiate into functional cardiomyocytes. In our previous study, the transgenic mouse model expressing sodium iodide symporter (NIS) driven by {alpha}-myosin heavy chain ({alpha}-MHC) promoter was developed to image cardiomyocyte with {gamma}-camera and microPET in vivo. In this study, we investigate the monitoring availability of {alpha}-MHC driven NIS gene of MSCs from the transgenic mouse during cardiomyogenic differentiation in vitro

  4. pH Regulation of Electrogenic Sugar/H+ Symport in MFS Sugar Permeases

    Science.gov (United States)

    Bazzone, Andre; Madej, M. Gregor; Kaback, H. Ronald

    2016-01-01

    Bacterial sugar symporters in the Major Facilitator Superfamily (MFS) use the H+ (and in a few cases Na+) electrochemical gradients to achieve active transport of sugar into the cell. Because a number of structures of MFS sugar symporters have been solved recently, molecular insight into the transport mechanism is possible from detailed functional analysis. We present here a comparative electrophysiological study of the lactose permease (LacY), the fucose permease (FucP) and the xylose permease (XylE), which reveals common mechanistic principles and differences. In all three symporters energetically downhill electrogenic sugar/H+ symport is observed. Comparison of the pH dependence of symport at symmetrical pH exhibits broad bell-shaped pH profiles extending over 3 to 6 pH units and a decrease at extremely alkaline pH ≥ 9.4 and at acidic to neutral pH = 4.6–7.5. The pH dependence can be described by an acidic to neutral apparent pK (pKapp) and an alkaline pKapp. Experimental evidence suggests that the alkaline pKapp is due to H+ depletion at the protonation site, while the acidic pKapp is due to inhibition of deprotonation. Since previous studies suggest that a single carboxyl group in LacY (Glu325) may be the only side chain directly involved in H+ translocation and a carboxyl side chain with similar properties has been identified in FucP (Asp46) and XylE (Asp27), the present results imply that the pK of this residue is switched during H+/sugar symport in all three symporters. PMID:27227677

  5. IAEA co-ordinated technical support programme to the NIS

    International Nuclear Information System (INIS)

    Olsen, R.; Murakami, K.; Blacker, C.; Sharma, S.K.

    1999-01-01

    With most Newly Independent States (NIS) of the former Soviet Union becoming parties to the Non-Proliferation Treaty as Non-Nuclear Weapon States, there has been an acute need in these states for considerable assistance for the establishment of the necessary structure and resources to ensure that their commitments to non-proliferation are fully implemented in a timely manner. A number of IAEA Member States have offered and are now providing assistance to the NIS on a bilateral level to set up an appropriate State System of Accounting and Control (SSAC) which includes Import/Export Control and Physical Protection of Nuclear Material in each state. The IAEA and these Member States established the Co-ordinated Technical Support Programme (CTSP) to ensure that the support given to the NIS was done in a co-ordinated and transparent manner and to avoid duplication of effort. The IAEA has played a coordinating role for the past 5 years by helping to identify detailed needs in individual States, by providing a platform for Member States to identify areas where they could provide the optimum support, and in developing and preparing the Co-ordinated Technical Support Plans. The IAEA organises annual meetings in Vienna attended by all donor and recipient countries to review the focus and implementation status of the co-ordinated technical support activities. A position statement is made by each donor and recipient country, and views and experiences are exchanged. The contents of the CTSPs and the role of the Agency in monitoring the progress of the individual tasks are reviewed in this paper. A summary comparing the implementation status of the Programme by each country is presented. (author)

  6. In vivo SPECT reporter gene imaging of regulatory T cells.

    Directory of Open Access Journals (Sweden)

    Ehsan Sharif-Paghaleh

    Full Text Available Regulatory T cells (Tregs were identified several years ago and are key in controlling autoimmune diseases and limiting immune responses to foreign antigens, including alloantigens. In vivo imaging techniques including intravital microscopy as well as whole body imaging using bioluminescence probes have contributed to the understanding of in vivo Treg function, their mechanisms of action and target cells. Imaging of the human sodium/iodide symporter via Single Photon Emission Computed Tomography (SPECT has been used to image various cell types in vivo. It has several advantages over the aforementioned imaging techniques including high sensitivity, it allows non-invasive whole body studies of viable cell migration and localisation of cells over time and lastly it may offer the possibility to be translated to the clinic. This study addresses whether SPECT/CT imaging can be used to visualise the migratory pattern of Tregs in vivo. Treg lines derived from CD4(+CD25(+FoxP3(+ cells were retrovirally transduced with a construct encoding for the human Sodium Iodide Symporter (NIS and the fluorescent protein mCherry and stimulated with autologous DCs. NIS expressing self-specific Tregs were specifically radiolabelled in vitro with Technetium-99m pertechnetate ((99mTcO(4(- and exposure of these cells to radioactivity did not affect cell viability, phenotype or function. In addition adoptively transferred Treg-NIS cells were imaged in vivo in C57BL/6 (BL/6 mice by SPECT/CT using (99mTcO(4(-. After 24 hours NIS expressing Tregs were observed in the spleen and their localisation was further confirmed by organ biodistribution studies and flow cytometry analysis. The data presented here suggests that SPECT/CT imaging can be utilised in preclinical imaging studies of adoptively transferred Tregs without affecting Treg function and viability thereby allowing longitudinal studies within disease models.

  7. Combination therapy and evaluation of therapeutic effect in hepatocellular carcinoma cell using triple reporter genes; containing for NIS, HSV1-sr39tk and GFP

    Energy Technology Data Exchange (ETDEWEB)

    Lee, You La; Lee, Yong Jin; Ahn, Sohn Joo; Ahn, Byeong Cheol; Lee, Sang Woo; Yoo, Jeong Soo; Lee, Jae Tae [Kyungpook National University, Daegu (Korea, Republic of)

    2007-07-01

    To identify therapeutic effect after combine Sodium Iodine Symporter (NIS) and Mutant Herpes-simplex virus type 1 sr39tk (HSV1-sr39tk) expression in hepatocellular carcinoma cell, we transfected triple gene and investigated the properties of these gene ability in hepatocellular carcinoma cell line. After making vector with gene encoding a fusion protein comprised of HSV1-sr39tk and green florescence protein (GFP), to make triple reporter genes NIS gene was further fused to the vector using IRES vector. The vector expressing triple reporter gene was transfected to the Huh-7 cell line using liposome. Functions of hNIS and HSV1-sr39tk expression were confirmed by radio iodine uptake with and without perchlorate and [3H]-penciclovir (3-H PCV) uptake, respectively. To evaluate therapeutic effect in vitro, GCV and I-131 was treated in Huh-7/NTG cell and dual therapy performed. An animal imaging acquired using Optix and microPET in vivo. I-125 uptake was increased up to 100-fold compare to that of non-transfected cells. The transfected cell accumulated H-3 PCV up to 53 times higher at 2 hour than that of non-transfected cells. With fluorescence microscopy, green fluorescence was detected in the transfected cell. In cytotoxic studies, the cell viability of Huh-7/NTG cell was decreased to 41 % of control cell at 10ug/ml GCV concentrations. The survival rate of the Huh-7/NTG cell treated with I-131 decreased up to 16%. In I-131 and GCV dual therapy, Huh-7/NTG cell survival rate decreased up to 4%. In animal studies, Huh-7/NTG tumors showed higher uptake of 18F-FHBG and I-124 than Huh-7 tumors. GFP signal is also higher in Huh-7/NTG tumor than control. We successfully constructed a vector with delivery two therapeutic genes and one reporter gene and transfected the vector to a Huh-7 cell. The hepatocellular carcinoma cell transfected with the vector can be treated with GCV and I-131. The effect of dual gene therapy could be easily assessed by the optical reporter gene imaging.

  8. O ténis e a moda

    OpenAIRE

    Morais-Alexandre, Paulo

    2010-01-01

    Interagindo com a evolução do vestuário, o desporto em geral e o ténis em particular têm influenciado ao longo dos tempos a Moda, sendo o contrário também verdadeiro. Assim, muitos dos trajes adaptados à prática desportiva vão passando para o traje quotidiano, da mesma forma que algumas das inovações da Moda são incorporadas no vestuário usado para praticar desporto, ao nível da forma, mas também das cores, padrões, ornamentos, etc., sendo ainda possível verificar neste âmbito a influência do...

  9. Transition metal ion FRET uncovers K(+) regulation of a neurotransmitter/sodium symporter

    DEFF Research Database (Denmark)

    Billesbølle, Christian B; Mortensen, Jonas S; Sohail, Azmat

    2016-01-01

    Neurotransmitter/sodium symporters (NSSs) are responsible for Na(+)-dependent reuptake of neurotransmitters and represent key targets for antidepressants and psychostimulants. LeuT, a prokaryotic NSS protein, constitutes a primary structural model for these transporters. Here we show that K...

  10. Identification of essential amino acid residues in the nisin dehydratase NisB

    Directory of Open Access Journals (Sweden)

    Rustem eKhusainov

    2015-02-01

    Full Text Available Nisin is a posttranslationally-modified antimicrobial peptide that has the ability to induce its own biosynthesis. Serines and threonines in the modifiable core peptide part of precursor nisin are dehydrated to dehydroalanines and dehydrobutyrines by the dehydratase NisB, and subsequently cysteines are coupled to the dehydroamino acids by the cyclase NisC. In this study, we applied extensive site-directed mutagenesis, together with direct binding studies, to investigate the molecular mechanism of the dehydratase NisB. We use a natural nisin-producing strain as a host to probe mutant-NisB functionality. Importantly, we are able to differentiate between intracellular and secreted fully dehydrated precursor nisin, enabling investigation of the NisB properties needed for the release of dehydrated precursor nisin to its devoted secretion system NisT. We report that single amino acid substitutions of conserved residues, i.e. R83A, R83M and R87A result in incomplete dehydration of precursor nisin and prevention of secretion. Single point NisB mutants Y80F and H961A, result in a complete lack of dehydration of precursor nisin, but do not abrogate precursor nisin binding. The data indicate that residues Y80 and H961 are directly involved in catalysis, fitting well with their position in the recently published 3D-structure of NisB. We confirm, by in vivo studies, results that were previously obtained from in vitro experiments and NisB structure elucidation and show that previous findings translate well to effects seen in the original production host.

  11. Progress in Gene Therapy for Prostate Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Ahmed, Kamran A.; Davis, Brian J. [Department of Radiation Oncology, Mayo Clinic, Rochester, MN (United States); Wilson, Torrence M. [Department of Urology, Mayo Clinic, Rochester, MN (United States); Wiseman, Gregory A. [Division of Nuclear Medicine, Mayo Clinic, Rochester, MN (United States); Federspiel, Mark J. [Department of Molecular Medicine, Mayo Clinic, Rochester, MN (United States); Morris, John C., E-mail: davis.brian@mayo.edu [Division of Endocrinology, Mayo Clinic, Rochester, MN (United States)

    2012-11-19

    Gene therapy has held promise to correct various disease processes. Prostate cancer represents the second leading cause of cancer death in American men. A number of clinical trials involving gene therapy for the treatment of prostate cancer have been reported. The ability to efficiently transduce tumors with effective levels of therapeutic genes has been identified as a fundamental barrier to effective cancer gene therapy. The approach utilizing gene therapy in prostate cancer patients at our institution attempts to address this deficiency. The sodium-iodide symporter (NIS) is responsible for the ability of the thyroid gland to transport and concentrate iodide. The characteristics of the NIS gene suggest that it could represent an ideal therapeutic gene for cancer therapy. Published results from Mayo Clinic researchers have indicated several important successes with the use of the NIS gene and prostate gene therapy. Studies have demonstrated that transfer of the human NIS gene into prostate cancer using adenovirus vectors in vitro and in vivo results in efficient uptake of radioactive iodine and significant tumor growth delay with prolongation of survival. Preclinical successes have culminated in the opening of a phase I trial for patients with advanced prostate disease which is currently accruing patients. Further study will reveal the clinical promise of NIS gene therapy in the treatment of prostate as well as other malignancies.

  12. Progress in Gene Therapy for Prostate Cancer

    International Nuclear Information System (INIS)

    Ahmed, Kamran A.; Davis, Brian J.; Wilson, Torrence M.; Wiseman, Gregory A.; Federspiel, Mark J.; Morris, John C.

    2012-01-01

    Gene therapy has held promise to correct various disease processes. Prostate cancer represents the second leading cause of cancer death in American men. A number of clinical trials involving gene therapy for the treatment of prostate cancer have been reported. The ability to efficiently transduce tumors with effective levels of therapeutic genes has been identified as a fundamental barrier to effective cancer gene therapy. The approach utilizing gene therapy in prostate cancer patients at our institution attempts to address this deficiency. The sodium-iodide symporter (NIS) is responsible for the ability of the thyroid gland to transport and concentrate iodide. The characteristics of the NIS gene suggest that it could represent an ideal therapeutic gene for cancer therapy. Published results from Mayo Clinic researchers have indicated several important successes with the use of the NIS gene and prostate gene therapy. Studies have demonstrated that transfer of the human NIS gene into prostate cancer using adenovirus vectors in vitro and in vivo results in efficient uptake of radioactive iodine and significant tumor growth delay with prolongation of survival. Preclinical successes have culminated in the opening of a phase I trial for patients with advanced prostate disease which is currently accruing patients. Further study will reveal the clinical promise of NIS gene therapy in the treatment of prostate as well as other malignancies.

  13. SANITARY ASPECT OF NUTRITION CONTROL IN PUBLIC KITCHEN IN NIS

    Directory of Open Access Journals (Sweden)

    Suzana Milutinovic

    2006-07-01

    Full Text Available The aim of the paper was to evaluate sanitary condition of food preparation and distribution in the "Public kitchen" in Nis, as well as the meals’ quality in order to assess the health risks. The local inspection of the objects and microbiological analysis of swaps were done according to standard methods. Energetical values and biochemical structure of the meals were assessed by bromatological methods and energetical density was calculated. The study was being conducted from 2002 – 2005. The results show that sanitary conditions in the object were not adequate, because of a high percentage of incorrect samples (13.4% from the total number of samples. Energetical values of meals were usually adequate (1157 – 1564 kcal, 4837 – 6581 kJ, but constantly decreased. The chemical structure of the meals was adequate too, meaning that meals were very well- planed. The energetic density of meals was high (1,18 – 1,42 kcal/g. Our conclusion is that there are no alternatives to continuous health care education of the medical stuff and regular sanitary hygienic control, all with the aim to accomplish complete social function of the public kitchen and to protect the health of its consumers.

  14. Magnetic field measurement in the analyzing magnet of NIS spectrometer

    Science.gov (United States)

    Avramenko, S. A.; Afanas'ev, S. V.; Voloshina, I. G.; Dolgii, S. A.; Yusupov, A. Yu.; Kalmykov, A. V.; Makoveev, V. K.; Nikolaevskii, G. P.; Ostrovskii, I. V.; Perepelkin, E. E.; Peresedov, V. F.; Plyashkevich, S. N.; Rossiiskaya, N. S.; Salmin, R. A.; Spodarets, V. K.; Strokovskii, E. A.; Yudin, I. P.

    2006-12-01

    The main goals of the Nucleon Intrinsic Strangeness experiment (NIS) are the search for the effects of hidden polarized strangeness in the nucleon and the exploration and study of exotic baryons (pentaquarks) in NN reactions. The setup is located in the Laboratory of High Energies at the Joint Institute for Nuclear Research in channel 4V of the Nuclotron extracted beam with the energy between 1 and 4 GeV. The 1SP-40-4V electromagnet of the spectrometer has the external dimensions 3.20 × 3.26 × 4.48 m and the aperture 2.74 × 0.68 m. The magnetic field measurement was performed using the three-component Hall magnetometer in the computer-controlled automated mode. The volume of measurements was 1.03 × 0.60 × 3.92 m. The description of the measuring equipment and measurement procedure is given. The results of the measurements are used for the Monte Carlo computer modeling of the experiment. These results will be used in the analysis of physical data after their acquisition.

  15. The effect of 17-AAG on iodine uptake kinetics of NIS-transfected anaplastic thyroid cancer

    International Nuclear Information System (INIS)

    Wang Renfei; Tan Jian; Li Wei; Meng Zhaowei; Zheng Wei

    2012-01-01

    Objective: To investigate the effect of 17-allylamino-17-demethoxy geldanamycin (17-AAG) on iodine uptake kinetics of NIS-transfected anaplastic thyroid cancer (ATC) cells. Methods: Lipofection was used to transfect the recombinant plasmid, namely pcDNA3.1-NIS, into FRO cells (ATC cell line). A stable cell line NIS-FRO was obtained by G418 resistance selection. 125 I was added into the medium, and influx and efflux experiments were performed. Different time-radioactivity curves were drawn, and further analysis was performed between the non-transfected cells (the control group) and NIS-FRO cells treated with 1 μmol/L 17-AAG for 24 h. Student's t-test was used to analyze the data. Results: The iodine uptake ability of the NIS-FRO cells was significantly higher than that of the FRO cells (about 10.68 times, t=45.329, P<0.001). However, 125 I out-flowed rapidly when removed from the medium, and the retention rate of 125 I in the NIS-FRO cells was only 10.5% of the initial amount after 30 rin. After treatment with 1 μmol/L 17-AAG for 24 h, the 125 I uptake ability of NIS-FRO cells further increased. During the 20-60 min incubation with 125 I, the iodine uptake ability of 17-AAG treated NIS-FRO cells increased significantly with radioactive counts of 31771.8- 54815.5 per minute,which was much higher than that of the control group (24020.3-41293.8 per minute; t=3.096, 4.275, 3.055, 4.292 and 5.496, respectively, all P<0.05). The iodine uptake ability increased about 24.8%-35.5%. Furthermore, 5-30 min after removing the medium, the retention rates of 125 I in the 17-AAG treated NIS-FRO cells were significantly increased compared with those of the control group (32.7%-85.2% vs 10.5%-56.8%; t=22.801, 13.096, 19.631, 38.205, 43.519, 29.322, respectively, all P<0.01), and 125 I efflux was reduced. After 30 min, 125 I retention rate of the treatment group was 32.7%, which was 3.1 times higher than that of the control group. Conclusion: The iodine uptake ability can be

  16. Nuclear legislation in central and eastern europe and the NIS

    International Nuclear Information System (INIS)

    2003-01-01

    This study presents the current state of legislation and regulations governing the peaceful uses of nuclear energy in the central and eastern European countries (CEEC) and the New Independent States (NIS). It also contains information on the national bodies responsible for the regulation and control of nuclear energy. The nuclear energy sector has not escaped from the changes that have affected the political, economic and social climates over the past fifteen years. Under the former socialist regime, activities in this field came within the sole remit of the State administration. In the legal area, it had not been deemed necessary in most of these countries to enact laws guaranteeing democratic control of electronuclear programmes and establishing a clear distinction between activities promoting this source of energy and regulatory control, while ensuring that safety imperatives take priority over all other considerations. With the arrival of new political forces came the will to remedy this situation promptly by creating new regulatory structures and drafting legislative texts based on those used in western countries. This evolution was all the more necessary given that, at the same time, the new policy of accountability had revealed safety defects in numerous nuclear installations in these countries, thus rendering international assistance indispensable. From the legal point of view, the outcome of these years of effort is remarkably positive: almost all countries of Eastern Europe pursuing electronuclear programmes have established institutions capable of exercising efficient control over nuclear power plants and other installations. Accession to the international conventions which form the backbone of nuclear law has become widespread. Modern legislation is henceforth in place in almost all of these states. (author)

  17. Microwave-assisted synthesis of NiS2 nanostructures for supercapacitors and cocatalytic enhancing photocatalytic H2 production

    Science.gov (United States)

    Pang, Huan; Wei, Chengzhen; Li, Xuexue; Li, Guochang; Ma, Yahui; Li, Sujuan; Chen, Jing; Zhang, Jiangshan

    2014-01-01

    Uniform NiS2 nanocubes are successfully synthesized with a microwave-assisted method. Interestingly, NiS2 nanocubes, nanospheres and nanoparticles are obtained by controlling microwave reaction time. NiS2 nanomaterials are primarily applied to supercapacitors and cocatalytic enhancing photocatalytic H2 production. Different morphologies of NiS2 nanostructures show different electrochemical and cocatalytic enhancing H2 production activities. Benefited novel nanostructures, NiS2 nanocube electrodes show a large specific capacitance (695 F g-1 at 1.25 A g-1) and excellent cycling performance (the retention 93.4% of initial specific capacitance after 3000 cycles). More importantly, NiS2 nanospheres show highly cocatalytic enhancing photocatalytic for H2 evolution, in which the photocatalytic H2 production is up to 3400 μmol during 12 hours under irradiation of visible light (λ>420 nm) with an average H2 production rate of 283 μmol h-1.

  18. Substrate-Na{sup +} complex formation: Coupling mechanism for {gamma}-aminobutyrate symporters

    Energy Technology Data Exchange (ETDEWEB)

    Pallo, Anna; Simon, Agnes [Department of Neurochemistry, Institute of Biomolecular Chemistry, Chemical Research Center, Hungarian Academy of Sciences (Hungary); Bencsura, Akos [Department of Theoretical Chemistry, Institute of Structural Chemistry, Chemical Research Center, Hungarian Academy of Sciences, Budapest (Hungary); Heja, Laszlo [Department of Neurochemistry, Institute of Biomolecular Chemistry, Chemical Research Center, Hungarian Academy of Sciences (Hungary); Kardos, Julianna, E-mail: jkardos@chemres.hu [Department of Neurochemistry, Institute of Biomolecular Chemistry, Chemical Research Center, Hungarian Academy of Sciences (Hungary)

    2009-07-24

    Crystal structures of transmembrane transport proteins belonging to the important families of neurotransmitter-sodium symporters reveal how they transport neurotransmitters across membranes. Substrate-induced structural conformations of gated neurotransmitter-sodium symporters have been in the focus of research, however, a key question concerning the mechanism of Na{sup +} ion coupling remained unanswered. Homology models of human glial transporter subtypes of the major inhibitory neurotransmitter {gamma}-aminobutyric acid were built. In accordance with selectivity data for subtype 2 vs. 3, docking and molecular dynamics calculations suggest similar orthosteric substrate (inhibitor) conformations and binding crevices but distinguishable allosteric Zn{sup 2+} ion binding motifs. Considering the occluded conformational states of glial human {gamma}-aminobutyric acid transporter subtypes, we found major semi-extended and minor ring-like conformations of zwitterionic {gamma}-aminobutyric acid in complex with Na{sup +} ion. The existence of the minor ring-like conformation of {gamma}-aminobutyric acid in complex with Na{sup +} ion may be attributed to the strengthening of the intramolecular H-bond by the electrostatic effect of Na{sup +} ion. Coupling substrate uptake into cells with the thermodynamically favorable Na{sup +} ion movement through substrate-Na{sup +} ion complex formation may be a mechanistic principle featuring transmembrane neurotransmitter-sodium symporter proteins.

  19. Analysis of perchlorate, thiocyanate, nitrate and iodide in human amniotic fluid using ion chromatography and electrospray tandem mass spectrometry

    International Nuclear Information System (INIS)

    Blount, Benjamin C.; Valentin-Blasini, Liza

    2006-01-01

    Because of health concerns surrounding in utero exposure to perchlorate, we developed a sensitive and selective method for quantifying iodide, as well as perchlorate and other sodium-iodide symporter (NIS) inhibitors in human amniotic fluid using ion chromatography coupled with electrospray ionization tandem mass spectrometry. Iodide and NIS inhibitors were quantified using a stable isotope-labeled internal standards (Cl 18 O 4 - , S 13 CN - and 15 NO 3 - with excellent assay accuracy of 100%, 98%, 99%, 95% for perchlorate, thiocyanate, nitrate and iodide, respectively, in triplicate analysis of spiked amniotic fluid sample). Excellent analytical precision (<5.2% RSD for all analytes) was found when amniotic fluid quality control pools were repetitively analyzed for iodide and NIS-inhibitors. Selective chromatography and tandem mass spectrometry reduced the need for sample cleanup, resulting in a rugged and rapid method capable of routinely analyzing 75 samples/day. Analytical response was linear across the physiologically relevant concentration range for the analytes. Analysis of a set of 48 amniotic fluid samples identified the range and median levels for perchlorate (0.057-0.71, 0.18 μg/L), thiocyanate (<10-5860, 89 μg/L), nitrate (650-8900, 1620 μg/L) and iodide (1.7-170, 8.1 μg/L). This selective, sensitive, and rapid method will help assess exposure of the developing fetus to low levels of NIS-inhibitors and their potential to inhibit thyroid function

  20. MCNP Techniques for Modeling Sodium Iodide Spectra of Kiwi Surveys

    International Nuclear Information System (INIS)

    Robert B Hayes

    2007-01-01

    This work demonstrates how MCNP can be used to predict the response of mobile search and survey equipment from base principles. The instrumentation evaluated comes from the U.S. Department of Energy's Aerial Measurement Systems. Through reconstructing detector responses to various point-source measurements, detector responses to distributed sources can be estimated through superposition. Use of this methodology for currently deployed systems allows predictive determinations of activity levels and distributions for common configurations of interest. This work helps determine the quality and efficacy of certain surveys in fully characterizing an effected site following a radiological event of national interest

  1. Feasibility of baculovirus-mediated reporter gene delivery for efficient monitoring of islet transplantation in vivo

    International Nuclear Information System (INIS)

    Liu, Shuai; Pan, Yu; Lv, Jing; Wu, Haifei; Tian, Jingyan; Zhang, Yifan

    2014-01-01

    Objective: The objective of this study was to explore the feasibility of baculovirus vector-mediated sodium iodide symporter (NIS) gene delivery to monitor islet transplantation. Methods: Baculovirus vectors expressing green fluorescent protein (GFP) or NIS (Bac-GFP and Bac-NIS) were established using the Bac-to-Bac baculovirus expression system. The GFP expression of Bac-GFP-infected rat islets was observed in vitro by fluorescence microscopy. Iodine uptake and inhibition of iodine uptake by NaClO 4 in Bac-NIS-infected islets were dynamically monitored in vitro. Bac-GFP- or Bac-NIS-infected islets were implanted into the left axillary cavity of NOD-SCID mice, and fluorescence imaging and 125 I NanoSPECT/CT imaging were subsequently performed in vivo. Results: Bac-GFP efficiently infected rat islets (over 95% infected at MOI = 40), and the expression of GFP lasted approximately two weeks. NaClO 4 could inhibit iodine uptake by Bac-NIS-infected islets. In vivo imaging revealed that the fluorescence intensity of the transplant sites in Bac-GFP-infected groups was significantly higher than in the non-infected group. Grafts could be clearly observed by 125 I NanoSPECT/CT imaging for up to 8 h. Conclusion: Baculovirus vectors are powerful vehicles for studying rat islets in gene delivery. It is feasible to use a baculovirus vector to delivery an NIS gene for non-invasive monitoring transplanted islets in vivo by the expression of the target gene

  2. Identification of essential amino acid residues in the nisin dehydratase NisB

    NARCIS (Netherlands)

    Khusainov, Rustem; van Heel, Auke J.; Lubelski, Jacek; Moll, Gert N.; Kuipers, Oscar P.

    2015-01-01

    Nisin is a posttranslationally-modified antimicrobial peptide that has the ability to induce its own biosynthesis. Serines and threonines in the modifiable core peptide part of precursor nisin are dehydrated to dehydroalanines and dehydrobutyrines by the dehydratase NisB, and subsequently cysteines

  3. Use of the Lactococcal nisA Promoter To Regulate Gene Expression in Gram-Positive Bacteria : Comparison of Induction Level and Promoter Strength

    NARCIS (Netherlands)

    Eichenbaum, Zehava; Federle, Michael J.; Marra, Diana; Vos, Willem M. de; Kuipers, Oscar P.; Kleerebezem, Michiel; Scott, June R.

    1998-01-01

    We characterized the regulated activity of the lactococcal nisA promoter in strains of the gram-positive species Streptococcus pyogenes, Streptococcus agalactiae, Streptococcus pneumoniae, Enterococcus faecalis, and Bacillus subtilis. nisA promoter activity was dependent on the proteins NisR and

  4. Monoclonal antibodies that bind the renal Na+/glucose symport system. 1. Identification

    International Nuclear Information System (INIS)

    Wu, J.S.R.; Lever, J.E.

    1987-01-01

    Phlorizin is a specific, high-affinity ligand that binds the active site of the Na + /glucose symporter by a Na + -dependent mechanism but is not itself transported across the membrane. The authors have isolated a panel of monoclonal antibodies that influence high-affinity, Na + -dependent phlorizin binding to pig renal brush border membranes. Antibodies were derived after immunization of mice either with highly purified renal brush border membranes or with apical membranes purified from LLC-PK 1 , a cell line of pig renal proximal tubule origin. Antibody 11A3D6, an IgG/sub 2b/, reproducibly stimulated Na + -dependent phlorizin binding whereas antibody 18H10B12, an IgM, strongly inhibited specific binding. These effects were maximal after 30-min incubation and exhibited saturation at increased antibody concentrations. Antibodies did not affect Na + -dependent sugar uptake in vesicles but significantly prevented transport inhibition by bound phlorizin. Antibodies recognized a 75-kDa antigen identified by Western blot analysis of brush border membranes, and a 75-kDa membrane protein could be immunoprecipitated by 18H10B12. These properties, provide compelling evidence that the 75-kDa antigen recognized by these antibodies is a component of the renal Na + /glucose symporter

  5. Au-controlled enhancement of photoluminescence of NiS nanostructures synthesized via a microwave-assisted hydrothermal technique

    International Nuclear Information System (INIS)

    Linganiso, Ella Cebisa; Mwakikunga, Bonex Wakufwa; Mhlanga, Sabelo Dalton; Coville, Neil John

    2014-01-01

    Nickel sulphide (NiS) nanostructures decorated with gold (Au) nanoparticles (NPs) were synthesized via a microwave-assisted hydrothermal technique. Binary phase NiS (α and β) crystalline nanostructures, bare, and decorated with Au NPs were obtained and confirmed by X-ray diffraction (XRD) studies. TEM analysis revealed that the NiS nanostructures were of various shapes. A quantum confinement effect was confirmed by the blue shift PL emissions and high optical energy band gap observed for the as-synthesized sample. A threefold light emission enhancement due to Au NP coatings was obtained when Au metal NP decoration concentrations was varied from 1% to 10%. These enhancements were attributed to the surface plasmon resonance (SPR) excitation of the surface decorated metal NPs which results in an increased rate of spontaneous emission. The PL enhancement factor was observed to vary at different NiS emissions as well as with the size of the Au NPs. The effect of metal NP decoration on the PL emission of NiS is to the best of our knowledge, presented for the first time. - Highlights: • Binary phase NiS decorated with gold nanoparticles. • Quantum confinement effect confirmed by PL analysis. • PL enhancement depending more on particle size distribution. • Effect of gold on NiS PL is to the best of our knowledge reported for the first time

  6. The Main Directions of the Structural Defragmentation of the State Development Strategy of the NIS of Ukraine

    Directory of Open Access Journals (Sweden)

    Melnyk Alexander G.

    2018-03-01

    Full Text Available The article considers the scientific-methodical approach to bridging of gaps on the main directions, in systems of mechanisms and instruments of the State strategy for development of the National Innovation Strategy (NIS, caused by breaks in the system of interactions by elements of its organizational, technological, and institutional structure. This situation in the innovation system is defined as fragmentation of the basic structures of the NIS, which is interrelated by fragmentation of multi-level development strategies for development of the NIS. The most fragmented directions of the State strategy for development of the NIS of Ukraine are defined, among which the system of transfer of technologies and absence of corresponding strategic priorities, technological modernization of industry, integration of the research sphere into the world innovation space, creation of the high-tech sector of NIS. The main directions of structural defragmentation of the State Strategy for Development of the NIS are proposed: organization of innovation process, formation of development institutions, clustering of scientific and production sectors of the NIS, formation of environment to achieve technological leadership.

  7. Direct assessment of substrate binding to the Neurotransmitter:Sodium Symporter LeuT by solid state NMR

    DEFF Research Database (Denmark)

    Erlendsson, Simon; Gotfryd, Kamil; Larsen, Flemming Hofmann

    2017-01-01

    The Neurotransmitter:Sodium Symporters (NSSs) represent an important class of proteins mediating sodium-dependent uptake of neurotransmitters from the extracellular space. The substrate binding stoichiometry of the bacterial NSS protein, LeuT, and thus the principal transport mechanism, has been...

  8. ZrFsy1, a high-affinity fructose/H+ symporter from fructophilic yeast Zygosaccharomyces rouxii.

    Directory of Open Access Journals (Sweden)

    Maria José Leandro

    Full Text Available Zygosaccharomyces rouxii is a fructophilic yeast than can grow at very high sugar concentrations. We have identified an ORF encoding a putative fructose/H(+ symporter in the Z. rouxii CBS 732 genome database. Heterologous expression of this ORF in a S. cerevisiae strain lacking its own hexose transporters (hxt-null and subsequent kinetic characterization of its sugar transport activity showed it is a high-affinity low-capacity fructose/H(+ symporter, with Km 0.45 ± 0.07 mM and Vmax 0.57 ± 0.02 mmol h(-1 (gdw(-1. We named it ZrFsy1. This protein also weakly transports xylitol and sorbose, but not glucose or other hexoses. The expression of ZrFSY1 in Z. rouxii is higher when the cells are cultivated at extremely low fructose concentrations (<0.2% and on non-fermentable carbon sources such as mannitol and xylitol, where the cells have a prolonged lag phase, longer duplication times and change their microscopic morphology. A clear phenotype was determined for the first time for the deletion of a fructose/H(+ symporter in the genome where it occurs naturally. The effect of the deletion of ZrFSY1 in Z. rouxii cells is only evident when the cells are cultivated at very low fructose concentrations, when the ZrFsy1 fructose symporter is the main active fructose transporter system.

  9. Comparison of NIS and NHIS/NIPRCS vaccination coverage estimates. National Immunization Survey. National Health Interview Survey/National Immunization Provider Record Check Study.

    Science.gov (United States)

    Bartlett, D L; Ezzati-Rice, T M; Stokley, S; Zhao, Z

    2001-05-01

    The National Immunization Survey (NIS) and the National Health Interview Survey (NHIS) produce national coverage estimates for children aged 19 months to 35 months. The NIS is a cost-effective, random-digit-dialing telephone survey that produces national and state-level vaccination coverage estimates. The National Immunization Provider Record Check Study (NIPRCS) is conducted in conjunction with the annual NHIS, which is a face-to-face household survey. As the NIS is a telephone survey, potential coverage bias exists as the survey excludes children living in nontelephone households. To assess the validity of estimates of vaccine coverage from the NIS, we compared 1995 and 1996 NIS national estimates with results from the NHIS/NIPRCS for the same years. Both the NIS and the NHIS/NIPRCS produce similar results. The NHIS/NIPRCS supports the findings of the NIS.

  10. MPC&A training needs of the NIS/Baltics States.

    Energy Technology Data Exchange (ETDEWEB)

    Beck, David Franklin; Stoy-McLeod, Carol L.

    2006-07-01

    This report serves to document contract deliverables considered to be of continuing interest associated with two workshops conducted as part of an initial assessment of Material Protection, Control, and Accounting (MPC&A) training needs of the Newly Independent and Baltic States (NIS/Baltics). These workshops were held in Kiev, Ukraine, ca. 2003-2004, with the assistance of personnel from the George Kuzmycz Training Center (GKTC) of the Kiev Institute of Nuclear Research (KINR). Because of the dominant role Ukraine plays in the region in terms of the nuclear industry, one workshop focused exclusively on Ukrainian training needs, with participants attending from twelve Ukrainian organizations (plus U.S. DOE/NNSA representatives). The second workshop included participation by a further ten countries from the NIS/Baltics region. In addition, the training needs data developed during the workshop were supplemented by the outcomes of surveys and studies conducted by the GKTC.

  11. 'NiNis': Youth in Argentina who Neither Work nor Study. A Social Integration Deficit

    Directory of Open Access Journals (Sweden)

    Lidia de la Torre

    2017-01-01

    Full Text Available This study aims to assess the extent to which vulnerability in household material living conditions affects the institutional integration of young people of Argentina. We worked with a random sample of 4,855 youth aged between 18 and 25. It was observed that 66% of those who neither study nor work live in households having a low or very low socioeconomic status, with 4 out of 10 of these youth residing in shantytowns or slums and with half of them failing to complete high school. Harsh environments create a vicious circle of persistent passivity and isolation. However, the comparison between the NiNis and the working segment allowed us to conclude that similar household levels of socio-economic vulnerability are not necessarily sufficient to explain the situation of social disaffiliation found in these youth NiNis.

  12. Comparison of the in vitro effects of TCDD, PCB 126 and PCB 153 on thyroid-restricted gene expression and thyroid hormone secretion by the chicken thyroid gland.

    Science.gov (United States)

    Katarzyńska, Dorota; Hrabia, Anna; Kowalik, Kinga; Sechman, Andrzej

    2015-03-01

    The aim of this study was to compare the in vitro effects of 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD), 3,3',4,4',5-pentachlorobiphenyl (PCB 126; a coplanar PCB congener) and 2,2'4,4',5,5'-hexachlorobiphenyl (PCB153; non-coplanar PCB) on mRNA expression of thyroid-restricted genes, i.e. sodium iodide symporter (NIS), thyroid peroxidase (TPO) and thyroglobulin (TG), and thyroid hormone secretion from the thyroid gland of the laying chicken. Relative expression levels of NIS, TG and TPO genes and thyroxine (T4) and triiodothyronine (T3) secretion from the thyroidal explants were quantified by the real-time qPCR and RIA methods, respectively. In comparison with the control group, TCDD and PCB 126 significantly increased mRNA expression of TPO and TG genes. TCDD did not affect NIS mRNA levels, but PCB 126 decreased its expression. No effect of PCB 153 on the expression of these genes was observed. TCDD and PCB 126 significantly decreased T4 and T3 secretion. There was no significant effect of PCB 153 on these hormone secretions. In conclusion, the results obtained show that in comparison with non-coplanar PCB 153, TCDD and coplanar PCB 126 can directly affect thyroid hormone synthesis and secretion, and in consequence, they may disrupt the endocrine function of the thyroid gland of the laying chicken. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. Environmental perchlorate: Why it matters

    International Nuclear Information System (INIS)

    Kirk, Andrea B.

    2006-01-01

    The only known mechanism of toxicity for perchlorate is interference with iodide uptake at the sodium-iodide symporter (NIS). The NIS translocates iodide across basolateral membranes to the thyroid gland so it can be used to form thyroid hormones (TH). NIS is also expressed in the mammary gland during lactation, so that iodide can be transferred from a mother to her child. Without adequate iodide, an infant cannot produce sufficient TH to meet its developmental needs. Effects expected from perchlorate are those that would be seen in conditions of hypothyroidism or hypothyroxinemia. The probability of a permanent adverse effect is greatest during early life, as successful neurodevelopment is TH-dependent. Study of perchlorate risk is complicated by a number of factors including thyroid status of the mother during gestation, thyroid status of the fetus, maternal and infant iodine intake, and exposure of each to other TH-disrupting chemicals. Perhaps the greatest standing issue, and the issue most relevant to the field of analytical chemistry, is the simple fact that human exposure has not been quantified. This review will summarize perchlorate's potential to adversely affect neurodevelopment. Whether current environmental exposures to perchlorate contribute to neuro-impairment is unknown. Risks posed by perchlorate must be considered in conjunction with iodine intake

  14. Progesterone Upregulates Gene Expression in Normal Human Thyroid Follicular Cells

    Directory of Open Access Journals (Sweden)

    Ana Paula Santin Bertoni

    2015-01-01

    Full Text Available Thyroid cancer and thyroid nodules are more prevalent in women than men, so female sex hormones may have an etiological role in these conditions. There are no data about direct effects of progesterone on thyroid cells, so the aim of the present study was to evaluate progesterone effects in the sodium-iodide symporter NIS, thyroglobulin TG, thyroperoxidase TPO, and KI-67 genes expression, in normal thyroid follicular cells, derived from human tissue. NIS, TG, TPO, and KI-67 mRNA expression increased significantly after TSH 20 μUI/mL, respectively: 2.08 times, P<0.0001; 2.39 times, P=0.01; 1.58 times, P=0.0003; and 1.87 times, P<0.0001. In thyroid cells treated with 20 μUI/mL TSH plus 10 nM progesterone, RNA expression of NIS, TG, and KI-67 genes increased, respectively: 1.78 times, P<0.0001; 1.75 times, P=0.037; and 1.95 times, P<0.0001, and TPO mRNA expression also increased, though not significantly (1.77 times, P=0.069. These effects were abolished by mifepristone, an antagonist of progesterone receptor, suggesting that genes involved in thyroid cell function and proliferation are upregulated by progesterone. This work provides evidence that progesterone has a direct effect on thyroid cells, upregulating genes involved in thyroid function and growth.

  15. Facile synthesis of NiS anchored carbon nanofibers for high-performance supercapacitors

    Science.gov (United States)

    Xu, Jinling; Zhang, Li; Xu, Guancheng; Sun, Zhipeng; Zhang, Chi; Ma, Xin; Qi, Chunling; Zhang, Lu; Jia, Dianzeng

    2018-03-01

    Transition metal sulfide compounds with carbon materials are promising for high-performance supercapacitors. Carbon nanofibers (CNFs) wrapped with NiS nanoparticles were herein obtained through electrospinning and calcination. NiS nanoparticles in composite nanofibers are covered by a layer of graphitic carbon, which not only increase the conductivity but also provide active regions for nanoparticle growth to prevent aggregation. The CNFs-NiS electrode has high specific capacity of 177.1 mAh g-1 at 1 A g-1 (0.41 mAh cm-2 at a current density of 2.3 mA cm-2) and long-term cycling stability, with 88.7% capacitance retention after 5000 cycles. The excellent electrochemical activity may be attributed to the accessible specific surface, unique porous structure of CNFs and high specific capacitance of NiS. In addition, the asymmetric supercapacitor has an enhanced volumetric energy density of 13.32 mWh cm-3 at a volumetric power density of 180 mW cm-3 and high cycling stability, with 89.5% capacitance retention after 5000 cycles. It also successfully lights up a light-emitting diode. The CNFs-NiS composite has significant potential applications in supercapacitor.

  16. Microwave-assisted synthesis of NiS2 nanostructures for supercapacitors and cocatalytic enhancing photocatalytic H2 production

    Science.gov (United States)

    Pang, Huan; Wei, Chengzhen; Li, Xuexue; Li, Guochang; Ma, Yahui; Li, Sujuan; Chen, Jing; Zhang, Jiangshan

    2014-01-01

    Uniform NiS2 nanocubes are successfully synthesized with a microwave-assisted method. Interestingly, NiS2 nanocubes, nanospheres and nanoparticles are obtained by controlling microwave reaction time. NiS2 nanomaterials are primarily applied to supercapacitors and cocatalytic enhancing photocatalytic H2 production. Different morphologies of NiS2 nanostructures show different electrochemical and cocatalytic enhancing H2 production activities. Benefited novel nanostructures, NiS2 nanocube electrodes show a large specific capacitance (695 F g−1 at 1.25 A g−1) and excellent cycling performance (the retention 93.4% of initial specific capacitance after 3000 cycles). More importantly, NiS2 nanospheres show highly cocatalytic enhancing photocatalytic for H2 evolution, in which the photocatalytic H2 production is up to 3400 μmol during 12 hours under irradiation of visible light (λ>420 nm) with an average H2 production rate of 283 μmol h−1. PMID:24389929

  17. Electrochemically induced transformation of NiS nanoparticles into Ni(OH)2 in KOH aqueous solution toward electrochemical capacitors

    International Nuclear Information System (INIS)

    Hou Linrui; Yuan Changzhou; Li Diankai; Yang Long; Shen Laifa; Zhang Fang; Zhang Xiaogang

    2011-01-01

    Highlights: → NiS is synthesized by means of the H 2 O/CS 2 interface under hydrothermal treatment. → NiS itself owns poor electrochemical capacitance in 2 M KOH solution. → NiS is electrochemically induced and transformed into electroactive Ni(OH) 2 . → Ni(OH) 2 is responsible for good energy storage of the NiS in the KOH solution. → The new formed Ni(OH) 2 delivers large energy density at high rates. - Abstract: Nickel sulfide nanoparticles (NPs) are first synthesized by virtue of a unique H 2 O/CS 2 interface under mild hydrothermal treatment. Electrochemical data reveals that the as-synthesized NiS NPs themselves own poor supercapacitive behavior at initial cyclic voltammetry (CV) cycles in 2 M KOH solution, while a specific capacitance of 893 F g -1 can be surprisingly obtained at a current density of 5 A g -1 just after continuous 320 CV cycles. X-ray diffraction and Fourier transform infrared techniques demonstrate that what is really responsible for the good electrochemical capacitance in the KOH aqueous solution is the new electrochemically formed Ni(OH) 2 phase, rather than NiS NPs themselves. The Ni(OH) 2 is slowly formed during the continuous CV cycling process, in which the electrochemically induced phase transformation from NiS to Ni(OH) 2 phase takes place. Furthermore, the new Ni(OH) 2 phase demonstrates the great ability of delivering large specific capacitance at high rates.

  18. A Novel Missense Mutation in SLC5A5 Gene in a Sudanese Family with Congenital Hypothyroidism.

    Science.gov (United States)

    Watanabe, Yui; Ebrhim, Reham Shareef; Abdullah, Mohamed A; Weiss, Roy E

    2018-05-15

    Thyroid hormone synthesis requires the presence of iodide. The sodium iodide symporter (NIS) is a glycoprotein which mediates the active uptake of iodide from the blood stream into the thyroid grand. NIS defects due to SLC5A5 gene mutations are known to cause congenital hypothyroidism (CH). The proposita is a 28-year-old female whose origin is the North Sudan where neonatal screening for CH is not available. She presented with severe constipation and a goiter at the age of 40 days. Laboratory testing confirmed CH and she was started on levothyroxine (L-T4). Presumably due to the delayed treatment the patient developed mental retardation. Her younger sister presented with a goiter, tongue protrusion and umbilical hernia and the youngest brother was also diagnosed with CH based on the TSH >100 µIU/mL at the age of 22 days and 8 days, respectively. Two siblings were treated with L-T4 and had normal development. Their consanguineous parents had no history of thyroid disorders. We performed whole exome sequencing (WES) on the proposita. WES identified a novel homozygous missense mutation in the SLC5A5 gene: c.1042T>G, p.Tyr348Asp, which was subsequently confirmed by Sanger sequencing. All affected children were homozygous for the same mutation and their unaffected mother was heterozygous. The NIS protein is composed of 13 transmembrane segments (TMS), an extracellular amino-terminus and an intracellular carboxyl terminus. The mutation is located in the TMS IX which has the most β-OH group-containing amino acids (serine and threonine) which is implicated in Na+ binding and translocation. In conclusion, a novel homozygous missense mutation in the SLC5A5 gene was identified in the Sudanese family with CH. The mutation is located in the TMS IX of the NIS protein which is essential for NIS function. Low iodine intake in Sudan is considered to affect severity of hypothyroidism in the patients.

  19. Identification of chosen apoptotic (TIAR and TIA-1) markers expression in thyroid tissues from adolescents with immune and non-immune thyroid diseases

    International Nuclear Information System (INIS)

    Bossowski, A.; Czarnocka, B.; Lyczkowska, A.; Bardadin, K.; Czerwinska, J.; Moniuszko, A.; Dadan, J.; Bossowska, A.

    2010-01-01

    The aim of this study was to estimate sodium iodide symporter (NIS) and thyroid peroxidase (TPO) expression in thyrocytes from patients with GD and no-toxic multi nodular goitre (NTMG) in relationship with apoptotic (TIAR and TIA-1) markers. The investigation was performed on thyroid cells isolated from post operation thyroid tissues from 15 patients aged 12-21 years old with GD and 15 cases aged 13-21 years old with NTMG. Detection of NIS and TPO was performed by immunohistochemistry. Analysis of apoptotic markers in thyroid tissues was performed using antibodies to TIAR and TIA-1 by Western Blot and immunohistochemistry. Identification of pro apoptotic TIAR and TIA-1 molecules in the thyroid tissues revealed a higher expression of both proteins in patients with Graves' disease (+++; +, respectively) in comparison to patients with NTNG (+; 0). In addition, TIAR expression was detected in three bands [p50, p42, p38 (kDa)] and TIA-1 in two bands [p22, p17 (kDa)]. using Western Blot test in patients with thyroid autoimmune diseases. In patients with NTNG expression of both apoptotic proteins was lower and identified in single bands: 42 (kDa) for TIAR and 17 (kDa) for TIA-1. The analysis of expression of NIS and TPO in thyroid follicular cells was higher in patients with Graves' disease in compared to their detection in patients with NTMG. In addition, degree of thyroid antigen expression positive correlated with amount of pro apoptotic markers (TIAR, p<0.001; TIA-1, p<0.025 for NIS; TIAR, p<0.012 for TPO). We conclude that elevated expression of NIS and TPO in Graves' disease is associated with higher stimulation and activation of apoptosis in thyroid follicular cells during autoimmune process. (authors)

  20. Materijalna motivacija kao nosilac uspešne reorganizacije kompanije NIS (Material Motivation as the Holder of a Successful Reorganization on the Example of Company Nis

    Directory of Open Access Journals (Sweden)

    Radmila Stojanović

    2015-04-01

    Full Text Available For successful organization people are the primary development resource. Motivation and satisfaction of employees become the basis of modern organizations. Motivated employees today represent a strategic resource which gain a competitive advantage for the organization. If someone wants to motivate others, must first be able to motivate yourself. That means that if in organization exists motivated staff, there must be a motivated manager who will be able to launch employees. The aim of this paper is to emphasizes the importance of material motivation for successful business of a large company that had in the past significant organizational change. Through unstructured interviews were collected data on which was investigated the hypothesis that the material motivation of the most important holder for successful reorganization on the example of leading Serbian company for exploration, production and refining of oil and gas NIS. From the above it can be concluded that high-quality human resources management involves proper motivation system, that has been based on material incentives. In this paper, attention will be focused on monetary motivation and how a well-established system of material incentives can lead to the great success of the company that had a significant reorganization in the past. It will be shown in detail the system of material incentives and the positive results which obtained by this system, when it comes to the business of the company, which today is the most desirable employer in Serbia and the region. The paper should emphasize the benefits of a fair system of motivation which brings to an organization, but also to encourage further thinking to improve this aspect of motivation, which is a prerequisite for successful business and the basis for all other activities in the HRM. The analysis results indeed show that a system of material incentives in NIS is the holder of a successful reorganization, and the proof is the business

  1. Direct evidence of spin frustration in the fcc antiferromagnet NiS sub 2

    CERN Document Server

    Matsuura, M; Endoh, Y; Hirota, K; Yamada, K

    2002-01-01

    NiS sub 2 is a well-known Mott insulator with anomalous antiferromagnetic long-range order of coexistent type I (Q sub M =(1,0,0), T sub N sub 1 =40 K) and type II (Q sub M =(1/2,1/2,1/2), T sub N sub 2 =30 K). Extensive neutron-scattering measurements reveal that magnetism in NiS sub 2 is governed by geometrical spin frustration, resulting in magnetic diffuse scattering extending along the fcc zone boundary. Although the diffuse scattering exists at temperatures as high as 250 K (6T sub N sub 1), it disappears rapidly below T sub N sub 2 , associated with minor crystal distortion. We observed a clear energy gap in addition to the low-energy spin-wave excitation at significantly below 30 K, and obtain evidence that degeneracy due to the coexistence of the two types of antiferromagnetism is relieved in the ground state via the reduction in symmetry due to distortion. (orig.)

  2. A rapid NiS bead technique for measurements of picogram concentrations of platinum group elements (PGEs) following neutron activation

    International Nuclear Information System (INIS)

    Das, A.; Shukla, A.D.

    1999-01-01

    To measure picogram amounts of PGEs in terrestrial and extraterrestrial samples we have modified the NiS fire assay technique in conjunction with neutron activation analysis. Os, Ir and Ru are almost quantitatively concentrated in the NiS bead. The method should be applicable to other elements (Pt, Pd, and Rh) but these could not be analyzed because of the short half life of their daughter isotopes. The results also show that the chalcophhile elements like Ag also can be quantitatively estimated using this method. (author)

  3. Size-dependent and intra-band photoluminescence of NiS2 nano-alloys synthesized by microwave assisted hydrothermal technique

    CSIR Research Space (South Africa)

    Linganiso, C

    2013-03-01

    Full Text Available Synthesis of nickel disulfide (NiS2) nano-alloys capped and uncapped with hexadecylamine (HDA) was carried out. A cubic phase NiS2 formation was confirmed by X-ray diffraction (XRD) analysis. An average crystallite size of 35 nm was obtained...

  4. The acceleration intermediate phase (NiS and Ni3S2) evolution by nanocrystallization in Li/NiS2 thermal batteries with high specific capacity

    Science.gov (United States)

    Jin, Chuanyu; Zhou, Lingping; Fu, Licai; Zhu, Jiajun; Li, Deyi; Yang, Wulin

    2017-06-01

    The intermediate phase of NiS2 is thought to be a bottleneck currently to improve the overall performance of Li/NiS2 thermal batteries because of its low conductivity and close formation enthalpy between NiS2 and the intermediate phase (NiS, Ni3S2, etc). For improving the discharge performances of Li/NiS2 thermal batteries, the nano NiS2 with an average size of 85 ± 5 nm is designated as a cathode material. The electrochemical measurements show that the specific capacity of nano NiS2 cathode is higher than micro NiS2. The nano NiS2 cathode exhibits excellent electrochemical performances with high specific capacities of 794 and 654 mAh g-1 at current density of 0.1 and 0.5 A cm-2 under a cut-off voltage of 0.5 V, respectively. These results show that the rapid intermediate phase evolution from the nanocrystallization can obviously enhance use efficiency of NiS2 and improve discharge performances of thermal batteries.

  5. Au-controlled enhancement of photoluminescence of NiS nanostructures synthesized via a microwave-assisted hydrothermal technique

    CSIR Research Space (South Africa)

    Linganiso, EC

    2014-11-01

    Full Text Available and confirmed by X-ray diffraction (XRD) studies. TEM analysis revealed that the NiS nanostructures were of various shapes. A quantum confinement effect was confirmed by the blue shift PL emissions and high optical energy band gap observed for the as...

  6. Metallic behavior of NiS thin film under the structural, optical, electrical and ab initio investigation frameworks

    Energy Technology Data Exchange (ETDEWEB)

    Boughalmi, R. [Unité de physique des dispositifs à semi-conducteurs, Faculté des sciences de Tunis, Tunis El Manar University, 2092 Tunis (Tunisia); Rahmani, R. [Laboratoire de Physique des Couches Minces et Matériaux pour l' Electronique (LPC2ME). Département de physique, Faculté des Sciences, Université d' Oran Es-Sénia, Oran (Algeria); Département de physique, Université des Sciences et de la Technologie d' Oran- Mohamed-Boudiaf, Oran (Algeria); Boukhachem, A., E-mail: abdelwaheb.boukhachem@laposte.net [Unité de physique des dispositifs à semi-conducteurs, Faculté des sciences de Tunis, Tunis El Manar University, 2092 Tunis (Tunisia); Amrani, B.; Driss-Khodja, K. [Laboratoire de Physique des Couches Minces et Matériaux pour l' Electronique (LPC2ME). Département de physique, Faculté des Sciences, Université d' Oran Es-Sénia, Oran (Algeria); Amlouk, M. [Unité de physique des dispositifs à semi-conducteurs, Faculté des sciences de Tunis, Tunis El Manar University, 2092 Tunis (Tunisia)

    2015-08-01

    Nickel sulfide (NiS) thin films were deposited on the glass substrates by spray pyrolysis at 250 °C using an aqueous solution which contains nickel chloride hexahydrate and thiourea as precursors. X-ray diffraction analysis confirms that the hexagonal structure is being part of P6{sub 3}/mmc space group of the deposited films with (100) preferred orientation and lattice parameters a = 3.441 Å and c = 5.320 Å. The optical properties, investigated through transmittance and reflectance measurements reveal that the direct band gap energy (Eg) is around 0.55 eV. The electrical study shows a metallic behavior of the current II-VI binary compound. This behavior regarding NiS II-VI binary sulfide was confirmed by numerical studies based on the density functional theory (DFT) were adopted. The ground state quantities, such as lattice parameter, bulk modulus and its pressure derivative as well as the elastic constants were obtained. The values are consistent with the stability of hexagonal structure. The band structure and the states densities of such material were studied. The results show that there is an agreement between experimental and simulation. - Highlights: • NiS thin films are synthesized by Spray pyrolysis. • NiS is a low band gap compound. • These films have interesting electrical properties showing a metallic behavior. • Computational study confirms the electrical measurements.

  7. [Tooth pathology analysis of osteological material from the Medieval locality of Saint Pantelejmon church in Nis].

    Science.gov (United States)

    Mitić, Nadica; Mitić, Aleksandar; Crnoglavac, Vesna; Vlak, Dejana; Nikolić, Marija

    2008-01-01

    Medieval necropolis at the porch of St. Panteleimon church in Nis, from 12th century represents a typical Serbian necropolis, which has its analogies in several areas in Serbia. Preservation of the skeletal remains belongs to category of good and medium preservation. The aim of the work was to study the skeletal remains for the prevalence of tooth caries, localization of caries lesions, presence of abrasion, supragingival tartar and resorption of alveolar bone as the indicator of periodontal disease. The analyses included 42 skeletal remains. The anthropological analyses involved paleopathological findings on 954 teeth of 22 men and 20 women. The pathological changes of teeth were determined by inspection, dental probe, dental mirror and x-ray examination. Epidemiological research was done using average caries index. The antropological tooth pathology research of osteological material from the medieval localization of St. Pantaleimon Church in Nis showed the presence of caries in 7.86% cases, 9.93% women and 6.07% men. In 76% caries were localized on the approximal surfaces of teeth. Abrasion of the second and third degree was registered on the side and front teeth with transformation of contact points into contact surfaces and the creation of approximal, interstitial, scolded surfaces. A large quantity of supragingival tartar was found in all individuals aged over 25 years. Expressed alveolar bone resorption is the indicator of generalized periodontal disease. The prevalence of caries in the studied medieval population from the 12th century was sporadic, with localization on secondary predilection places. The abrasion of the second and third degree was present, and the resorption of the alveolar bone was registered in all the examined skeletal remains, which was the indicator of spread periodontal disease in this period.

  8. Sodium Solute Symporter and Cadherin Proteins Act as Bacillus thuringiensis Cry3Ba Toxin Functional Receptors in Tribolium castaneum*

    Science.gov (United States)

    Contreras, Estefanía; Schoppmeier, Michael; Real, M. Dolores; Rausell, Carolina

    2013-01-01

    Understanding how Bacillus thuringiensis (Bt) toxins interact with proteins in the midgut of susceptible coleopteran insects is crucial to fully explain the molecular bases of Bt specificity and insecticidal action. In this work, aminopeptidase N (TcAPN-I), E-cadherin (TcCad1), and sodium solute symporter (TcSSS) have been identified by ligand blot as putative Cry3Ba toxin-binding proteins in Tribolium castaneum (Tc) larvae. RNA interference knockdown of TcCad1 or TcSSS proteins resulted in decreased susceptibility to Cry3Ba toxin, demonstrating the Cry toxin receptor functionality for these proteins. In contrast, TcAPN-I silencing had no effect on Cry3Ba larval toxicity, suggesting that this protein is not relevant in the Cry3Ba toxin mode of action in Tc. Remarkable features of TcSSS protein were the presence of cadherin repeats in its amino acid sequence and that a TcSSS peptide fragment containing a sequence homologous to a binding epitope found in Manduca sexta and Tenebrio molitor Bt cadherin functional receptors enhanced Cry3Ba toxicity. This is the first time that the involvement of a sodium solute symporter protein as a Bt functional receptor has been demonstrated. The role of this novel receptor in Bt toxicity against coleopteran insects together with the lack of receptor functionality of aminopeptidase N proteins might account for some of the differences in toxin specificity between Lepidoptera and Coleoptera insect orders. PMID:23645668

  9. Flavonoid rutin increases thyroid iodide uptake in rats.

    Directory of Open Access Journals (Sweden)

    Carlos Frederico Lima Gonçalves

    Full Text Available Thyroid iodide uptake through the sodium-iodide symporter (NIS is not only an essential step for thyroid hormones biosynthesis, but also fundamental for the diagnosis and treatment of different thyroid diseases. However, part of patients with thyroid cancer is refractory to radioiodine therapy, due to reduced ability to uptake iodide, which greatly reduces the chances of survival. Therefore, compounds able to increase thyroid iodide uptake are of great interest. It has been shown that some flavonoids are able to increase iodide uptake and NIS expression in vitro, however, data in vivo are lacking. Flavonoids are polyhydroxyphenolic compounds, found in vegetables present in human diet, and have been shown not only to modulate NIS, but also thyroperoxidase (TPO, the key enzyme in thyroid hormones biosynthesis, besides having antiproliferative effect in thyroid cancer cell lines. Therefore, we aimed to evaluate the effect of some flavonoids on thyroid iodide uptake in Wistar rats in vivo. Among the flavonoids tested, rutin was the only one able to increase thyroid iodide uptake, so we decided to evaluate the effect of this flavonoid on some aspects of thyroid hormones synthesis and metabolism. Rutin led to a slight reduction of serum T4 and T3 without changes in serum thyrotropin (TSH, and significantly increased hypothalamic, pituitary and brown adipose tissue type 2 deiodinase and decreased liver type 1 deiodinase activities. Moreover, rutin treatment increased thyroid iodide uptake probably due to the increment of NIS expression, which might be secondary to increased response to TSH, since TSH receptor expression was increased. Thus, rutin might be useful as an adjuvant in radioiodine therapy, since this flavonoid increased thyroid iodide uptake without greatly affecting thyroid function.

  10. Consistency of the national realization of dew-point temperature using NIS standard humidity generators

    Directory of Open Access Journals (Sweden)

    El-Galil Doaa Abd

    2017-01-01

    Full Text Available A comparison of two standard humidity generators (two-temperature (2-T and one-temperature (1-T generators that are developed by the National Institute for Standards (NIS has been performed using a transfer standard chilled-mirror hygrometer and measurement procedures to realize dew-point temperature Td in the range from −50 °C to 0 °C. The main objective of this comparison was to compare the realizations of dew-point temperature and to establish the level of consistency between the two generators. For a level of consistency between two measurements, it is expressed by the difference between the measured values, m1 − m2, and the expanded pair uncertainty of this difference Up [1]. The comparison measurements revealed dew-point temperature differences of 0.02 °C and 0.07 °C with expanded pair uncertainties of ±0.09 °C and ±0.15 °C.

  11. Power of tests for comparing trend curves with application to national immunization survey (NIS).

    Science.gov (United States)

    Zhao, Zhen

    2011-02-28

    To develop statistical tests for comparing trend curves of study outcomes between two socio-demographic strata across consecutive time points, and compare statistical power of the proposed tests under different trend curves data, three statistical tests were proposed. For large sample size with independent normal assumption among strata and across consecutive time points, the Z and Chi-square test statistics were developed, which are functions of outcome estimates and the standard errors at each of the study time points for the two strata. For small sample size with independent normal assumption, the F-test statistic was generated, which is a function of sample size of the two strata and estimated parameters across study period. If two trend curves are approximately parallel, the power of Z-test is consistently higher than that of both Chi-square and F-test. If two trend curves cross at low interaction, the power of Z-test is higher than or equal to the power of both Chi-square and F-test; however, at high interaction, the powers of Chi-square and F-test are higher than that of Z-test. The measurement of interaction of two trend curves was defined. These tests were applied to the comparison of trend curves of vaccination coverage estimates of standard vaccine series with National Immunization Survey (NIS) 2000-2007 data. Copyright © 2011 John Wiley & Sons, Ltd.

  12. Formation of Multiple-Phase Catalysts for the Hydrogen Storage of Mg Nanoparticles by Adding Flowerlike NiS.

    Science.gov (United States)

    Xie, Xiubo; Ma, Xiujuan; Liu, Peng; Shang, Jiaxiang; Li, Xingguo; Liu, Tong

    2017-02-22

    In order to enhance the hydrogen storage properties of Mg, flowerlike NiS particles have been successfully prepared by solvothermal reaction method, and are subsequently ball milled with Mg nanoparticles (NPs) to fabricate Mg-5 wt % NiS nanocomposite. The nanocomposite displays Mg/NiS core/shell structure. The NiS shell decomposes into Ni, MgS and Mg 2 Ni multiple-phases, decorating on the surface of the Mg NPs after the first hydrogen absorption and desorption cycle at 673 K. The Mg-MgS-Mg 2 Ni-Ni nanocomposite shows enhanced hydrogenation and dehydrogenation rates: it can quickly uptake 3.5 wt % H 2 within 10 min at 423 K and release 3.1 wt % H 2 within 10 min at 573 K. The apparent hydrogen absorption and desorption activation energies are decreased to 45.45 and 64.71 kJ mol -1 . The enhanced sorption kinetics of the nanocomposite is attributed to the synergistic catalytic effects of the in situ formed MgS, Ni and Mg 2 Ni multiple-phase catalysts during the hydrogenation/dehydrogenation process, the porthole effects for the volume expansion and microstrain of the phase transformation of Mg 2 Ni and Mg 2 NiH 4 and the reduced hydrogen diffusion distance caused by nanosized Mg. This novel method of in situ producing multiple-phase catalysts gives a new horizon for designing high performance hydrogen storage material.

  13. Purification and characterization of the reconstitutively active P/sub i//H/sup +/ symporter from rat liver mitochondria

    Energy Technology Data Exchange (ETDEWEB)

    Kaplan, R.S.; Pratt, R.D.; Pedersen, P.L.

    1986-05-01

    A highly purified preparation of reconstitutively active P/sub i//H/sup +/ symporter has been obtained from rat liver mitochondria. The carrier is isolated by extraction of hypotonically shocked mitoplasts with Triton X-114 in the presence of cardiolipin followed by sequential chromatography on hydroxylapatite, DEAE-Sepharose CL-6B, and Affi-Gel 501. Upon incorporation of the final Affi-Gel eluate into phospholipid vesicles, an N-ethylmaleimide (NEM)-sensitive P/sub i//P/sub i/ exchange of greater than 15 ..mu..mol/min/mg protein has been measured. This exchange is characterized by a first order rate constant of 0.85 min/sup -1/ and a t/sub 1/2/ of 49 sec. Furthermore, /sup 32/P/sub i/ uptake into vesicles can be inhibited by SH reagents and by the lysine reactive reagent dansyl chloride. Coomassie-stained SDS polyacrylamide gradient gels verify the high purity of this fraction and indicate the presence of two bands, of nearly equivalent staining intensity, at 33 kDa and 35 kDa. A small amount of higher molecular weight material also appears at approx. 61 kDa. Alkylation of the purified fraction with NEM causes the two lower molecular weight protein bands to migrate as a single species at 35 kDa which binds (/sup 3/H)NEM. It is concluded that the purifed protein represents a nearly homogeneous form of the NEM-sensitive P/sub i//H/sup +/ symporter of rat liver mitochondria. Additionally, the purified carrier appears to contain cysteine and lysine residues that are essential for activity.

  14. Growth, nisA Gene Expression, and In Situ Activity of Novel Lactococcus lactis subsp. cremoris Costarter Culture in Commercial Hard Cheese Production.

    Science.gov (United States)

    Noutsopoulos, Dimitrios; Kakouri, Athanasia; Kartezini, Eleftheria; Pappas, Dimitrios; Hatziloukas, Efstathios; Samelis, John

    2017-12-01

    This study evaluated in situ expression of the nisA gene by an indigenous, nisin A-producing (NisA+) Lactococcus lactis subsp. cremoris raw milk genotype, represented by strain M78, in traditional Greek Graviera cheeses under real factory-scale manufacturing and ripening conditions. Cheeses were produced with added a mixed thermophilic and mesophilic commercial starter culture (CSC) or with the CSC plus strain M78 (CSC+M78). Cheeses were sampled after curd cooking (day 0), fermentation of the unsalted molds for 24 h (day 1), brining (day 7), and ripening of the brined molds (14 to 15 kg each) for 30 days in a fully controlled industrial room (16.5°C; 91% relative humidity; day 37). Total RNA was directly extracted from the cheese samples, and the expression of nisA gene was evaluated by real-time reverse transcription PCR (qRT-PCR). Agar overlay and well diffusion bioassays were correspondingly used for in situ detection of the M78 NisA+ colonies in the cheese agar plates and antilisterial activity in whole-cheese slurry samples, respectively. Agar overlay assays showed good growth (>8 log CFU/g of cheese) of the NisA+ strain M78 in coculture with the CSC and vice versa. The nisA expression was detected in CSC+M78 cheese samples only, with its expression levels being the highest (16-fold increase compared with those of the control gene) on day 1, followed by significant reduction on day 7 and almost negligible expression on day 37. Based on the results, certain intrinsic and mainly implicit hurdle factors appeared to reduce growth prevalence rates and decrease nisA gene expression, as well as the nisin A-mediated antilisterial activities of the NisA+ strain M78 postfermentation. To our knowledge, this is the first report on quantitative expression of the nisA gene in a Greek cooked hard cheese during commercial manufacturing and ripening conditions by using a novel, rarely isolated, indigenous NisA+ L. lactis subsp. cremoris genotype as costarter culture.

  15. Correlates of HPV vaccine initiation and provider recommendation among male adolescents, 2014 NIS-Teen.

    Science.gov (United States)

    Landis, Kathryn; Bednarczyk, Robert A; Gaydos, Laura M

    2018-05-08

    Vaccination is a safe and effective way to prevent Human Papillomavirus (HPV) infection and related cancers; however, HPV vaccine uptake remains low in the US. After the 2011 Advisory Committee on Immunization Practices (ACIP) recommendation for routine HPV vaccination of adolescent males, several studies have examined predictors for initiating the vaccine series in this population of interest, particularly with regard to provider recommendations. This study examined racial and ethnic differences for HPV vaccine initiation and provider recommendation in male adolescents. Based on prior HPV vaccine uptake estimates and healthcare utilization data, we hypothesized that minority adolescents would be more likely to initiate HPV vaccines, but less likely to receive a provider recommendation compared to white counterparts. We analyzed the 2014 National Immunization Survey-Teen (NIS-Teen), which included 10,753 male adolescents with provider-verified vaccination data in 50 US states, using multivariate logistic regression models to evaluate racial/ethnic differences in HPV vaccine initiation and provider recommendation. The odds of HPV vaccine initiation were 76 percent higher for Hispanic adolescents and 43 percent higher for non-Hispanic Other or Multiple race adolescents compared to white adolescents. Approximately half of parents reported receiving a provider recommendation for vaccination, with no significant difference in the odds of receiving a provider recommendation across racial/ethnic groups. Despite similar frequency of recommendations across racial and ethnic groups, male adolescents who are racial/ethnic minorities are more likely to initiate vaccination. Future research should focus on developing tailored interventions to increase HPV vaccine receipt among males of all racial/ethnic groups. Copyright © 2018 Elsevier Ltd. All rights reserved.

  16. Thyroid Disorders in Accra, Ghana

    African Journals Online (AJOL)

    User

    to enhance thyroid-targeted expression of sodium/iodide symporter. J Clin Endocrinol. Metab 89(5): 2344-2350. Mariotti, S, Cambuli, VM (2007) Cardiovascular risk in elderly hypothyroid patients. Thyroid 17. (11): 1067-1073. Mariotti, S, Franceschi, C, Cossarizza, A, Pinchera, A. (1995) The aging thyroid. Endocr Rev 16(6):.

  17. Iodine nutrition in breast-fed infants is impaired by maternal smoking

    DEFF Research Database (Denmark)

    Laurberg, Peter; Nøhr, Susanne B; Pedersen, Klaus M

    2004-01-01

    the sodium-iodide symporter responsible for iodide transport in the lactating mammary gland. Smoking during the period of breastfeeding increases the risk of iodine deficiency-induced brain damage in the child. Women who breastfeed should not smoke, but if they do, an extra iodine supplement should...

  18. METAMORPHIC INHIBITION OF XENOPUS LAEVIS BY SODIUM PERCHLORATE: EFFECTS ON DEVELOPMENT AND THYROID HISTOLOGY

    Science.gov (United States)

    The perchlorate anion inhibits thyroid hormone (TH) synthesis via inhibition of the sodium-iodide symporter. It is, therefore, a good model chemical to aid in the development of a bioassay to screen chemicals for effects on thyroid function. Xenopus laevis larvae were exposed to ...

  19. Beyond radioiodine: novel therapies in advanced thyroid cancer

    International Nuclear Information System (INIS)

    Haugen, Bryan R.

    2004-01-01

    Full text: Thyroid cancer is a relatively common endocrine malignancy. Fortunately, many patients do well with standard therapy including surgery and radioiodine. A minority of patients have poorly differentiated thyroid carcinoma that is unresponsive to radioiodine therapy. Redifferentiation agents that 'reprogram ' these tumors to concentrate radioiodine would be of great value in treating patients with advanced thyroid cancer. The retinoid isotretinoin is the most extensively studied of these agents. It appears that 20-40% of patients respond to isotretinoin treatment by concentration of radioiodine in metastatic tumors, but the clinical utility of this redifferentiation is still unclear. In vitro studies suggest that the retinoid receptors RARβ and RXRγ are required for this effect. Abnormal DNA methylation may be an early event in thyroid tumorigenesis and methylation of the sodium iodide symporter (NIS) may play a role in loss of iodine concentration in these tumors. Inhibitors of methylation (5-azacytidine, phenylacetate and sodium butyrate) have been shown to increase NIS expression and iodine uptake in cell culture models, but published trials in humans are not yet available. Histone acetylation is required for efficient transcription of genes necessary for differentiated function. Proteins that cause histone deacetylation inhibit gene transcription and differentiated function. Inhibitors of histone deacetylation (depsipeptide, trichostatin A) have been shown to increase NIS expression and iodine uptake in poorly differentiated and undifferentiated cell lines. Finally, commonly used agents such as thiazolidine diones (diabetes) and HMG-CoA reductase inhibitors (hypercholesterolemia) have shown promise in preliminary in vitro studies in advanced thyroid cancer cell lines. Our own work has focused on receptor-selective retinoids and thiazolidine diones as potential therapy in patients with advanced thyroid cancer based on nuclear hormone receptor

  20. Effects of varying dietary iodine supplementation levels as iodide or iodate on thyroid status as well as mRNA expression and enzyme activity of antioxidative enzymes in tissues of grower/finisher pigs.

    Science.gov (United States)

    Li, Qimeng; Mair, Christiane; Schedle, Karl; Hellmayr, Isabella; Windisch, Wilhelm

    2013-02-01

    The objective of this study was to investigate the influence of high dietary iodine supply and different iodine sources on thyroid status and oxidative stress in target tissues of the thyroid hormones in fattening pigs. Eighty castrates (body weight: 33.3 ± 0.4 kg) were randomly allotted into five different treatments: The control diet contained 150 μg I/kg as KI, the other feeding groups were supplemented with 4,000 μg I/kg (as KI and KIO(3)) and 10,000 μg I/kg (as KI and KIO(3)), respectively. The mRNA expression levels of sodium/iodide symporter (NIS) and key antioxidant enzymes (Cu/Zn SOD, CAT, GPx) were analyzed in thyroid gland, liver, kidney, muscle, and adipose tissue sampled during slaughter. Furthermore, antioxidant enzyme activities and the effect on lipid peroxidation (MDA) were determined in liver and muscle. In thyroid gland, a significant downregulation of NIS and Cu/Zn SOD mRNA expression was observed in high-iodine groups. In liver, a source effect on the mRNA expression of Cu/Zn SOD between KI and KIO(3) at 4,000 μg I/kg was shown. In contrast, not SOD but GPx activity was affected by iodine source with strongest downregulation in high KIO(3) group. In muscle, GPx activity was affected by both iodine source and dose, showing stronger downregulation in KI groups. In kidney and adipose tissue, oxidative stress parameters showed no or only unsystematic changes. However, variation in iodine supply had no effect on MDA concentrations. NIS expression was significantly decreased with increased iodine supplementation, which is to ensure the thyroid gland function. However, the alleviating effect of iodine supplementation observed in antioxidant enzyme mRNA expression and activity did not reflect on the lipid peroxide level.

  1. Implementation of multiple intelligences theory in the English language course syllabus at the University of Nis Medical School.

    Science.gov (United States)

    Bakić-Mirić, Natasa

    2010-01-01

    Theory of multiple intelligences (MI) is considered an innovation in learning the English language because it helps students develop all eight intelligences that, on the other hand, represent ways people understand the world around them, solve problems and learn. They are: verbal/linguistic, logical/mathematical, visual/spatial, bodily/kinaesthetic, musical/rhythmic, interpersonal, intrapersonal and naturalist. Also, by focusing on the problem-solving activities, teachers, by implementing theory of multiple intelligences, encourage students not only to build their existing language knowledge but also learn new content and skills. The objective of this study has been to determine the importance of implementation of the theory of multiple intelligences in the English language course syllabus at the University of Nis Medical School. Ways in which the theory of multiple intelligences has been implemented in the English language course syllabus particularly in one lecture for junior year students of pharmacy in the University of Nis Medical School. The English language final exam results from February 2009 when compared with the final exam results from June 2007 prior to the implementation of MI theory showed the following: out of 80 junior year students of pharmacy, 40 obtained grade 10 (outstanding), 16 obtained grade 9 (excellent), 11 obtained grade 8 (very good), 4 obtained grade 7 (good) and 9 obtained grade 6 (pass). No student failed. The implementation of the theory of multiple intelligences in the English language course syllabus at the University of Nis Medical School has had a positive impact on learning the English language and has increased students' interest in language learning. Genarally speaking, this theory offers better understanding of students' intelligence and greater appreciation of their strengths. It provides numerous opportunities for students to use and develop all eight intelligences not just the few they excel in prior to enrolling in a

  2. The assessment of different models to predict solar module temperature, output power and efficiency for Nis, Serbia

    International Nuclear Information System (INIS)

    Pantic, Lana S.; Pavlović, Tomislav M.; Milosavljević, Dragana D.; Radonjic, Ivana S.; Radovic, Miodrag K.; Sazhko, Galina

    2016-01-01

    Five different models for calculating solar module temperature, output power and efficiency for sunny days with different solar radiation intensities and ambient temperatures are assessed in this paper. Thereafter, modeled values are compared to the experimentally obtained values for the horizontal solar module in Nis, Serbia. The criterion for determining the best model was based on the statistical analysis and the agreement between the calculated and the experimental values. The calculated values of solar module temperature are in good agreement with the experimentally obtained ones, with some variations over and under the measured values. The best agreement between calculated and experimentally obtained values was for summer months with high solar radiation intensity. The nonlinear model for calculating the output power is much better than the linear model and at the same time predicts better the total electrical energy generated by the solar module during the day. The nonlinear model for calculating the solar module efficiency predicts the efficiency higher than the STC (Standard Test Conditions) value of solar module efficiency for all conditions, while the linear model predicts the solar module efficiency very well. This paper provides a simple and efficient guideline to estimate relevant parameters of a monocrystalline silicon solar module under the moderate-continental climate conditions. - Highlights: • Linear model for solar module temperature gives accurate predictions for August. • The nonlinear model better predicts the solar module power than the linear model. • For calculating solar module power for Nis we propose the nonlinear model. • For calculating solar model efficiency for Nis we propose adoption of linear model. • The adopted models can be used for calculations throughout the year.

  3. Comparison of NiS2 and α-NiS hollow spheres for supercapacitors, non-enzymatic glucose sensors and water treatment.

    Science.gov (United States)

    Wei, Chengzhen; Cheng, Cheng; Cheng, Yanyan; Wang, Yan; Xu, Yazhou; Du, Weimin; Pang, Huan

    2015-10-21

    NiS2 hollow spheres are successfully prepared by a one-step template free method. Meanwhile, α-NiS hollow spheres can also be synthesized via the calcination of the pre-obtained NiS2 hollow spheres at 400 °C for 1 h in air. The electrochemical performances of the as-prepared NiS2 and α-NiS hollow sphere products are evaluated. When used for supercapacitors, compared with NiS2 hollow spheres, the α-NiS hollow sphere electrode shows a large specific capacitance of 717.3 F g(-1) at 0.6 A g(-1) and a good cycle life. Furthermore, NiS2 and α-NiS hollow spheres are successfully applied to fabricate non-enzymatic glucose sensors. In particular, the α-NiS hollow spheres exhibit good catalytic activity for the oxidation of glucose, a fast amperometric response time of less than 5 s, and the detection limit is estimated to be 0.08 μM. More importantly, compared with other normally co-existing interfering species, such as ascorbic acid, uric acid and dopamine, the electrode modified with α-NiS hollow spheres shows good selectivity. Moreover, the α-NiS hollow spheres also present good capacity to remove Congo red organic pollutants from wastewater by their surface adsorption ability.

  4. L-cysteine-assisted synthesis of hierarchical NiS2 hollow spheres supported carbon nitride as photocatalysts with enhanced lifetime

    Science.gov (United States)

    Zhu, Chengzhang; Jiang, Zhifeng; Chen, Linlin; Qian, Kun; Xie, Jimin

    2017-03-01

    Novel hierarchical NiS2 hollow spheres modified by graphite-like carbon nitride were prepared using a facile L-cysteine-assisted solvothermal route. The NiS2/g-C3N4 composites exhibited excellent photocatalytic efficiency in rhodamine B, methyl orange and ciprofloxacin degradation as compared to single g-C3N4 and NiS2, which could be due to the synergistic effects of the unique hollow sphere-like structure, strong visible-light absorption and increased separation rate of the photoinduced electron-hole pairs at the intimate interface of heterojunctions. A suitable combination of g-C3N4 with NiS2 showed the best photocatalytic performance. In addition, an electron spin resonance and trapping experiment demonstrated that the photogenerated hydroxyl radicals and superoxide radicals were the two main photoactive species in photocatalysis. A possible photocatalytic mechanism of NiS2/g-C3N4 composites under visible light irradiation is also proposed. The strategy presented here can be extended to a general strategy for constructing 3D/2D heterostructured photocatalysts for broad applications in photocatalysis.

  5. Size-dependent and intra-band photoluminescence of NiS2 nano-alloys synthesized by microwave assisted hydrothermal technique

    International Nuclear Information System (INIS)

    Linganiso, Ella Cebisa; Mhlanga, Sabelo Dalton; Coville, Neil John; Mwakikunga, Bonex Wakufwa

    2013-01-01

    Graphical abstract: Unexpected ultra-violet (UV) emission as well as near infra-red (IR) emissions were attributed to intra-band energy state transitions that occur as a result of the porous structure of the material. Enhanced UV and near IR PL emissions due to the smaller crystallite size of the capped NiS 2 nanostructures was also observed. Band energy and local density of states calculation for NiS 2 were used to support the experimentally observed luminescence results. The luminescence features at wavelengths of 400 nm (3.10 eV), 428 nm (2.90 eV), 447 nm (2.77 eV) and 464 nm (2.67) can be attributed to some of those electrons de-exciting from S (3p) levels down to the Ni (3d) (blue to UV emission) whereas those features at wavelengths of 710 nm (1.75 eV), 751 nm (1.65 eV), 754 nm (1.64 eV) [NiS 2 /HDA-capped NiS 2 ] and 784 nm (1.58 eV) respectively seem to result from de-excitations between either Ni(3d) or S (3s, 3p) levels and Ni–S hybridization levels (red to near IR emission). Highlights: ► Rapid solid state alloying of Ni and S from their liquid state precursor by microwaves. ► New photoluminescence data of NiS 2 system. ► Unexpected luminescence in the UV–Visible and near IR ranges for such a metal matrix alloy. ► Explanation of NiS 2 photoluminescence from ab initio calculations by electronic energy band structure and density of states. -- Abstract: Synthesis of nickel disulfide (NiS 2 ) nano-alloys capped and uncapped with hexadecylamine (HDA) was carried out. A cubic phase NiS 2 formation was confirmed by X-ray diffraction (XRD) analysis. An average crystallite size of 35 nm was obtained for the uncapped nanostructures and 9 nm was obtained for the capped nanostructures estimated using the Scherrer equation. Unexpected ultra-violet (UV) emission as well as near infrared (IR) emissions were attributed to intra-band energy state transitions that occur as a result of the porous structure of the material. Enhanced UV and near IR PL emissions

  6. The solute specificity profiles of nucleobase cation symporter 1 (NCS1) from Zea mays and Setaria viridis illustrate functional flexibility.

    Science.gov (United States)

    Rapp, Micah; Schein, Jessica; Hunt, Kevin A; Nalam, Vamsi; Mourad, George S; Schultes, Neil P

    2016-03-01

    The solute specificity profiles (transport and binding) for the nucleobase cation symporter 1 (NCS1) proteins, from the closely related C4 grasses Zea mays and Setaria viridis, differ from that of Arabidopsis thaliana and Chlamydomonas reinhardtii NCS1. Solute specificity profiles for NCS1 from Z. mays (ZmNCS1) and S. viridis (SvNCS1) were determined through heterologous complementation studies in NCS1-deficient Saccharomyces cerevisiae strains. The four Viridiplantae NCS1 proteins transport the purines adenine and guanine, but unlike the dicot and algal NCS1, grass NCS1 proteins fail to transport the pyrimidine uracil. Despite the high level of amino acid sequence similarity, ZmNCS1 and SvNCS1 display distinct solute transport and recognition profiles. SvNCS1 transports adenine, guanine, hypoxanthine, cytosine, and allantoin and competitively binds xanthine and uric acid. ZmNCS1 transports adenine, guanine, and cytosine and competitively binds, 5-fluorocytosine, hypoxanthine, xanthine, and uric acid. The differences in grass NCS1 profiles are due to a limited number of amino acid alterations. These amino acid residues do not correspond to amino acids essential for overall solute and cation binding or solute transport, as previously identified in bacterial and fungal NCS1, but rather may represent residues involved in subtle solute discrimination. The data presented here reveal that within Viridiplantae, NCS1 proteins transport a broad range of nucleobase compounds and that the solute specificity profile varies with species.

  7. Development of a PBPK model of thiocyanate in rats with an extrapolation to humans: A computational study to quantify the mechanism of action of thiocyanate kinetics in thyroid

    International Nuclear Information System (INIS)

    Willemin, Marie-Emilie; Lumen, Annie

    2016-01-01

    Thyroid homeostasis can be disturbed due to thiocyanate exposure from the diet or tobacco smoke. Thiocyanate inhibits both thyroidal uptake of iodide, via the sodium-iodide symporter (NIS), and thyroid hormone (TH) synthesis in the thyroid, via thyroid peroxidase (TPO), but the mode of action of thiocyanate is poorly quantified in the literature. The characterization of the link between intra-thyroidal thiocyanate concentrations and dose of exposure is crucial for assessing the risk of thyroid perturbations due to thiocyanate exposure. We developed a PBPK model for thiocyanate that describes its kinetics in the whole-body up to daily doses of 0.15 mmol/kg, with a mechanistic description of the thyroidal kinetics including NIS, passive diffusion, and TPO. The model was calibrated in a Bayesian framework using published studies in rats. Goodness-of-fit was satisfactory, especially for intra-thyroidal thiocyanate concentrations. Thiocyanate kinetic processes were quantified in vivo, including the metabolic clearance by TPO. The passive diffusion rate was found to be greater than NIS-mediated uptake rate. The model captured the dose-dependent kinetics of thiocyanate after acute and chronic exposures. Model behavior was evaluated using a Morris screening test. The distribution of thiocyanate into the thyroid was found to be determined primarily by the partition coefficient, followed by NIS and passive diffusion; the impact of the latter two mechanisms appears to increase at very low doses. Extrapolation to humans resulted in good predictions of thiocyanate kinetics during chronic exposure. The developed PBPK model can be used in risk assessment to quantify dose-response effects of thiocyanate on TH. - Highlights: • A PBPK model of thiocyanate (SCN − ) was calibrated in rats in a Bayesian framework. • The intra-thyroidal kinetics of thiocyanate including NIS and TPO was modeled. • Passive diffusion rate for SCN − seemed to be greater than the NIS

  8. Development of a PBPK model of thiocyanate in rats with an extrapolation to humans: A computational study to quantify the mechanism of action of thiocyanate kinetics in thyroid

    Energy Technology Data Exchange (ETDEWEB)

    Willemin, Marie-Emilie; Lumen, Annie, E-mail: Annie.Lumen@fda.hhs.gov

    2016-09-15

    Thyroid homeostasis can be disturbed due to thiocyanate exposure from the diet or tobacco smoke. Thiocyanate inhibits both thyroidal uptake of iodide, via the sodium-iodide symporter (NIS), and thyroid hormone (TH) synthesis in the thyroid, via thyroid peroxidase (TPO), but the mode of action of thiocyanate is poorly quantified in the literature. The characterization of the link between intra-thyroidal thiocyanate concentrations and dose of exposure is crucial for assessing the risk of thyroid perturbations due to thiocyanate exposure. We developed a PBPK model for thiocyanate that describes its kinetics in the whole-body up to daily doses of 0.15 mmol/kg, with a mechanistic description of the thyroidal kinetics including NIS, passive diffusion, and TPO. The model was calibrated in a Bayesian framework using published studies in rats. Goodness-of-fit was satisfactory, especially for intra-thyroidal thiocyanate concentrations. Thiocyanate kinetic processes were quantified in vivo, including the metabolic clearance by TPO. The passive diffusion rate was found to be greater than NIS-mediated uptake rate. The model captured the dose-dependent kinetics of thiocyanate after acute and chronic exposures. Model behavior was evaluated using a Morris screening test. The distribution of thiocyanate into the thyroid was found to be determined primarily by the partition coefficient, followed by NIS and passive diffusion; the impact of the latter two mechanisms appears to increase at very low doses. Extrapolation to humans resulted in good predictions of thiocyanate kinetics during chronic exposure. The developed PBPK model can be used in risk assessment to quantify dose-response effects of thiocyanate on TH. - Highlights: • A PBPK model of thiocyanate (SCN{sup −}) was calibrated in rats in a Bayesian framework. • The intra-thyroidal kinetics of thiocyanate including NIS and TPO was modeled. • Passive diffusion rate for SCN{sup −} seemed to be greater than the NIS

  9. Effect of cell phone-like electromagnetic radiation on primary human thyroid cells.

    Science.gov (United States)

    Silva, Veronica; Hilly, Ohad; Strenov, Yulia; Tzabari, Cochava; Hauptman, Yirmi; Feinmesser, Raphael

    2016-01-01

    To evaluate the potential carcinogenic effects of radiofrequency energy (RFE) emitted by cell phones on human thyroid primary cells. Primary thyroid cell culture was prepared from normal thyroid tissue obtained from patients who underwent surgery at our department. Subconfluent thyroid cells were irradiated under different conditions inside a cell incubator using a device that simulates cell phone-RFE. Proliferation of control and irradiated cells was assessed by the immunohistochemical staining of antigen Kiel clone-67 (Ki-67) and tumor suppressor p53 (p53) expression. DNA ploidy and the stress biomarkers heat shock protein 70 (HSP70) and reactive oxygen species (ROS) was evaluated by fluorescence-activated cell sorting (FACS). Our cells highly expressed thyroglobulin (Tg) and sodium-iodide symporter (NIS) confirming the origin of the tissue. None of the irradiation conditions evaluated here had an effect neither on the proliferation marker Ki-67 nor on p53 expression. DNA ploidy was also not affected by RFE, as well as the expression of the biomarkers HSP70 and ROS. Our conditions of RFE exposure seem to have no potential carcinogenic effect on human thyroid cells. Moreover, common biomarkers usually associated to environmental stress also remained unchanged. We failed to find an association between cell phone-RFE and thyroid cancer. Additional studies are recommended.

  10. Mutations of dual oxidase 2 (DUOX2) gene among patients with permanent and transient congenital hypothyroidism

    International Nuclear Information System (INIS)

    Rostampour, N.; Tajaddini, M.H.; Hashemipour, M

    2012-01-01

    Objective: The prevalence of congenital hypothyroidism (CH) is high in Isfahan, Iran. In addition, it has different etiologies compared with other countries. The rate of parental consanguinity is also high in the city. Moreover, DUOX2 gene is effective in transient CH and permanent CH due to dyshormonogenesis. Therefore, the aim of this research was to investigate the mutations of DUOX2 gene in patients with transient CH and permanent CH due to dyshormonogenesis. Methodology: In this descriptive, prospective study, patients diagnosed with transient and permanent CH due to dyshormonogenesis during CH screening program were selected. Venous blood samples were obtained to determine the 3 mutations (Q36H, R376W, and D506N) of DUOX2 gene using polymerase chain reaction (PCR) method by specific primers and complementary methods such as restriction fragment length polymorphism (RFLP) and single-strand conformation polymorphism (SSCP). Results: In this study, 25 patients with transient CH and 33 subjects with permanent CH due to dyshormonogenesis were studied. In addition, 30 children were studied as the control group. We did not find any mutations of the 3 mentioned mutations of DUOX2 gene. Conclusion: Considering the findings of the current study, further studies with other methods are required to evaluate other gene mutations such as pendrin, sodium-iodide symporter (NIS) and thyroglobulin. (author)

  11. Molecular nuclear cardiac imaging

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Dong Soo; Paeng, Jin Chul [College of Medicine, Seoul National Univ., Seoul (Korea, Republic of)

    2004-04-01

    Molecular nuclear cardiac imaging has included Tc-99m Annexin imaging to visualize myocardial apoptosis, but is now usually associated with gene therapy and cell-based therapy. Cardiac gene therapy was not successful so far but cardiac reporter gene imaging was made possible using HSV-TK (herpes simplex virus thymidine kinase) and F-18 FHBG (fluoro-hydroxymethylbutyl guanine) or I-124 FIAU (fluoro-deoxyiodo-arabino-furanosyluracil). Gene delivery was performed by needle injection with or without catheter guidance. TK expression did not last longer than 2 weeks in myocardium. Cell-based therapy of ischemic heart or failing heart looks promising, but biodistribution and differentiation of transplanted cells are not known. Reporter genes can be transfected to the stem/progenitor cells and cells containing these genes can be transplanted to the recipients using catheter-based purging or injection. Repeated imaging should be available and if promoter are varied to let express reporter transgenes, cellular (trans)differentiation can be studied. NIS (sodium iodide symporter) or D2R receptor genes are promising in this aspect.

  12. Clinically compliant spatial and temporal imaging of chimeric antigen receptor T-cells.

    Science.gov (United States)

    Emami-Shahri, Nia; Foster, Julie; Kashani, Roxana; Gazinska, Patrycja; Cook, Celia; Sosabowski, Jane; Maher, John; Papa, Sophie

    2018-03-14

    The unprecedented efficacy of chimeric antigen receptor (CAR) T-cell immunotherapy of CD19 + B-cell malignancy has established a new therapeutic pillar of hematology-oncology. Nonetheless, formidable challenges remain for the attainment of comparable success in patients with solid tumors. To accelerate progress and rapidly characterize emerging toxicities, systems that permit the repeated and non-invasive assessment of CAR T-cell bio-distribution would be invaluable. An ideal solution would entail the use of a non-immunogenic reporter that mediates specific uptake of an inexpensive, non-toxic and clinically established imaging tracer by CAR T cells. Here we show the utility of the human sodium iodide symporter (hNIS) for the temporal and spatial monitoring of CAR T-cell behavior in a cancer-bearing host. This system provides a clinically compliant toolkit for high-resolution serial imaging of CAR T cells in vivo, addressing a fundamental unmet need for future clinical development in the field.

  13. Emerging integrated nanoclay-facilitated drug delivery system for papillary thyroid cancer therapy

    Science.gov (United States)

    Zhang, Yi; Long, Mei; Huang, Peng; Yang, Huaming; Chang, Shi; Hu, Yuehua; Tang, Aidong; Mao, Linfeng

    2016-09-01

    Nanoclay can be incorporated into emerging dual functional drug delivery systems (DDSs) to promote efficiency in drug delivery and reduce the toxicity of doxorubicin (DOX) used for thyroid cancer treatment. This paper reports the expansion of the basal spacing of kaolinite nanoclay was expanded from 0.72 nm to 0.85 nm, which could provide sufficiently spacious site for hosting doxorubicin molecules and controlling the diffusion rate. A targeted design for papillary thyroid cancer cells was achieved by introducing KI, which is consumed by the sodium-iodide symporter (NIS). As indicated by MTT assays, confocal laser scanning microscopy and bio-TEM observations, methoxy-intercalated kaolinite (KaolinMeOH) exhibited negligible cytotoxicity against papillary thyroid cancer cells. By contrast, DOX-KaolinMeOH showed dose-dependent therapeutic effects in vitro, and KI@DOX-KaolinMeOH was found to act as a powerful targeted therapeutic drug. Furthermore, active and passive targeting strategies played a role in the accumulation of the drug molecules, as verified by an in vivo bio-distribution analysis.

  14. Cancer Stratification by Molecular Imaging

    Directory of Open Access Journals (Sweden)

    Justus Weber

    2015-03-01

    Full Text Available The lack of specificity of traditional cytotoxic drugs has triggered the development of anticancer agents that selectively address specific molecular targets. An intrinsic property of these specialized drugs is their limited applicability for specific patient subgroups. Consequently, the generation of information about tumor characteristics is the key to exploit the potential of these drugs. Currently, cancer stratification relies on three approaches: Gene expression analysis and cancer proteomics, immunohistochemistry and molecular imaging. In order to enable the precise localization of functionally expressed targets, molecular imaging combines highly selective biomarkers and intense signal sources. Thus, cancer stratification and localization are performed simultaneously. Many cancer types are characterized by altered receptor expression, such as somatostatin receptors, folate receptors or Her2 (human epidermal growth factor receptor 2. Similar correlations are also known for a multitude of transporters, such as glucose transporters, amino acid transporters or hNIS (human sodium iodide symporter, as well as cell specific proteins, such as the prostate specific membrane antigen, integrins, and CD20. This review provides a comprehensive description of the methods, targets and agents used in molecular imaging, to outline their application for cancer stratification. Emphasis is placed on radiotracers which are used to identify altered expression patterns of cancer associated markers.

  15. Molecular nuclear cardiac imaging

    International Nuclear Information System (INIS)

    Lee, Dong Soo; Paeng, Jin Chul

    2004-01-01

    Molecular nuclear cardiac imaging has included Tc-99m Annexin imaging to visualize myocardial apoptosis, but is now usually associated with gene therapy and cell-based therapy. Cardiac gene therapy was not successful so far but cardiac reporter gene imaging was made possible using HSV-TK (herpes simplex virus thymidine kinase) and F-18 FHBG (fluoro-hydroxymethylbutyl guanine) or I-124 FIAU (fluoro-deoxyiodo-arabino-furanosyluracil). Gene delivery was performed by needle injection with or without catheter guidance. TK expression did not last longer than 2 weeks in myocardium. Cell-based therapy of ischemic heart or failing heart looks promising, but biodistribution and differentiation of transplanted cells are not known. Reporter genes can be transfected to the stem/progenitor cells and cells containing these genes can be transplanted to the recipients using catheter-based purging or injection. Repeated imaging should be available and if promoter are varied to let express reporter transgenes, cellular (trans)differentiation can be studied. NIS (sodium iodide symporter) or D2R receptor genes are promising in this aspect

  16. Spanish consensus for the management of patients with advanced radioactive iodine refractory differentiated thyroid cancer.

    Science.gov (United States)

    Riesco-Eizaguirre, Garcilaso; Galofré, Juan Carlos; Grande, Enrique; Zafón Llopis, Carles; Ramón y Cajal Asensio, Teresa; Navarro González, Elena; Jiménez-Fonseca, Paula; Santamaría Sandi, Javier; Gómez Sáez, José Manuel; Capdevila, Jaume

    2016-04-01

    Approximately one third of the patients with differentiated thyroid cancer (DTC) who develop structurally-evident metastatic disease are refractory to radioactive iodine (RAI). Most deaths from thyroid cancer occur in these patients. The main objective of this consensus is to address the most controversial aspects of management of these patients. On behalf of the Spanish Society of Endocrinology & Nutrition (SEEN) and the Spanish Group for Orphan and Infrequent Tumors (GETHI), the Spanish Task Force for Thyroid Cancer, consisting of endocrinologists and oncologists, reviewed the relevant literature and prepared a series of clinically relevant questions related to management of advanced RAI-refractory DTC. Ten clinically relevant questions were identified by the task force. In answering to these 10 questions, the task force included recommendations regarding the best definition of refractoriness; the best therapeutic options including watchful waiting, local therapies, and systemic therapy (e.g. kinase inhibitors), when sodium iodide symporter (NIS) restoration may be expected; and how recent advances in molecular biology have increased our understanding of the disease. In response to our appointment as a task force by the SEEN and GHETI, we developed a consensus to help in clinical management of patients with advanced RAI-refractory DTC. We think that this consensus will provide helpful and current recommendations that will help patients with this disorder to get optimal medical care. Copyright © 2015 SEEN. Published by Elsevier España, S.L.U. All rights reserved.

  17. Fibroelastic pseudotumor elastofibroma dorsi detected by 18F-FDG PET/CT scan and by postherapy radioiodine SPECT/CT.

    Science.gov (United States)

    Oporto, M; Cepa, F; Orta, N; Rubí, S; Navalón, H; Peña, C

    Radioiodine uptake in the thyroid tissue, metastasis of differentiated thyroid cancer (DTC), and in other tissues, depends on the expression of sodium-iodide symporter (NIS). Vascular permeability, effusions, inflammation, and other mechanisms may also play a role in the accumulation of radioactive iodine. A 63-year-old woman underwent radioiodine therapy, as well as a post-therapy whole-body scan, as she was suspected of having lung metastasis from thyroid carcinoma. The scan not only showed uptake at the lung metastasis but also a faint diffuse bilateral uptake in the posterior thorax. On SPECT/CT this uptake was located in a known Elastofibroma Dorsi (ED) previously diagnosed by contrast CT and viewed in a FDG PET/CT. The radioiodine uptake in ED, especially if typical, is not a diagnostic problem in SPECT/CT study, but can be misleading in a study limited to a few planar images, particularly if the uptake occurs asymmetrically, or ED is located in a unsuspected area. Copyright © 2017 Elsevier España, S.L.U. y SEMNIM. All rights reserved.

  18. Electric and magnetic fields do not modify the biochemical properties of FRTL-5 cells.

    Science.gov (United States)

    Dimida, A; Ferrarini, E; Agretti, P; De Marco, G; Grasso, L; Martinelli, M; Longo, I; Giulietti, D; Ricci, A; Galimberti, M; Siervo, B; Licitra, G; Francia, F; Pinchera, A; Vitti, P; Tonacchera, M

    2011-03-01

    Electric and magnetic fields (EMF) might be involved in human disease and numerous research and scientific reviews have been conducted to address this question. In particular thyroid structural and functional alterations caused by various forms of non-ionizing radiation have been described. The aim of this study was to analyze the possible effects of EMF on thyroid, in particular we analyzed the effects caused by a GSM (Global System for Mobile Communications) signal (900 MHz) on cultured thyroid cells (FRTL- 5). The experimental setup was designed in order to expose samples to a radiofrequency wave in well-controlled conditions. We used the FRTL-5 cell line, an epithelial monoclonal continuous cell line derived from Fisher rat thyroid tissue growing as monolayer, expressing the TSH receptor and the sodium-iodide symporter (NIS). FRTL-5 were subsequently irradiate for 24, 48, and 96 h with EMF (800-900 MHz, power-frequency of mobile communication systems) and iodide uptake and cAMP production were measured. The irradiation of cells with EMF at 900 Mhz for 24, 48, and 96 h did not influence the level of cAMP production and was not able to modify iodide accumulation in FRTL- 5 cells with respect to basal conditions. In conclusion, EMF do not seem to be able to interfere with the biochemical properties of FRTL-5 cells in vitro.

  19. FMEA Performed on the SPINLINE3 Operational System Software as part of the TIHANGE 1 NIS Refurbishment Safety Case

    International Nuclear Information System (INIS)

    Ristord, L.; Esmenjaud, C.

    2002-01-01

    This paper introduces the SPINLINE3 technology and TIHANGE 1 the NIS project. It then focuses on the specificity of FMEA performed on software. It points out the benefits of this analysis and also some of the limitations and possible developments. It also gives characteristics that, if present in the software, help the analysis and the defenses. It takes as an example the analysis performed on the Operational System Software of the Schneider Electric safety digital generic platform SPINLINE3. The New TIHANGE 1 Nuclear Instrumentation System successfully started operation on the beginning of Marsh 2001 after the plant outage, as planned at the beginning of the project. The choice of a software-based technology has raised the issue of the risk of CCF due to the same software being used in redundant independent units. Implementing functional diversity or equipment diversity has been considered but found either not practicable or of little value within this context. The safety characteristics of the SPINLINE3 solution and the stringent and proven safety software development process applied by the Nuclear department of the Schneider Electric company have made acceptable the principle of a design based on redundant identical processing units for this project. In addition, because of the possible consequences in case of the NIS not performing its protection function on demand, the licensing authority has required an FMEA oriented toward the SCCF risk as part of the safety case. This FMEA has been performed on : - the NIS architecture, - the SPINLINE3 Operational System Software, - the three Tihange 1 application software (i.e. source, intermediate and power range). The process used and the results have been elaborated by Schneider Electric and reviewed by the customer and the licensing authority all along the project development until final acceptance. Issues have been raised and answers and/or complementary analyses provided, some of them making direct references to the

  20. Calibration procedures for in vivo sodium iodide spectrometry of plutonium and americium in the human lung

    International Nuclear Information System (INIS)

    Umbarger, C.J.; Jett, J.H.

    1976-01-01

    This paper describes the calibration techniques and associated error analysis for the in vivo measurement by NaI spectrometry of heavy elements in the lung, specifically plutonium and americium. A very brief description of the instrumentation system is included

  1. Radioactivity observed in the sodium iodide gamma-ray spectrometer returned on the Apollo 17 mission

    Science.gov (United States)

    Dyer, C. S.; Trombka, J. I.; Schmadebeck, R. L.; Eller, E.; Bielefeld, M. J.; Okelley, G. D.; Eldridge, J. S.; Northcutt, K. J.; Metzger, A. E.; Reedy, R. C.

    1975-01-01

    In order to obtain information on radioactive background induced in the Apollo 15 and 16 gamma-ray spectrometers (7 cm x 7 cm NaI) by particle irradiation during spaceflight, and identical detector was flown and returned to earth on the Apollo 17 mission. The induced radioactivity was monitored both internally and externally from one and a half hours after splashdown. When used in conjunction with a computation scheme for estimating induced activation from calculated trapped proton and cosmic-ray fluences, these results show an important contribution resulting from both thermal and energetic neutrons produced in the heavy spacecraft by cosmic-ray interactions.

  2. Apparent improvement of antisera for radioimmunoassay by treatment with sodium iodide

    Energy Technology Data Exchange (ETDEWEB)

    Skrabanek, P; Powell, D [Mater Misericordiae Hospital, Dublin (Ireland). Dept. of Endocrinology; Kirrane, J [Mater Misericordiae Hospital, Dublin (Ireland). Dept. of Immunology

    1977-08-01

    The concept that antisera for radioimmunoassay can be improved by treatment with NaI and dialysis is challenged. Some antisera are little affected by NaI. Even when NaI does dissociate endogenous antigenic material from crude antiserum, in the subsequent dialysis NaI is dialysed at a much faster rate than antigen, allowing reassociation to occur. The reported improvement of antisera by the NaI method cannot be attributed to the effect of NaI but can be explained by the dilution which occurs during dialysis.

  3. Sodium Iodide-131 (Na131I) AS Gelatin Capsules At TNRC-In Libya

    International Nuclear Information System (INIS)

    Sherief, M. F.; Abudeeb, F. N.; Abudaia, J. A.; Elghanoudy, Y. A.

    2004-01-01

    In this contribution, the production of a capsulated Na 131 I radiopharmaceutical, for treatment of variety of hyperthyroidism diseases, at Tajoura Nuclear Research Center in Tripoli-Libya is described. The process requires the application of a very small volume of iodine-131 (not more than 25μ l in some cases) with radioactivities reaching some 37 GBq per capsule. The application of such volume is necessary to prevent damage to gelatin material. Loading a volume of 100 μ l of radioactive Na 131 I solution containing 37 GBq. radioactivity within a capsule filled with anhydrous sodium hydrogen phosphate as an adsorption material for Na 131 I solution brings such solution into a direct interaction with the gelatin material. This is assumed to have an inadequate effect in therapy. To overcome this problem, the work team has introduced some substantial alterations on the irradiation procedure and the process of the pre-irradiation treatment of the target. As a consequence, that has successfully culminated in production of Na 131 I capsules with proper perspective (e.g. radioactive yield of 74 GBq from 37 GBq previously and radioactive concentration of 37 GBq/ml). (Authors)

  4. Calibration and Performance Testing of Sodium Iodide, NaI (Tl)

    African Journals Online (AJOL)

    Administrator

    performed by the well-established method of ... gamma-rays emitted from radionuclides in a ... 1 Radiation Protection Institute, Ghana Atomic Energy Commission, P. O. Box ... validation of the calibration showed that there were no significance ...

  5. Thallium-201 chloride dynamic analysis using thallium-201 chloride and sodium iodide-131 thyroid subtraction scintigraphy

    Energy Technology Data Exchange (ETDEWEB)

    Morimoto, Setsuo; Hiraki, Yoshio; Togami, Izumi [Okayama Univ. (Japan). School of Medicine

    1984-10-01

    The mechanism of /sup 201/Tl chloride accumulation is unclear in thyroid gland and thyroid tumor. This report examines 108 patients that received thyroid scintigraphy examinations with both /sup 201/Tl chloride and sodium /sup 131/I. The patients were diagnosed clinically and histologically whenever possible. The ROI were obtained by subtraction imaging with both isotopes and by subtraction positive and negative areas of imaging. Dynamic curves were obtained for /sup 201/Tl chloride per square unit of each ROI. The dynamic curve in the radioiodide-accumulated area was examined. The data indicate that the clearance rate of /sup 201/Tl chloride (T/sub 15/) was correlated with the sodium /sup 131/I uptake rate at 24 h (r=0.70).

  6. In situ synthesis of oriented NiS nanotube arrays on FTO as high-performance counter electrode for dye-sensitized solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Li, Yan, E-mail: liyan-nwnu@163.com [Key Laboratory of Atomic and Molecular Physics & Functional Materials of Gansu Province, College of Physics and Electronic Engineering, Northwest Normal University, Lanzhou, 730070 (China); Chang, Yin [Key Laboratory of Atomic and Molecular Physics & Functional Materials of Gansu Province, College of Physics and Electronic Engineering, Northwest Normal University, Lanzhou, 730070 (China); Zhao, Yun [Laboratory of Clean Energy Chemistry and Materials, Lanzhou Institute of Chemical Physics, Chinese Academy of Sciences, Lanzhou, 730000 (China); Wang, Jian; Wang, Cheng-wei [Key Laboratory of Atomic and Molecular Physics & Functional Materials of Gansu Province, College of Physics and Electronic Engineering, Northwest Normal University, Lanzhou, 730070 (China)

    2016-09-15

    Oriented nickel sulfide (NiS) nanotube arrays were successfully in-situ fabricated on conductive glass substrate and used directly as counter electrode for dye-sensitized solar cells without any post-processing. Compared with Pt counter electrode, for the beneficial effect of electronic transport along the axial direction through the arrays to the substrate, oriented NiS nanotube arrays exhibit both higher electrocatalytic activity for I{sub 3}{sup −} reduction and better electrochemical stability, resulting in a significantly improved power conversion efficiency of 9.8%. Such in-situ grown oriented sulfide semiconductor nanotube arrays is expected to lead a new class structure of composites for highly efficient cathode materials. - Highlights: • In-situ synthesis strategy was proposed to construct oriented NiS nanotube arrays. • Such oriented tube nanostructure benefits the electronic transport along the axial direction of the arrays. • As CE of DSSCs, NiS nanotube arrays exhibit both higher efficiency (9.8%) and electrochemical stability than Pt.

  7. The Leucine transporter from Aquifex aeolicus as a model for the Neurotransmitter Sodium Symporters – insights into function and ligand binding

    DEFF Research Database (Denmark)

    Kantcheva, Adriana Krassimirova

    In her PhD studies, Adriana K. Kantcheva looked into the structural perspective of a bacterial transporter – the leucine transporter from Aquifex aeolicus (LeuT) – which is a homologue to neurotransmitter sodium symporters (NSS) found in humans, such as the serotonin transporter. Two crystal...... structures of LeuT elucidated new insights regarding ion and substrate binding to this transporter. Studying members of the NSS family is important as these proteins are found in the central nervous system of humans at the synaptic cleft and are implicated in serious conditions such as Parkinson’s disease...

  8. Report on the degradation of the environment at the site of NIS Novi Sad oil refinery and remediation measures

    International Nuclear Information System (INIS)

    Pavlovic, P.; Pavlovic, M.; Ivankovic, M.; Sokolovic, S.

    2002-01-01

    Before the NATO bombing, Refinery had available 149 tanks for the storage of crude oil, intermediate and final products, additives etc. All tanks are placed within the impermeable embankments of concrete or soil and connected to the storm and oil sewerage systems which enables the monitoring and control of of oil leakage and storm waste. During the NATO bombing practically all processing units were either destroyed or damaged. The summary of damages inflicted to the processing units is given. During the NATO bombing campaign over 51% of the available storage capacity was destroyed and over 34% of it was severely damaged. A summary of available, destroyed and damaged tank capacities in the NIS Novi Sad Oil Refinery is given. (author)

  9. In situ preparation of NiS2/CoS2 composite electrocatalytic materials on conductive glass substrates with electronic modulation for high-performance counter electrodes of dye-sensitized solar cells

    Science.gov (United States)

    Li, Faxin; Wang, Jiali; Zheng, Li; Zhao, Yaqiang; Huang, Niu; Sun, Panpan; Fang, Liang; Wang, Lei; Sun, Xiaohua

    2018-04-01

    The electrocatalytic composite materials of honeycomb structure NiS2 nanosheets loaded with metallic CoS2 nanoparticles are in situ prepared on F doped SnO2 conductive glass (FTO) substrates used as counter electrodes of DSSCs through chemical bath deposition (CBD) and sulfidizing process. Single crystalline NiS2 honeycomb structure array lay a foundation for the large surface area of NiS2/CoS2 composite CEs. The formed NiS2/CoS2 nanointerface modulates electronic structure of composite CEs from the synergetic interactions between CoS2 nanoparticles and NiS2 nanosheets, which dramatically improves the electrocatalytic activity of NiS2/CoS2 composite CEs; Metallic CoS2 nanoparticles covering NiS2 nanosheets electrodes adjusts the electrodes' structure and then reduces the series resistance (Rs) and the Nernst diffusion resistance (Zw) of counter electrodes. The improvement of these areas greatly enhances the electrocatalytic performance of CEs and the short circuit current density (Jsc) and Fill factor (FF) of DSSCs. Impressively, the DSSC based on NiS2/CoS2-0.1 CE shows the best photovoltaic performance with photovoltaic conversion efficiency of 8.22%, which is 24.36% higher than that (6.61%) of the DSSC with Pt CE. And the NiS2/CoS2-0.1 CE also displays a good stability in the iodine based electrolyte. This work indicates that rational construction of composite electrocatalytic materials paves an avenue for high-performance counter electrodes of DSSCs.

  10. Hes1 is required for appropriate morphogenesis and differentiation during mouse thyroid gland development.

    Directory of Open Access Journals (Sweden)

    Aurore Carre

    Full Text Available Notch signalling plays an important role in endocrine development, through its target gene Hes1. Hes1, a bHLH transcriptional repressor, influences progenitor cell proliferation and differentiation. Recently, Hes1 was shown to be expressed in the thyroid and regulate expression of the sodium iodide symporter (Nis. To investigate the role of Hes1 for thyroid development, we studied thyroid morphology and function in mice lacking Hes1. During normal mouse thyroid development, Hes1 was detected from E9.5 onwards in the median anlage, and at E11.5 in the ultimobranchial bodies. Hes1(-/- mouse embryos had a significantly lower number of Nkx2-1-positive progenitor cells (p<0.05 at E9.5 and at E11.5. Moreover, Hes1(-/- mouse embryos showed a significantly smaller total thyroid surface area (-40 to -60% compared to wild type mice at all study time points (E9.5-E16.5. In both Hes1(-/- and wild type mouse embryos, most Nkx2-1-positive thyroid cells expressed the cell cycle inhibitor p57 at E9.5 in correlation with low proliferation index. In Hes1(-/- mouse embryos, fusion of the median anlage with the ultimobranchial bodies was delayed by 3 days (E16.5 vs. E13.5 in wild type mice. After fusion of thyroid anlages, hypoplastic Hes1(-/- thyroids revealed a significantly decreased labelling area for T4 (-78% and calcitonin (-65% normalized to Nkx2-1 positive cells. Decreased T4-synthesis might be due to reduced Nis labelling area (-69%. These findings suggest a dual role of Hes1 during thyroid development: first, control of the number of both thyrocyte and C-cell progenitors, via a p57-independent mechanism; second, adequate differentiation and endocrine function of thyrocytes and C-cells.

  11. Modeling mixtures of thyroid gland function disruptors in a vertebrate alternative model, the zebrafish eleutheroembryo

    Energy Technology Data Exchange (ETDEWEB)

    Thienpont, Benedicte; Barata, Carlos [Department of Environmental Chemistry, Institute of Environmental Assessment and Water Research (IDAEA, CSIC), Jordi Girona, 18-26, 08034 Barcelona (Spain); Raldúa, Demetrio, E-mail: drpqam@cid.csic.es [Department of Environmental Chemistry, Institute of Environmental Assessment and Water Research (IDAEA, CSIC), Jordi Girona, 18-26, 08034 Barcelona (Spain); Maladies Rares: Génétique et Métabolisme (MRGM), University of Bordeaux, EA 4576, F-33400 Talence (France)

    2013-06-01

    Maternal thyroxine (T4) plays an essential role in fetal brain development, and even mild and transitory deficits in free-T4 in pregnant women can produce irreversible neurological effects in their offspring. Women of childbearing age are daily exposed to mixtures of chemicals disrupting the thyroid gland function (TGFDs) through the diet, drinking water, air and pharmaceuticals, which has raised the highest concern for the potential additive or synergic effects on the development of mild hypothyroxinemia during early pregnancy. Recently we demonstrated that zebrafish eleutheroembryos provide a suitable alternative model for screening chemicals impairing the thyroid hormone synthesis. The present study used the intrafollicular T4-content (IT4C) of zebrafish eleutheroembryos as integrative endpoint for testing the hypotheses that the effect of mixtures of TGFDs with a similar mode of action [inhibition of thyroid peroxidase (TPO)] was well predicted by a concentration addition concept (CA) model, whereas the response addition concept (RA) model predicted better the effect of dissimilarly acting binary mixtures of TGFDs [TPO-inhibitors and sodium-iodide symporter (NIS)-inhibitors]. However, CA model provided better prediction of joint effects than RA in five out of the six tested mixtures. The exception being the mixture MMI (TPO-inhibitor)-KClO{sub 4} (NIS-inhibitor) dosed at a fixed ratio of EC{sub 10} that provided similar CA and RA predictions and hence it was difficult to get any conclusive result. There results support the phenomenological similarity criterion stating that the concept of concentration addition could be extended to mixture constituents having common apical endpoints or common adverse outcomes. - Highlights: • Potential synergic or additive effect of mixtures of chemicals on thyroid function. • Zebrafish as alternative model for testing the effect of mixtures of goitrogens. • Concentration addition seems to predict better the effect of

  12. Modeling mixtures of thyroid gland function disruptors in a vertebrate alternative model, the zebrafish eleutheroembryo

    International Nuclear Information System (INIS)

    Thienpont, Benedicte; Barata, Carlos; Raldúa, Demetrio

    2013-01-01

    Maternal thyroxine (T4) plays an essential role in fetal brain development, and even mild and transitory deficits in free-T4 in pregnant women can produce irreversible neurological effects in their offspring. Women of childbearing age are daily exposed to mixtures of chemicals disrupting the thyroid gland function (TGFDs) through the diet, drinking water, air and pharmaceuticals, which has raised the highest concern for the potential additive or synergic effects on the development of mild hypothyroxinemia during early pregnancy. Recently we demonstrated that zebrafish eleutheroembryos provide a suitable alternative model for screening chemicals impairing the thyroid hormone synthesis. The present study used the intrafollicular T4-content (IT4C) of zebrafish eleutheroembryos as integrative endpoint for testing the hypotheses that the effect of mixtures of TGFDs with a similar mode of action [inhibition of thyroid peroxidase (TPO)] was well predicted by a concentration addition concept (CA) model, whereas the response addition concept (RA) model predicted better the effect of dissimilarly acting binary mixtures of TGFDs [TPO-inhibitors and sodium-iodide symporter (NIS)-inhibitors]. However, CA model provided better prediction of joint effects than RA in five out of the six tested mixtures. The exception being the mixture MMI (TPO-inhibitor)-KClO 4 (NIS-inhibitor) dosed at a fixed ratio of EC 10 that provided similar CA and RA predictions and hence it was difficult to get any conclusive result. There results support the phenomenological similarity criterion stating that the concept of concentration addition could be extended to mixture constituents having common apical endpoints or common adverse outcomes. - Highlights: • Potential synergic or additive effect of mixtures of chemicals on thyroid function. • Zebrafish as alternative model for testing the effect of mixtures of goitrogens. • Concentration addition seems to predict better the effect of mixtures of

  13. Increased expression of pro-angiogenic factors and vascularization in thyroid hyperfunctioning adenomas with and without TSH receptor activating mutations.

    Science.gov (United States)

    Celano, Marilena; Sponziello, Marialuisa; Tallini, Giovanni; Maggisano, Valentina; Bruno, Rocco; Dima, Mariavittoria; Di Oto, Enrico; Redler, Adriano; Durante, Cosimo; Sacco, Rosario; Filetti, Sebastiano; Russo, Diego

    2013-02-01

    Autonomously functioning thyroid nodules (AFTN) are known to receive an increased blood influx necessary to sustain their high rate of growth and hormone production. Here, we investigated the expression of hematic and lymphatic vases in a series of 20 AFTN compared with the contralateral non-tumor tissues of the same patients, and the transcript levels of proteins involved in the control of vascular proliferation, including the vascular endothelial growth factor (VEGF) and platelet-derived growth factors (PDGF) and their receptors and the endothelial nitric oxide synthase (eNOS). In parallel, the expression of the differentiation markers sodium/iodide symporter (NIS), thyroperoxidase (TPO), thyroglobulin (Tg), and TSH receptor (TSHR) was also investigated. The data were further analyzed comparing subgroups of tumors with or without mutations in the TSHR gene. Analysis by means of CD31 and D2-40 immunostaining showed in AFTN an increased number of hematic, but not lymphatic, vessels in parallel with an enhanced proliferation rate shown by increased Ki67 staining. Quantitative RT-PCR analysis revealed an increase of VEGF, VEGFR1 and 2, PDGF-A, PDGF-B, and eNOS expression in tumor versus normal tissues. Also, higher transcript levels of NIS, TPO, and Tg were detected. Comparison of the two subgroups of samples revealed only few differences in the expression of the genes examined. In conclusion, these data demonstrate an increased expression of angiogenesis-related factors associated with an enhanced proliferation of hematic, but not lymphatic, vessels in AFTNs. In this context, the presence of TSHR mutations may only slightly influence the expression of pro-angiogenic growth factors.

  14. [Tooth macromorphological and ultrastructural analysis of osteological material from the medieval locality of St. Panteleimon Church in Nis].

    Science.gov (United States)

    Mitić, Nadica; Mitić, Aleksandar; Mitić, Vladimir; Savić, Vojin; Nikolić, Marija

    2010-01-01

    Analysis of macromorphological and ultrastructural tooth characteristics of osteological material from the medieval site of St. Pantaleimon Church in Nis provides us with insight on the life, nutrition and habits of medieval population, as well as the structure and composition of their teeth. The aim of this research, based on the tooth inspection of skeletal remains from the medieval site of St. Pantaleimon Church in Nis, was to analyze macromorphological characteristics, ultrastructure of the dental tissue of maxillary and mandibular molars, canines and incisors, as well as their chemical composition. Macromorphological and ultrastructural analysis of the dental tissue of osteological material dating from the 12th century included 1312 teeth with advanced abrasion. Macromorphological changes were detected by using a dental mirror, probe and radiography. After irrigation, the teeth were prepared using the standard procedure and analyzed by scanning electronic microscopy (JEOL-JSM-5300). Chemical analysis was done by expanded downscaling (EDS) method for Mg, P, Ca. The analysis detected second degree abrasions of all teeth in individuals aged 20-25 years. Third and fourth degree abrasions of teeth were detected in individuals aged over 40 years. Ultrastructural analysis showed a complete obliteration of dentin tubules and pulp of the lower incisors, the apposition of intratubular dentin inside the tubules, as well as extensive deformity and loss of dentin structure on molars with preserved pulp volume and nerve fiber calcification. The calcification of nerve fibers showed that the formation of intratubular dentin was proportional with the biological potential of pulp and the degree of abrasion, and inversely proportional with the size of dentin surface. Chemical analysis showed that in the analyzed teeth Ca composition was slightly lower than that in the control group, P composition was almost identical, while Mg composition was multiply increased in comparison to

  15. Non-verbal Communication in a Neonatal Intensive Care Unit: A Video Audit Using Non-verbal Immediacy Scale (NIS-O).

    Science.gov (United States)

    Nimbalkar, Somashekhar Marutirao; Raval, Himalaya; Bansal, Satvik Chaitanya; Pandya, Utkarsh; Pathak, Ajay

    2018-05-03

    Effective communication with parents is a very important skill for pediatricians especially in a neonatal setup. The authors analyzed non-verbal communication of medical caregivers during counseling sessions. Recorded videos of counseling sessions from the months of March-April 2016 were audited. Counseling episodes were scored using Non-verbal Immediacy Scale Observer Report (NIS-O). A total of 150 videos of counseling sessions were audited. The mean (SD) total score on (NIS-O) was 78.96(7.07). Female counseled sessions had significantly higher proportion of low scores (p communication skills in a neonatal unit. This study lays down a template on which other Neonatal intensive care units (NICUs) can carry out gap defining audits.

  16. Phase I Trial of Intratumoral Administration of NIS-Expressing Strain of Measles Virus in Unresectable or Recurrent Malignant Peripheral Nerve Sheath Tumor

    Science.gov (United States)

    2017-10-01

    AWARD NUMBER: W81XWH-15-1-0115 TITLE: Phase I Trial of Intratumoral Administration of NIS-Expressing Strain of Measles Virus in Unresectable or...Fort Detrick, Maryland 21702-5012 DISTRIBUTION STATEMENT: Approved for Public Release; Distribution Unlimited REPORT DOCUMENTATION PAGE Form...Approved OMB No. 0704-0188 Public reporting burden for this collection of information is estimated to average 1 hour per response, including the time

  17. A two-step hydrothermal synthesis approach to synthesize NiCo2S4/NiS hollow nanospheres for high-performance asymmetric supercapacitors

    Science.gov (United States)

    Xu, Rui; Lin, Jianming; Wu, Jihuai; Huang, Miaoliang; Fan, Leqing; He, Xin; Wang, Yiting; Xu, Zedong

    2017-11-01

    In this work, a high-performance asymmetric supercapacitor device based on NiCo2S4/NiS hollow nanospheres as the positive electrode and the porous activated carbon as the negative electrode was successfully fabricated via a facile two-step hydrothermal synthesis approach. This NiCo2S4/NiS//activated carbon asymmetric supercapacitor achieved a high energy density of 43.7 Wh kg-1 at a power density of 160 W kg-1, an encouraging specific capacitance of 123 F g-1 at a current density of 1 mA cm-2, as well as a long-term performance with capacitance degradation of 5.2% after 3000 consecutive cycles at 1 mA cm-2. Moreover, the NiCo2S4/NiS electrode also demonstrated an excellent specific capacitance (1947.5 F g-1 at 3 mA cm-2) and an outstanding cycling stability (retaining 90.3% after 1000 cycles). The remarkable electrochemical performances may be attributed to the effect of NiS doping on NiCo2S4 which could enlarge the surface area and increase the surface roughness.

  18. Geothermal energy use in terms of a more balanced & sustainable urban-rural development of Southeast Serbia, with focus on Nis region

    Directory of Open Access Journals (Sweden)

    Jovanović Aleksandar

    2017-01-01

    Full Text Available The surrounding of Nis has been known for various geothermal manifestations (see Figure 3 and 4. The city itself has direct use of Nis Spa, where a couple of sites have been used for balneology and where heating systems have been installed. However, other local resources in Nis surrounding are little known. Also, Sokobanja has a long history of thermal waters 'use throughout its rich history, from the Antiquity throughout the middle ages and Turkish rule. This is also present in towns of Bela Palanka and Svrljig in South-East Serbian region surrounding Nis. These resources can be used for supplying the cities and villages with heat in the future. More importantly, communities in local towns in the region can be supported by more proficient use of geothermal potentials, as this idea supports the alleviated concentration of inhabitants in the region. It supports local renewable energy sources and a greater ration between potentials and actual use of geothermal sources, which tends to be very low in Serbian cities and rural places. In this paper, these resources are going to be presented, for the community in Serbia to have an insight and to be reminded of its potentials and significance for regional development and local resource utilization. Built heritage and urban-architectural wholes in some of these towns and in the villages, are neglected and geothermal resources in their vicinity underused. A more organized use of geothermal potentials can lead to their regenerations. It can support the idea of a more balanced rural-urban development of the region of Nis. However, geothermal energy can also be beneficial for future regional energy planning and cooperation between towns and villages in South-Eastern Serbian regions like Nis region. And this can be an important strategy in regional planning and energy planning for the future, once the economic crisis would stop to prevail in Serbia. The authors of this paper point out to the long

  19. The nucleobase cation symporter 1 of Chlamydomonas reinhardtii and that of the evolutionarily distant Arabidopsis thaliana display parallel function and establish a plant-specific solute transport profile.

    Science.gov (United States)

    Schein, Jessica R; Hunt, Kevin A; Minton, Janet A; Schultes, Neil P; Mourad, George S

    2013-09-01

    The single cell alga Chlamydomonas reinhardtii is capable of importing purines as nitrogen sources. An analysis of the annotated C. reinhardtii genome reveals at least three distinct gene families encoding for known nucleobase transporters. In this study the solute transport and binding properties for the lone C. reinhardtii nucleobase cation symporter 1 (CrNCS1) are determined through heterologous expression in Saccharomyces cerevisiae. CrNCS1 acts as a transporter of adenine, guanine, uracil and allantoin, sharing similar - but not identical - solute recognition specificity with the evolutionary distant NCS1 from Arabidopsis thaliana. The results suggest that the solute specificity for plant NCS1 occurred early in plant evolution and are distinct from solute transport specificities of single cell fungal NCS1 proteins. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  20. CD147 subunit of lactate/H+ symporters MCT1 and hypoxia-inducible MCT4 is critical for energetics and growth of glycolytic tumors.

    Science.gov (United States)

    Le Floch, Renaud; Chiche, Johanna; Marchiq, Ibtissam; Naiken, Tanesha; Naïken, Tanesha; Ilc, Karine; Ilk, Karine; Murray, Clare M; Critchlow, Susan E; Roux, Danièle; Simon, Marie-Pierre; Pouysségur, Jacques

    2011-10-04

    Malignant tumors exhibit increased dependence on glycolysis, resulting in abundant export of lactic acid, a hypothesized key step in tumorigenesis. Lactic acid is mainly transported by two H(+)/lactate symporters, MCT1/MCT4, that require the ancillary protein CD147/Basigin for their functionality. First, we showed that blocking MCT1/2 in Ras-transformed fibroblasts with AR-C155858 suppressed lactate export, glycolysis, and tumor growth, whereas ectopic expression of MCT4 in these cells conferred resistance to MCT1/2 inhibition and reestablished tumorigenicty. A mutant-derivative, deficient in respiration (res(-)) and exclusively relying on glycolysis for energy, displayed low tumorigenicity. These res(-) cells could develop resistance to MCT1/2 inhibition and became highly tumorigenic by reactivating their endogenous mct4 gene, highlighting that MCT4, the hypoxia-inducible and tumor-associated lactate/H(+) symporter, drives tumorigenicity. Second, in the human colon adenocarcinoma cell line (LS174T), we showed that combined silencing of MCT1/MCT4 via inducible shRNA, or silencing of CD147/Basigin alone, significantly reduced glycolytic flux and tumor growth. However, both silencing approaches, which reduced tumor growth, displayed a low level of CD147/Basigin, a multifunctional protumoral protein. To gain insight into CD147/Basigin function, we designed experiments, via zinc finger nuclease-mediated mct4 and basigin knockouts, to uncouple MCTs from Basigin expression. Inhibition of MCT1 in MCT4-null, Basigin(high) cells suppressed tumor growth. Conversely, in Basigin-null cells, in which MCT activity had been maintained, tumorigenicity was not affected. Collectively, these findings highlight that the major protumoral action of CD147/Basigin is to control the energetics of glycolytic tumors via MCT1/MCT4 activity and that blocking lactic acid export provides an efficient anticancer strategy.

  1. Observation of the structural, optical and magnetic properties during the transformation from hexagonal NiS nano-compounds to cubic NiO nanostructures due to thermal oxidation

    Energy Technology Data Exchange (ETDEWEB)

    Linganiso, E.C., E-mail: elinganiso@csir.co.za [National Centre for Nano-Structured Materials, Council for Scientific and Industrial Research, P.O. Box 395, Pretoria 0001 (South Africa); DST/NRF Centre of Excellence in Strong Materials, Molecular Sciences Institute, School of Chemistry, University of the Witwatersrand, Private Bag 3, Johannesburg, Wits 2050 (South Africa); Mwakikunga, B.W., E-mail: bmwakikunga@csir.co.za [National Centre for Nano-Structured Materials, Council for Scientific and Industrial Research, P.O. Box 395, Pretoria 0001 (South Africa); Coville, N.J. [DST/NRF Centre of Excellence in Strong Materials, Molecular Sciences Institute, School of Chemistry, University of the Witwatersrand, Private Bag 3, Johannesburg, Wits 2050 (South Africa); Mhlanga, S.D. [Department of Applied Chemistry, University of Johannesburg, PO Box 17011, Doornfontein, 2028 Johannesburg (South Africa)

    2015-04-25

    Graphical abstract: The transition temperature of 350 °C for the formation of c-NiO from h-NiS oxidation was obtained from structural and optical property studies and by calculating the number of spins obtained from the EPR data. Vibrating sample magnetometry (VSM) shows that this pure NiS has both ferromagnetic ordering and paramagnetic domains. Further, the transition temperature of −9 °C of the pure α-NiS nano-alloys was confirmed by performing electrical measurements on the as-synthesized material. - Highlights: • Single hexagonal phase NiS obtained by microwave assisted hydrothermal synthesis. • NiS nanoalloys show both ferromagnetic and paramagnetic domains by VSM. • Structural evolution of annealed NiS and temperature dependent NiS oxidation presented. • Phase transition from NiS to NiO studied and correlated to the EPR spin population data and crystallite size. • Ferromagnetic and paramagnetic ordering observed for the raw NiS nanostructures. - Abstract: Single phase α-NiS nano-compounds with uniformly distributed hierarchical networks were synthesized by a microwave-assisted hydrothermal technique. The materials were evaluated for thermal stability under an oxidative environment and at temperatures between 150 °C and 600 °C. NiS materials showed stability at 300 °C and NiO formation was observed from 350 °C to 600 °C. The annealing effect on the crystalline size and IR absorption of the annealed samples is reported by XRD and FTIR studied. The EPR properties of the annealed materials were studied and compared to the oxidized materials. The transition temperature of 350 °C for the formation of NiO from NiS oxidation was confirmed by calculating the number of spins obtained from the EPR data. Vibrating sample magnetometry (VSM) shows that this pure NiS has both ferromagnetic ordering and paramagnetic domains. Further, the transition temperature of −9 °C of the pure α-NiS nano-compounds was confirmed by performing electrical

  2. The Water Reuse project: Sustainable waste water re-use technologies for irrigated land in NIS and southern European states; project overview and results.

    Science.gov (United States)

    van den Elsen, E.; Doerr, S.; Ritsema, C. J.

    2009-04-01

    In irrigated areas in the New Independent States (NIS) and southern European States, inefficient use of conventional water resources occurs through incomplete wetting of soils, which causes accelerated runoff and preferential flow, and also through excessive evaporation associated with unhindered capillary rise. Furthermore, a largely unexploited potential exists to save conventional irrigation water by supplementation with organic-rich waste water, which, if used appropriately, can also lead to improvements to soil physical properties and soil nutrient and organic matter content. This project aims to (a) reduce irrigation water losses by developing, evaluating and promoting techniques that improve the wetting properties of soils, and (b) investigate the use of organic-rich waste water as a non-conventional water resource in irrigation and, in addition, as a tool in improving soil physical properties and soil nutrient and organic matter content. Key activities include (i) identifying, for the NIS and southern European partner countries, the soil type/land use combinations, for which the above approaches are expected to be most effective and their implementation most feasible, using physical and socio-economic research methods, and (ii) examining the water saving potential, physical, biological and chemical effects on soils of the above approaches, and also their impact on performance. Expected outputs include techniques for sustainable improvements in soil wettability management as a novel approach in water saving, detailed evaluation of the prospects and effects of using supplemental organic-rich waste waters in irrigation, an advanced process-based numerical hydrological model, fully adapted to quantify and upscale resulting water savings and nutrient and potential contaminant fluxes for irrigated areas, and identification of suitable areas in the NIS and Mediterranean (in soil, land use, legislative and socio-economic terms) for implementation.

  3. Radioactive iodine treatment of differentiated thyroid carcinoma in teenager

    International Nuclear Information System (INIS)

    Chen Yonghui

    2008-01-01

    Incidence rate of differentiated thyroid carcinoma in teenager is not high. It has some different characteristics compared to adult differentiated thyroid carcinoma. Such as larger tumor at diagnosis; greater prevalence of neck lymph node and distant metastases at diagnosis; more sodium-iodide symporter expression; high recurrence rate but higher overall survival rate. 131 I administration to remove residual thyroid tissue and treat metastases is still one of the important approaches after surgery. (authors)

  4. “GUERRA DE OLHARES”: EMULAÇÃO E AGUDEZA EM VÊNUS E ADÔNIS (1593, DE WILLIAM SHAKESPEARE

    Directory of Open Access Journals (Sweden)

    Lavinia Silvares

    2013-12-01

    Full Text Available Neste artigo, proponho investigar alguns aspectos da relação entre a emulação dos antigos e a produção da agudeza em Vênus e Adônis, de Shakespeare, publicado pela primeira vez em 1593, em Londres. Nesse poema narrativo, a emulação de uma passagem das Metamorfoses de Ovídio é explícita e marca o lugar de autoridade a partir do qual diversas técnicas retórico-poéticas de amplificação do tópico inventivo e elocutivo serão empregadas para efetuar a agudeza do poema. Assim, proponho discutir como se legitimam as novidades de matéria e estilo poético em Vênus e Adônis ao mesmo tempo em que se preservam, retoricamente, as relações de pertencimento à autoridade antiga imitada. Para esse propósito, refiro-me a um texto preceptivo da época, o Discurso comparativo, de Francis Meres, para discutir como se realiza a operação de associação dos “novos” poetas a autoridades antigas.

  5. Main results of ten years co-operation with Nis in the field of physical protection of nuclear materials and nuclear facilities

    International Nuclear Information System (INIS)

    Salewski, P.; Gutschmidt, W.

    2001-01-01

    The Federal Republic of Germany (FRG), the Russian Federation (RF) and the New Independent States (NIS) have been working closely together since 1992 in the field of physical protection. The success of this co-operative work is based on mutually beneficial agreements between corresponding FRG and RF ministries. The main working points of these agreements were a) a mutual exchange of information and experience, and b) assistance in developing licensing and regulatory procedures and guidelines, and c) physical upgrades to Russian nuclear facilities. The first two points have been established by holding seminars, workshops and by on-site instruction. Upgrades of RF nuclear installations, financed by the FRG were performed at: the Bochvar Institute in Moscow, the Kurchatov Institute in Moscow and the Mayak reactor plant in Chelyabinsk. This paper will outline the progress made to date and the GRS procedure for achieving successful co-operation with its RF and NIS counterparts. The major results of ten years cooperation will be shown. The following document describes the experiences gained during the evaluation of security reports by GRS as an external expert organisation in contract with the Supervisory Authorities. (authors)

  6. Two siblings with early infantile myoclonic encephalopathy due to mutation in the gene encoding mitochondrial glutamate/H+ symporter SLC25A22.

    Science.gov (United States)

    Cohen, Rony; Basel-Vanagaite, Lina; Goldberg-Stern, Hadassah; Halevy, Ayelet; Shuper, Avinoam; Feingold-Zadok, Michal; Behar, Doron M; Straussberg, Rachel

    2014-11-01

    To characterize a new subset of early myoclonic encephalopathy usually associated with metabolic etiologies with a new genetic entity. We describe two siblings with early myoclonic encephalopathy born to consanguineous parents of Arab Muslim origin from Israel. We used homozygosity mapping and candidate gene sequencing to reveal the genetic basis of the myoclonic syndrome. We found a rare missense mutation in the gene encoding one of the two mitochondrial glutamate/H symporters, SLC25A22. The phenotype of early myoclonic encephalopathy was first linked to the same mutation in 2005 in patients of the same ethnicity as our family. Owing to the devastating nature of this encephalopathy, we focus attention on its clinical history, epileptic semiology, distinct electroencephalography features, and genetic basis. We provide the evidence that an integrated diagnostic strategy combining homozygosity mapping with candidate gene sequencing is efficient in consanguineous families with highly heterogeneous autosomal recessive diseases. Copyright © 2014 European Paediatric Neurology Society. Published by Elsevier Ltd. All rights reserved.

  7. Characterization of a novel sialic acid transporter of the sodium solute symporter (SSS) family and in vivo comparison with known bacterial sialic acid transporters.

    Science.gov (United States)

    Severi, Emmanuele; Hosie, Arthur H F; Hawkhead, Judith A; Thomas, Gavin H

    2010-03-01

    The function of sialic acids in the biology of bacterial pathogens is reflected by the diverse range of solute transporters that can recognize these sugar acids. Here, we use an Escherichia coliDeltananT strain to characterize the function of known and proposed bacterial sialic acid transporters. We discover that the STM1128 gene from Salmonella enterica serovar Typhimurium, which encodes a member of the sodium solute symporter family, is able to restore growth on sialic acid to the DeltananT strain and is able to transport [(14)C]-sialic acid. Using the DeltananT genetic background, we performed a direct in vivo comparison of the transport properties of the STM1128 protein with those of sialic acid transporters of the major facilitator superfamily and tripartite ATP-independent periplasmic families, E. coli NanT and Haemophilus influenzae SiaPQM, respectively. This revealed that both STM1128 and SiaPQM are sodium-dependent and, unlike SiaPQM, both STM1128 and NanT are reversible secondary carriers, demonstrating qualitative functional differences in the properties of sialic acid transporters used by bacteria that colonize humans.

  8. CO-occurring exposure to perchlorate, nitrate and thiocyanate alters thyroid function in healthy pregnant women

    Energy Technology Data Exchange (ETDEWEB)

    Horton, Megan K., E-mail: megan.horton@mssm.edu [Department of Preventive Medicine, Icahn School of Medicine, New York, New York (United States); Blount, Benjamin C.; Valentin-Blasini, Liza [National Center for Environmental Health, Centers for Disease Control and Prevention, Atlanta, Georgia (United States); Wapner, Ronald [Department of Obstetrics and Gynecology, Columbia University, New York, New York (United States); Whyatt, Robin [Department of Environmental Health Sciences, Mailman School of Public Health, Columbia University, New York, New York (United States); Gennings, Chris [Department of Preventive Medicine, Icahn School of Medicine, New York, New York (United States); Factor-Litvak, Pam [Department of Epidemiology, Mailman School of Public Health, Columbia University, New York, New York (United States)

    2015-11-15

    Background: Adequate maternal thyroid function during pregnancy is necessary for normal fetal brain development, making pregnancy a critical window of vulnerability to thyroid disrupting insults. Sodium/iodide symporter (NIS) inhibitors, namely perchlorate, nitrate, and thiocyanate, have been shown individually to competitively inhibit uptake of iodine by the thyroid. Several epidemiologic studies examined the association between these individual exposures and thyroid function. Few studies have examined the effect of this chemical mixture on thyroid function during pregnancy Objectives: We examined the cross sectional association between urinary perchlorate, thiocyanate and nitrate concentrations and thyroid function among healthy pregnant women living in New York City using weighted quantile sum (WQS) regression. Methods: We measured thyroid stimulating hormone (TSH) and free thyroxine (FreeT4) in blood samples; perchlorate, thiocyanate, nitrate and iodide in urine samples collected from 284 pregnant women at 12 (±2.8) weeks gestation. We examined associations between urinary analyte concentrations and TSH or FreeT4 using linear regression or WQS adjusting for gestational age, urinary iodide and creatinine. Results: Individual analyte concentrations in urine were significantly correlated (Spearman's r 0.4–0.5, p<0.001). Linear regression analyses did not suggest associations between individual concentrations and thyroid function. The WQS revealed a significant positive association between the weighted sum of urinary concentrations of the three analytes and increased TSH. Perchlorate had the largest weight in the index, indicating the largest contribution to the WQS. Conclusions: Co-exposure to perchlorate, nitrate and thiocyanate may alter maternal thyroid function, specifically TSH, during pregnancy. - Highlights: • Perchlorate, nitrate, thiocyanate and iodide measured in maternal urine. • Thyroid function (TSH and Free T4) measured in maternal blood

  9. Fluoride caused thyroid endocrine disruption in male zebrafish (Danio rerio).

    Science.gov (United States)

    Jianjie, Chen; Wenjuan, Xue; Jinling, Cao; Jie, Song; Ruhui, Jia; Meiyan, Li

    2016-02-01

    Excessive fluoride in natural water ecosystem has the potential to detrimentally affect thyroid endocrine system, but little is known of such effects or underlying mechanisms in fish. In the present study, we evaluated the effects of fluoride on growth performance, thyroid histopathology, thyroid hormone levels, and gene expressions in the HPT axis in male zebrafish (Danio rerio) exposed to different determined concentrations of 0.1, 0.9, 2.0 and 4.1 M of fluoride to investigate the effects of fluoride on thyroid endocrine system and the potential toxic mechanisms caused by fluoride. The results indicated that the growth of the male zebrafish used in the experiments was significantly inhibited, the thyroid microtrastructure was changed, and the levels of T3 and T4 were disturbed in fluoride-exposed male fish. In addition, the expressional profiles of genes in HPT axis displayed alteration. The expressions of all studied genes were significantly increased in all fluoride-exposed male fish after exposure for 45 days. The transcriptional levels of corticotrophin-releasing hormone (CRH), thyroid-stimulating hormone (TSH), thyroglobulin (TG), sodium iodide symporter (NIS), iodothyronine I (DIO1), and thyroid hormone receptor alpha (TRα) were also elevated in all fluoride-exposed male fish after 90 days of exposure, while the inconsistent expressions were found in the mRNA of iodothyronineⅡ (DIO2), UDP glucuronosyltransferase 1 family a, b (UGT1ab), transthyretin (TTR), and thyroid hormone receptor beta (TRβ). These results demonstrated that fluoride could notably inhibit the growth of zebrafish, and significantly affect thyroid endocrine system by changing the microtrastructure of thyroid, altering thyroid hormone levels and endocrine-related gene expressions in male zebrafish. All above indicated that fluoride could pose a great threat to thyroid endocrine system, thus detrimentally affected the normal function of thyroid of male zebrafish. Copyright © 2015

  10. Human reporter genes: potential use in clinical studies

    Energy Technology Data Exchange (ETDEWEB)

    Serganova, Inna [Department of Neurology, Memorial Sloan-Kettering Cancer Center, New York, NY 10021 (United States); Ponomarev, Vladimir [Department of Radiology, Memorial Sloan-Kettering Cancer Center, New York, NY 10021 (United States); Blasberg, Ronald [Department of Neurology, Memorial Sloan-Kettering Cancer Center, New York, NY 10021 (United States); Department of Radiology, Memorial Sloan-Kettering Cancer Center, New York, NY 10021 (United States)], E-mail: blasberg@neuro1.mskcc.org

    2007-10-15

    The clinical application of positron-emission-tomography-based reporter gene imaging will expand over the next several years. The translation of reporter gene imaging technology into clinical applications is the focus of this review, with emphasis on the development and use of human reporter genes. Human reporter genes will play an increasingly more important role in this development, and it is likely that one or more reporter systems (human gene and complimentary radiopharmaceutical) will take leading roles. Three classes of human reporter genes are discussed and compared: receptors, transporters and enzymes. Examples of highly expressed cell membrane receptors include specific membrane somatostatin receptors (hSSTrs). The transporter group includes the sodium iodide symporter (hNIS) and the norepinephrine transporter (hNET). The endogenous enzyme classification includes human mitochondrial thymidine kinase 2 (hTK2). In addition, we also discuss the nonhuman dopamine 2 receptor and two viral reporter genes, the wild-type herpes simplex virus 1 thymidine kinase (HSV1-tk) gene and the HSV1-tk mutant (HSV1-sr39tk). Initial applications of reporter gene imaging in patients will be developed within two different clinical disciplines: (a) gene therapy and (b) adoptive cell-based therapies. These studies will benefit from the availability of efficient human reporter systems that can provide critical monitoring information for adenoviral-based, retroviral-based and lenteviral-based gene therapies, oncolytic bacterial and viral therapies, and adoptive cell-based therapies. Translational applications of noninvasive in vivo reporter gene imaging are likely to include: (a) quantitative monitoring of gene therapy vectors for targeting and transduction efficacy in clinical protocols by imaging the location, extent and duration of transgene expression; (b) monitoring of cell trafficking, targeting, replication and activation in adoptive T-cell and stem/progenitor cell therapies

  11. Curcumin induces G2/M arrest, apoptosis, NF-κB inhibition, and expression of differentiation genes in thyroid carcinoma cells.

    Science.gov (United States)

    Schwertheim, Suzan; Wein, Frederik; Lennartz, Klaus; Worm, Karl; Schmid, Kurt Werner; Sheu-Grabellus, Sien-Yi

    2017-07-01

    The therapy of unresectable advanced thyroid carcinomas shows unfavorable outcome. Constitutive nuclear factor-κB (NF-κB) activation in thyroid carcinomas frequently contributes to therapeutic resistance; the radioiodine therapy often fails due to the loss of differentiated functions in advanced thyroid carcinomas. Curcumin is known for its anticancer properties in a series of cancers, but only few studies have focused on thyroid cancer. Our aim was to evaluate curcumin's molecular mechanisms and to estimate if curcumin could be a new therapeutic option in advanced thyroid cancer. Human thyroid cancer cell lines TPC-1 (papillary), FTC-133 (follicular), and BHT-101 (anaplastic) were treated with curcumin. Using real-time PCR analysis, we investigated microRNA (miRNA) and mRNA expression levels. Cell cycle, Annexin V/PI staining, and caspase-3 activity analysis were performed to detect apoptosis. NF-κB p65 activity and cell proliferation were analyzed using appropriate ELISA-based colorimetric assay kits. Treatment with 50 μM curcumin significantly increased the mRNA expression of the differentiation genes thyroglobulin (TG) and sodium iodide symporter (NIS) in all three cell lines and induced inhibition of cell proliferation, apoptosis, and decrease of NF-κB p65 activity. The miRNA expression analyses showed a significant deregulation of miRNA-200c, -21, -let7c, -26a, and -125b, known to regulate cell differentiation and tumor progression. Curcumin arrested cell growth at the G2/M phase. Curcumin increases the expression of redifferentiation markers and induces G2/M arrest, apoptosis, and downregulation of NF-κB activity in thyroid carcinoma cells. Thus, curcumin appears to be a promising agent to overcome resistance to the conventional cancer therapy.

  12. Genome-wide analysis of Pax8 binding provides new insights into thyroid functions

    Directory of Open Access Journals (Sweden)

    Ruiz-Llorente Sergio

    2012-04-01

    Full Text Available Abstract Background The transcription factor Pax8 is essential for the differentiation of thyroid cells. However, there are few data on genes transcriptionally regulated by Pax8 other than thyroid-related genes. To better understand the role of Pax8 in the biology of thyroid cells, we obtained transcriptional profiles of Pax8-silenced PCCl3 thyroid cells using whole genome expression arrays and integrated these signals with global cis-regulatory sequencing studies performed by ChIP-Seq analysis Results Exhaustive analysis of Pax8 immunoprecipitated peaks demonstrated preferential binding to intragenic regions and CpG-enriched islands, which suggests a role of Pax8 in transcriptional regulation of orphan CpG regions. In addition, ChIP-Seq allowed us to identify Pax8 partners, including proteins involved in tertiary DNA structure (CTCF and chromatin remodeling (Sp1, and these direct transcriptional interactions were confirmed in vivo. Moreover, both factors modulate Pax8-dependent transcriptional activation of the sodium iodide symporter (Nis gene promoter. We ultimately combined putative and novel Pax8 binding sites with actual target gene expression regulation to define Pax8-dependent genes. Functional classification suggests that Pax8-regulated genes may be directly involved in important processes of thyroid cell function such as cell proliferation and differentiation, apoptosis, cell polarity, motion and adhesion, and a plethora of DNA/protein-related processes. Conclusion Our study provides novel insights into the role of Pax8 in thyroid biology, exerted through transcriptional regulation of important genes involved in critical thyrocyte processes. In addition, we found new transcriptional partners of Pax8, which functionally cooperate with Pax8 in the regulation of thyroid gene transcription. Besides, our data demonstrate preferential location of Pax8 in non-promoter CpG regions. These data point to an orphan CpG island-mediated mechanism

  13. CO-occurring exposure to perchlorate, nitrate and thiocyanate alters thyroid function in healthy pregnant women

    International Nuclear Information System (INIS)

    Horton, Megan K.; Blount, Benjamin C.; Valentin-Blasini, Liza; Wapner, Ronald; Whyatt, Robin; Gennings, Chris; Factor-Litvak, Pam

    2015-01-01

    Background: Adequate maternal thyroid function during pregnancy is necessary for normal fetal brain development, making pregnancy a critical window of vulnerability to thyroid disrupting insults. Sodium/iodide symporter (NIS) inhibitors, namely perchlorate, nitrate, and thiocyanate, have been shown individually to competitively inhibit uptake of iodine by the thyroid. Several epidemiologic studies examined the association between these individual exposures and thyroid function. Few studies have examined the effect of this chemical mixture on thyroid function during pregnancy Objectives: We examined the cross sectional association between urinary perchlorate, thiocyanate and nitrate concentrations and thyroid function among healthy pregnant women living in New York City using weighted quantile sum (WQS) regression. Methods: We measured thyroid stimulating hormone (TSH) and free thyroxine (FreeT4) in blood samples; perchlorate, thiocyanate, nitrate and iodide in urine samples collected from 284 pregnant women at 12 (±2.8) weeks gestation. We examined associations between urinary analyte concentrations and TSH or FreeT4 using linear regression or WQS adjusting for gestational age, urinary iodide and creatinine. Results: Individual analyte concentrations in urine were significantly correlated (Spearman's r 0.4–0.5, p<0.001). Linear regression analyses did not suggest associations between individual concentrations and thyroid function. The WQS revealed a significant positive association between the weighted sum of urinary concentrations of the three analytes and increased TSH. Perchlorate had the largest weight in the index, indicating the largest contribution to the WQS. Conclusions: Co-exposure to perchlorate, nitrate and thiocyanate may alter maternal thyroid function, specifically TSH, during pregnancy. - Highlights: • Perchlorate, nitrate, thiocyanate and iodide measured in maternal urine. • Thyroid function (TSH and Free T4) measured in maternal blood

  14. Human reporter genes: potential use in clinical studies

    International Nuclear Information System (INIS)

    Serganova, Inna; Ponomarev, Vladimir; Blasberg, Ronald

    2007-01-01

    The clinical application of positron-emission-tomography-based reporter gene imaging will expand over the next several years. The translation of reporter gene imaging technology into clinical applications is the focus of this review, with emphasis on the development and use of human reporter genes. Human reporter genes will play an increasingly more important role in this development, and it is likely that one or more reporter systems (human gene and complimentary radiopharmaceutical) will take leading roles. Three classes of human reporter genes are discussed and compared: receptors, transporters and enzymes. Examples of highly expressed cell membrane receptors include specific membrane somatostatin receptors (hSSTrs). The transporter group includes the sodium iodide symporter (hNIS) and the norepinephrine transporter (hNET). The endogenous enzyme classification includes human mitochondrial thymidine kinase 2 (hTK2). In addition, we also discuss the nonhuman dopamine 2 receptor and two viral reporter genes, the wild-type herpes simplex virus 1 thymidine kinase (HSV1-tk) gene and the HSV1-tk mutant (HSV1-sr39tk). Initial applications of reporter gene imaging in patients will be developed within two different clinical disciplines: (a) gene therapy and (b) adoptive cell-based therapies. These studies will benefit from the availability of efficient human reporter systems that can provide critical monitoring information for adenoviral-based, retroviral-based and lenteviral-based gene therapies, oncolytic bacterial and viral therapies, and adoptive cell-based therapies. Translational applications of noninvasive in vivo reporter gene imaging are likely to include: (a) quantitative monitoring of gene therapy vectors for targeting and transduction efficacy in clinical protocols by imaging the location, extent and duration of transgene expression; (b) monitoring of cell trafficking, targeting, replication and activation in adoptive T-cell and stem/progenitor cell therapies

  15. Sterol regulatory element-binding proteins are regulators of the rat thyroid peroxidase gene in thyroid cells.

    Directory of Open Access Journals (Sweden)

    Christine Rauer

    Full Text Available Sterol regulatory element-binding proteins (SREBPs-1c and -2, which were initially discovered as master transcriptional regulators of lipid biosynthesis and uptake, were recently identified as novel transcriptional regulators of the sodium-iodide symporter gene in the thyroid, which is essential for thyroid hormone synthesis. Based on this observation that SREBPs play a role for thyroid hormone synthesis, we hypothesized that another gene involved in thyroid hormone synthesis, the thyroid peroxidase (TPO gene, is also a target of SREBP-1c and -2. Thyroid epithelial cells treated with 25-hydroxycholesterol, which is known to inhibit SREBP activation, had about 50% decreased mRNA levels of TPO. Similarly, the mRNA level of TPO was reduced by about 50% in response to siRNA mediated knockdown of both, SREBP-1 and SREBP-2. Reporter gene assays revealed that overexpression of active SREBP-1c and -2 causes a strong transcriptional activation of the rat TPO gene, which was localized to an approximately 80 bp region in the intron 1 of the rat TPO gene. In vitro- and in vivo-binding of both, SREBP-1c and SREBP-2, to this region in the rat TPO gene could be demonstrated using gel-shift assays and chromatin immunoprecipitation. Mutation analysis of the 80 bp region of rat TPO intron 1 revealed two isolated and two overlapping SREBP-binding elements from which one, the overlapping SRE+609/InvSRE+614, was shown to be functional in reporter gene assays. In connection with recent findings that the rat NIS gene is also a SREBP target gene in the thyroid, the present findings suggest that SREBPs may be possible novel targets for pharmacological modulation of thyroid hormone synthesis.

  16. Effect of the micronutrient iodine in thyroid carcinoma angiogenesis.

    Science.gov (United States)

    Daniell, Kayla; Nucera, Carmelo

    2016-12-20

    Iodide is a micronutrient essential for thyroid hormone production. The uptake and metabolism of iodide by thyrocytes is crucial to proper thyroid function. Iodide ions are drawn into the thyroid follicular cell via the sodium-iodide symporter (NIS) in the cell membrane and become integrated into tyrosyl residues to ultimately form thyroid hormones. We sought to learn how an abnormal concentration of iodide within thyrocyte can have significant effects on the thyroid, specifically the surrounding vascular network. Insufficient levels of iodide can lead to increased expression or activity of several pathways, including vascular endothelial growth factor (VEGF). The VEGF protein fuel vessel growth (angiogenesis) and therefore enhances the nutrients available to surrounding cells. Alternatively, normal/surplus iodide levels can have inhibitory effects on angiogenesis. Varying levels of iodide in the thyroid can influence thyroid carcinoma cell proliferation and angiogenesis via regulation of the hypoxia inducible factor-1 (HIF-1) and VEGF-dependent pathway. We have reviewed a number of studies to investigate how the effect of iodide on angiogenic and oxidative stress regulation can affect the viability of thyroid carcinoma cells. The various studies outlined give key insights to the role of iodide in thyroid follicles function and vascular growth, generally highlighting that insufficient levels of iodide stimulate pathways resulting in vascular growth, and viceversa normal/surplus iodide levels inhibit such pathways. Intriguingly, TSH and iodine levels differentially regulate the expression levels of angiogenic factors. All cells, including carcinoma cells, increase uptake of blood nutrients, meaning the vascular profile is influential to tumor growth and progression. Importantly, variation in the iodine concentrations also influence BRAF V600E -mediated oncogenic activity and might deregulate tumor proliferation. Although the mechanisms are not well eluted, iodine

  17. Mechanisms and rates of proton transfer to coordinated carboxydithioates: studies on [Ni(S2CR){PhP(CH2CH2PPh2)2}](+) (R = Me, Et, Bu(n) or Ph).

    Science.gov (United States)

    Alwaaly, Ahmed; Clegg, William; Henderson, Richard A; Probert, Michael R; Waddell, Paul G

    2015-02-21

    The complexes [Ni(S2CR)(triphos)]BPh4 (R = Me, Et, Bu(n) or Ph; triphos = PhP{CH2CH2PPh2}2) have been prepared and characterised. X-ray crystallography (for R = Et, Ph, C6H4Me-4, C6H4OMe-4 and C6H4Cl-4) shows that the geometry of the five-coordinate nickel in the cation is best described as distorted trigonal bipyramidal, containing a bidentate carboxydithioate ligand with the two sulfur atoms spanning axial and equatorial sites, the other axial site being occupied by the central phosphorus of triphos. The reactions of [Ni(S2CR)(triphos)](+) with mixtures of HCl and Cl(-) in MeCN to form equilibrium solutions containing [Ni(SH(S)CR)(triphos)](2+) have been studied using stopped-flow spectrophotometry. The kinetics show that proton transfer is slower than the diffusion-controlled limit and involves at least two coupled equilibria. The first step involves the rapid association between [Ni(S2CR)(triphos)](+) and HCl to form the hydrogen-bonded precursor, {[Ni(S2CR)(triphos)](+)HCl} (K) and this is followed by the intramolecular proton transfer (k) to produce [Ni(SH(S)CR)(triphos)](2+). In the reaction of [Ni(S2CMe)(triphos)](+) the rate law is consistent with the carboxydithioate ligand undergoing chelate ring-opening after protonation. It seems likely that chelate ring-opening occurs for all [Ni(S2CR)(triphos)](+), but only with [Ni(S2CMe)(triphos)](+) is the protonation step sufficiently fast that chelate ring-opening is rate-limiting. With all other systems, proton transfer is rate-limiting. DFT calculations indicate that protonation can occur at either sulfur atom, but only protonation at the equatorial sulfur results in chelate ring-opening. The ways in which protonation of either sulfur atom complicates the analyses and interpretation of the kinetics are discussed.

  18. EPIDEMIOLOGICAL - DEMOGRAPHIC CHARACTERISTIC OF SUICIDE ATTEMPTS IN ADOLESCENS TREATED AT THE INSTITUTE FOR MENTAL HEALTH IN NIS IN PERIOD OF 1999-2003

    Directory of Open Access Journals (Sweden)

    Ljubomir Milosavljevic

    2004-07-01

    Full Text Available The topic of this work is an epidemiological research of the suicide attempts of adolescents treated at the Institute for Mental Health Nis. The investigation comprises the period from 1999 up to 2003 year. The number of adolescents suicide attempts is increasing, and it is the highest one in 2003 year. Suicide attempt is most frequent with elderly female adolescents aged 17. A suicide attempt is preceded with manifestation in a form of mood disturbance in the scope of reactive situations. A dysfunctional family is the suicidal adolescent’s framework within which he moves while as, a means for the attempt, benzodiazepin’s group of medicaments is chosen by him.

  19. Water transport by Na+-coupled cotransporters of glucose (SGLT1) and of iodide (NIS). The dependence of substrate size studied at high resolution

    DEFF Research Database (Denmark)

    Zeuthen, Thomas; Belhage, Bo; Zeuthen, Emil

    2005-01-01

    and osmosis at the membrane with diffusion in the cytoplasm. The combination of high resolution measurements and precise modelling showed that water transport across the membrane can be explained by cotransport of water in the membrane proteins and that intracellular unstirred layers effects are minute.......The relation between substrate and water transport was studied in Na+-coupled cotransporters of glucose (SGLT1) and of iodide (NIS) expressed in Xenopus oocytes. The water transport was monitored from changes in oocyte volume at a resolution of 20 pl, more than one order of magnitude better than...... previous investigations. The rate of cotransport was monitored as the clamp current obtained from two-electrode voltage clamp. The high resolution data demonstrated a fixed ratio between the turn-over of the cotransporter and the rate of water transport. This applied to experiments in which the rate...

  20. Saccharomyces cerevisiae glycerol/H+ symporter Stl1p is essential for cold/near-freeze and freeze stress adaptation. A simple recipe with high biotechnological potential is given

    Directory of Open Access Journals (Sweden)

    Ferreira Célia

    2010-11-01

    Full Text Available Abstract Background Freezing is an increasingly important means of preservation and storage of microbial strains used for many types of industrial applications including food processing. However, the yeast mechanisms of tolerance and sensitivity to freeze or near-freeze stress are still poorly understood. More knowledge on this regard would improve their biotechnological potential. Glycerol, in particular intracellular glycerol, has been assigned as a cryoprotectant, also important for cold/near-freeze stress adaptation. The S. cerevisiae glycerol active transporter Stl1p plays an important role on the fast accumulation of glycerol. This gene is expressed under gluconeogenic conditions, under osmotic shock and stress, as well as under high temperatures. Results We found that cells grown on STL1 induction medium (YPGE and subjected to cold/near-freeze stress, displayed an extremely high expression of this gene, also visible at glycerol/H+ symporter activity level. Under the same conditions, the strains harbouring this transporter accumulated more than 400 mM glycerol, whereas the glycerol/H+ symporter mutant presented less than 1 mM. Consistently, the strains able to accumulate glycerol survive 25-50% more than the stl1Δ mutant. Conclusions In this work, we report the contribution of the glycerol/H+ symporter Stl1p for the accumulation and maintenance of glycerol intracellular levels, and consequently cell survival at cold/near-freeze and freeze temperatures. These findings have a high biotechnological impact, as they show that any S. cerevisiae strain already in use can become more resistant to cold/freeze-thaw stress just by simply adding glycerol to the broth. The combination of low temperatures with extracellular glycerol will induce the transporter Stl1p. This solution avoids the use of transgenic strains, in particular in food industry.

  1. Comparison of sodium iodide and solid-state detectors for the measurement of lung-stored uranium

    International Nuclear Information System (INIS)

    King, A.; Scott, L.M.; Disney, J.L.

    1978-01-01

    A series of measurement of uranium sources were made, using a solid state detector consisting of 4 high-purity germanium detectors, and compared with measurements made with a single NaI detector. The comparative efficiencies at various energies are shown. As energy increases the differences in efficiencies increase in favour of NaI. A estimate of detection sensitivity gave the limit of error on the net count of a subject with one maximum permissible lung burden as 27 +- 7.2 counts/min for NaI and 3.73 +- 1.04 counts/min for the solid state detector. On a microgram basis the respective limits of error are +- 66 and +- 67 μg. It is concluded that solid state detectors can give 17 times better resolution compared with NaI while maintaining the same detection sensitivity. Sensitivity is related to the scatter of higher energy gammas into a fairly wide energy range. This 17-fold improvement in resolution results in a narrower energy range in which the scattered radiation can fall. Thus gamma analysis with such a system would be less subject to background errors. (author)

  2. NiS and MoS2 nanosheet co-modified graphitic C3N4 ternary heterostructure for high efficient visible light photodegradation of antibiotic.

    Science.gov (United States)

    Lu, Xuejun; Wang, Yu; Zhang, Xinyi; Xu, Guangqing; Wang, Dongmei; Lv, Jun; Zheng, Zhixiang; Wu, Yucheng

    2018-01-05

    The development of efficient solar driven catalytic system for the degradation of antibiotics has become increasingly important in environmental protection and remediation. Non-noble-metal NiS and MoS 2 nanosheet co-modified graphitic C 3 N 4 ternary heterostructure has been synthesized via a facile combination of hydrothermal and ultrasound method, and the ternary heterostructure has been utilized for photocatalytic degradation of antibiotic agents. The antibiotics of ciprofloxacin (CIP) and tetracycline hydrochloride (TC) were photodegraded by the hybrid under the visible light. The optimal photodegradation rate of the ternary heterostructure reaches about 96% after 2h irradiation, which is 2.1 times higher than that of pure g-C 3 N 4 for TC degradation. The photocatalytic degradation rates of the ternary heterostructure for both CIP and TC obey the pseudo-first-order kinetic model. The enhanced visible light adsorption and charge separation efficiency contribute to the photocatalytic performance of the ternary heterostructure. This work provides new insights and pathways by which efficient degradation of antibiotics can be achieved and will stimulate further studies in this important field. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Allotment plan as a condition for sustainable development on the example of detailed regulation 'Stanko Vlasotinčanin' in Nis

    Directory of Open Access Journals (Sweden)

    Obradović Tanja

    2012-01-01

    Full Text Available In order to protect the environment and creation the conditions for a good and healthy life, the construction of buildings should be sustainable. It is essential that the entire process that includes planning, design and realization, be consistent with bioclimatic principles. Allotment plan should be an integral part of the planning process because it is an instrument to control the use of construction land and prevention the negative consequences that are created by uncontrolled action of the market. This paper analyzes the detailed regulation plan, 'Stanko Vlasotinčanin' in Nis with emphasis on the lack of plan allotment and (non application of bioclimatic principles in the planning. Performs a comparison with the detailed planning before 2003, ie. before the Law on planning and construction. Analyses the legislation relating to land use. Recommendations for amending the same, and the introduction of urban consolidation as a possible model of land development and implementation of spatial planning. It is concluded that it is necessary to undertake a number of different measures that are primarily related to the amendment and enforcement of legislation, the introduction of assessment of market value of land and the involvement and the willingness of experts and institutions for their implementation.

  4. Ganoderma-Like MoS2 /NiS2 with Single Platinum Atoms Doping as an Efficient and Stable Hydrogen Evolution Reaction Catalyst.

    Science.gov (United States)

    Guan, Yongxin; Feng, Yangyang; Wan, Jing; Yang, Xiaohui; Fang, Ling; Gu, Xiao; Liu, Ruirui; Huang, Zhengyong; Li, Jian; Luo, Jun; Li, Changming; Wang, Yu

    2018-05-27

    Herein, a unique ganoderma-like MoS 2 /NiS 2 hetero-nanostructure with isolated Pt atoms anchored is reported. This novel ganoderma-like heterostructure can not only efficiently disperse and confine the few-layer MoS 2 nanosheets to fully expose the edge sites of MoS 2 , and provide more opportunity to capture the Pt atoms, but also tune the electronic structure to modify the catalytic activity. Because of the favorable dispersibility and exposed large specific surface area, single Pt atoms can be easily anchored on MoS 2 nanosheets with ultrahigh loading of 1.8 at% (the highest is 1.3 at% to date). Owing to the ganoderma-like structure and platinum atoms doping, this catalyst shows Pt-like catalytic activity for the hydrogen evolution reaction with an ultralow overpotential of 34 mV and excellent durability of only 2% increase in overpotential for 72 h under the constant current density of 10 mA cm -2 . © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. PET/SPECT/CT multimodal imaging in a transgenic mouse model of breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Boisgard, R.; Alberini, J.L.; Jego, B.; Siquier, K.; Theze, B.; Guillermet, S.; Tavitian, B. [Service Hospitalier Frederic Joliot, Institut d' Imagerie BioMedicale, CEA, 91 - Orsay (France); Inserm, U803, 91 - Orsay (France)

    2008-02-15

    Background. - In the therapy monitoring of breast cancer, conventional imaging methods include ultrasound, mammography, CT and MRI, which are essentially based on tumor size modifications. However these modifications represent a late consequence of the biological response and fail to differentiate scar or necrotic tissue from residual viable tumoral tissue. Therefore, a current objective is to develop tools able to predict early response to treatment. Positron Emission Tomography (PET) and Single Photon Emission Computerized Tomography (SPECT) are imaging modalities able to provide extremely sensitive quantitative molecular data and are widely used in humans and animals. Results. - Mammary epithelial cells of female transgenic mice expressing the polyoma middle T onco-protein (Py M.T.), undergo four distinct stages of tumour progression, from pre malignant to malignant stages. Stages are identifiable in the mammary tissue and can lead to the development of distant metastases Longitudinal studies by dynamic whole body acquisitions by multimodal imaging including PET, SPECT and Computed Tomography (CT) allow following the tumoral evolution in Py M.T. mice in comparison with the histopathological analysis. At four weeks of age, mammary hyperplasia was identified by histopathology, but no abnormalities were found by palpation or detected by PET with 2-deoxy-2-[{sup 18}F]fluoro-D-glucose. Such as in some human mammary cancers, the sodium iodide sym-porter (N.I.S.) in tumoral mammary epithelial cells is expressed in this mouse model. In order to investigate the expression of N.I.S. in the Py M.T. mice mammary tumours, [{sup 99m}Tc]TcO{sub 4} imaging was performed with a dedicated SPECT/CT system camera (B.I.O.S.P.A.C.E. Gamma Imager/CT). Local uptake of [{sup 99m}Tc]TcO{sub 4} was detected as early as four weeks of age. The efficacy of chemotherapy was evaluated in this mouse model using a conventional regimen (Doxorubicine, 100 mg/ kg) administered weekly from nine to

  6. Hes1 Is Required for Appropriate Morphogenesis and Differentiation during Mouse Thyroid Gland Development

    Science.gov (United States)

    Carre, Aurore; Rachdi, Latif; Tron, Elodie; Richard, Bénédicte; Castanet, Mireille; Schlumberger, Martin; Bidart, Jean-Michel

    2011-01-01

    Notch signalling plays an important role in endocrine development, through its target gene Hes1. Hes1, a bHLH transcriptional repressor, influences progenitor cell proliferation and differentiation. Recently, Hes1 was shown to be expressed in the thyroid and regulate expression of the sodium iodide symporter (Nis). To investigate the role of Hes1 for thyroid development, we studied thyroid morphology and function in mice lacking Hes1. During normal mouse thyroid development, Hes1 was detected from E9.5 onwards in the median anlage, and at E11.5 in the ultimobranchial bodies. Hes1 −/− mouse embryos had a significantly lower number of Nkx2-1-positive progenitor cells (p<0.05) at E9.5 and at E11.5. Moreover, Hes1 −/− mouse embryos showed a significantly smaller total thyroid surface area (−40 to −60%) compared to wild type mice at all study time points (E9.5−E16.5). In both Hes1 −/− and wild type mouse embryos, most Nkx2-1-positive thyroid cells expressed the cell cycle inhibitor p57 at E9.5 in correlation with low proliferation index. In Hes1 −/− mouse embryos, fusion of the median anlage with the ultimobranchial bodies was delayed by 3 days (E16.5 vs. E13.5 in wild type mice). After fusion of thyroid anlages, hypoplastic Hes1 −/− thyroids revealed a significantly decreased labelling area for T4 (−78%) and calcitonin (−65%) normalized to Nkx2-1 positive cells. Decreased T4-synthesis might be due to reduced Nis labelling area (−69%). These findings suggest a dual role of Hes1 during thyroid development: first, control of the number of both thyrocyte and C-cell progenitors, via a p57-independent mechanism; second, adequate differentiation and endocrine function of thyrocytes and C-cells. PMID:21364918

  7. Perchlorate in seawater

    Energy Technology Data Exchange (ETDEWEB)

    Martinelango, P. Kalyani [Department of Chemistry and Biochemistry, Texas Tech University, Lubbock, TX 79409-1061 (United States); Tian Kang [Institute of Environmental and Human Health, Texas Tech University, Lubbock, TX 79409 (United States); Dasgupta, Purnendu K. [Department of Chemistry and Biochemistry, Texas Tech University, Lubbock, TX 79409-1061 (United States)]. E-mail: Sandyd@ttu.edu

    2006-05-10

    There has been no reliable published data on the presence of perchlorate in seawater. Seaweeds are among the most important plant life in the ocean and are good sources of iodine and have been widely used as food and nutritional supplement. Perchlorate is known to inhibit the transport of iodide by the sodium iodide symporter (NIS), present e.g., in the thyroid and mammary glands. With perchlorate being increasingly detected in drinking water, milk and various other foods, increasing the iodide intake through inexpensive natural supplements may be an attractive solution for maintaining iodine assimilation. We report here measurable concentrations of perchlorate in several samples of seawater (detectable in about half the samples analyzed). We also report the iodide and perchlorate concentrations of 11 different species of seaweed and the corresponding bioconcentration factors (BCF) for perchlorate and iodide, relative to the seawater from which they were harvested. All seaweed samples came from the same region, off the coast of Northeastern Maine. Concentrations of iodide and perchlorate in four seawater samples collected from the region near harvest time were 30 {+-} 11 and 0.16 {+-} 0.084 {mu}g l{sup -1}, respectively. Concentrations of both iodide and perchlorate varied over a wide range for different seaweed species; iodide ranging from 16 to 3134 mg kg{sup -1} and perchlorate from 0.077 to 3.2 mg kg{sup -1}. The Laminaria species had the highest iodide concentration; Laminaria digitata is the seaweed species most commonly used in the kelp tablets sold in health food stores. Our sample of L. digitata contained 3134 {+-} 15 mg iodide/kg dry weight. The BCF varied widely for different species, with Laminaria species concentrating iodide preferentially over perchlorate. The iodide BCF (BCF{sub i}) to perchlorate BCF (BCF{sub p}) quotient ranged from 0.66 to 53; L. digitata and L. saccarina having a BCF{sub i}/BCF{sub p} value of 45 and 53, respectively, far

  8. Perchlorate in seawater

    International Nuclear Information System (INIS)

    Martinelango, P. Kalyani; Tian Kang; Dasgupta, Purnendu K.

    2006-01-01

    There has been no reliable published data on the presence of perchlorate in seawater. Seaweeds are among the most important plant life in the ocean and are good sources of iodine and have been widely used as food and nutritional supplement. Perchlorate is known to inhibit the transport of iodide by the sodium iodide symporter (NIS), present e.g., in the thyroid and mammary glands. With perchlorate being increasingly detected in drinking water, milk and various other foods, increasing the iodide intake through inexpensive natural supplements may be an attractive solution for maintaining iodine assimilation. We report here measurable concentrations of perchlorate in several samples of seawater (detectable in about half the samples analyzed). We also report the iodide and perchlorate concentrations of 11 different species of seaweed and the corresponding bioconcentration factors (BCF) for perchlorate and iodide, relative to the seawater from which they were harvested. All seaweed samples came from the same region, off the coast of Northeastern Maine. Concentrations of iodide and perchlorate in four seawater samples collected from the region near harvest time were 30 ± 11 and 0.16 ± 0.084 μg l -1 , respectively. Concentrations of both iodide and perchlorate varied over a wide range for different seaweed species; iodide ranging from 16 to 3134 mg kg -1 and perchlorate from 0.077 to 3.2 mg kg -1 . The Laminaria species had the highest iodide concentration; Laminaria digitata is the seaweed species most commonly used in the kelp tablets sold in health food stores. Our sample of L. digitata contained 3134 ± 15 mg iodide/kg dry weight. The BCF varied widely for different species, with Laminaria species concentrating iodide preferentially over perchlorate. The iodide BCF (BCF i ) to perchlorate BCF (BCF p ) quotient ranged from 0.66 to 53; L. digitata and L. saccarina having a BCF i /BCF p value of 45 and 53, respectively, far greater than a simple anion exchange process

  9. Thyroid antagonists and thyroid indicators in U.S. pregnant women in the Vanguard Study of the National Children's Study

    International Nuclear Information System (INIS)

    Mortensen, Mary E.; Birch, Rebecca; Wong, Lee-Yang; Valentin-Blasini, Liza; Boyle, Elizabeth B.; Caldwell, Kathleen L.; Merrill, Lori S.; Moye, John; Blount, Benjamin C.

    2016-01-01

    The sodium iodide-symporter (NIS) mediates uptake of iodide into thyroid follicular cells. This key step in thyroid hormone synthesis is inhibited by perchlorate, thiocyanate (SCN) and nitrate (NO 3 ) anions. When these exposures occur during pregnancy the resulting decreases in thyroid hormones may adversely affect neurodevelopment of the human fetus. Our objectives were to describe and examine the relationship of these anions to the serum thyroid indicators, thyroid stimulating hormone (TSH) and free thyroxine (FT4), in third trimester women from the initial Vanguard Study of the National Children's Study (NCS); and to compare urine perchlorate results with those in pregnant women from the National Health and Nutritional Examination Survey (NHANES). Urinary perchlorate, SCN, NO 3 , and iodine, serum TSH, FT4, and cotinine were measured and a food frequency questionnaire (FFQ) was administered to pregnant women enrolled in the initial Vanguard Study. We used multiple regression models of FT4 and TSH that included perchlorate equivalent concentration (PEC, which estimates combined inhibitory effects of the anions perchlorate, SCN, and NO 3 on the NIS). We used multiple regression to model predictors of each urinary anion, using FFQ results, drinking water source, season of year, smoking status, and demographic characteristics. Descriptive statistics were calculated for pregnant women in NHANES 2001–2012. The geometric mean (GM) for urinary perchlorate was 4.04 µg/L, for TSH 1.46 mIU/L, and the arithmetic mean for FT4 1.11 ng/dL in 359 NCS women. In 330 women with completed FFQs, consumption of leafy greens, winter season, and Hispanic ethnicity were significant predictors of higher urinary perchlorate, which differed significantly by study site and primary drinking water source, and bottled water was associated with higher urinary perchlorate compared to filtered tap water. Leafy greens consumption was associated with higher urinary NO 3 and higher urinary

  10. Safety, pharmacokinetics, metabolism and radiation dosimetry of 18F-tetrafluoroborate (18F-TFB) in healthy human subjects.

    Science.gov (United States)

    Jiang, Huailei; Schmit, Nicholas R; Koenen, Alex R; Bansal, Aditya; Pandey, Mukesh K; Glynn, Robert B; Kemp, Bradley J; Delaney, Kera L; Dispenzieri, Angela; Bakkum-Gamez, Jamie N; Peng, Kah-Whye; Russell, Stephen J; Gunderson, Tina M; Lowe, Val J; DeGrado, Timothy R

    2017-10-27

    18 F-Tetrafluoroborate ( 18 F-TFB) is a promising iodide analog for PET imaging of thyroid cancer and sodium/iodide symporter (NIS) reporter activity in viral therapy applications. The aim of this study was to evaluate the safety, pharmacokinetics, biodistribution, and radiation dosimetry of high-specific activity 18 F-TFB in healthy human subjects. 18 F-TFB was synthesized with specific activity of 3.2 ± 1.3 GBq/μmol (at the end of synthesis). Dynamic and whole-body static PET/CT scans over 4 h were performed after intravenous administration of 18 F-TFB (333-407 MBq) in four female and four male healthy volunteers (35 ± 11 years old). Samples of venous blood and urine were collected over the imaging period and analyzed by ion-chromatography HPLC to determine tracer stability. Vital signs and clinical laboratory safety assays were measured to evaluate safety. 18 F-TFB administration was well tolerated with no significant findings on vital signs and no clinically meaningful changes in clinical laboratory assays. Left-ventricular blood pool time-activity curves showed a multi-phasic blood clearance of 18 F-radioactivity with the two rapid clearance phases over the first 20 min, followed by a slower clearance phase. HPLC analysis showed insignificant 18 F-labeled metabolites in the blood and urine over the length of the study (4 h). High uptakes were seen in the thyroid, stomach, salivary glands, and bladder. Urinary clearance of 18 F-TFB was prominent. Metabolic stability was evidenced by low accumulation of 18 F-radioactivity in the bone. Effective doses were 0.036 mSv/MBq in males and 0.064 mSv/MBq in females (p = 0.08, not significant). This initial study in healthy human subjects showed 18 F-TFB was safe and distributed in the human body similar to other iodide analogs. These data support further translational studies with 18 F-TFB as NIS gene reporter and imaging biomarker for thyroid cancer and other disease processes that import iodide.

  11. Thyroid antagonists and thyroid indicators in U.S. pregnant women in the Vanguard Study of the National Children's Study

    Energy Technology Data Exchange (ETDEWEB)

    Mortensen, Mary E., E-mail: MMortensen@cdc.gov [Division of Laboratory Sciences, National Center for Environmental Health, Centers for Disease Control and Prevention, Atlanta, GA (United States); Birch, Rebecca [Westat, Inc., Rockville, MD (United States); Wong, Lee-Yang; Valentin-Blasini, Liza [Division of Laboratory Sciences, National Center for Environmental Health, Centers for Disease Control and Prevention, Atlanta, GA (United States); Boyle, Elizabeth B. [Westat, Inc., Rockville, MD (United States); Caldwell, Kathleen L. [Division of Laboratory Sciences, National Center for Environmental Health, Centers for Disease Control and Prevention, Atlanta, GA (United States); Merrill, Lori S. [Westat, Inc., Rockville, MD (United States); Moye, John [NCS Program Office, Eunice Kennedy Shriver National Institute for Child Health and Human Development, National Institutes for Health, Bethesda, MD (United States); Blount, Benjamin C. [Division of Laboratory Sciences, National Center for Environmental Health, Centers for Disease Control and Prevention, Atlanta, GA (United States)

    2016-08-15

    The sodium iodide-symporter (NIS) mediates uptake of iodide into thyroid follicular cells. This key step in thyroid hormone synthesis is inhibited by perchlorate, thiocyanate (SCN) and nitrate (NO{sub 3}) anions. When these exposures occur during pregnancy the resulting decreases in thyroid hormones may adversely affect neurodevelopment of the human fetus. Our objectives were to describe and examine the relationship of these anions to the serum thyroid indicators, thyroid stimulating hormone (TSH) and free thyroxine (FT4), in third trimester women from the initial Vanguard Study of the National Children's Study (NCS); and to compare urine perchlorate results with those in pregnant women from the National Health and Nutritional Examination Survey (NHANES). Urinary perchlorate, SCN, NO{sub 3}, and iodine, serum TSH, FT4, and cotinine were measured and a food frequency questionnaire (FFQ) was administered to pregnant women enrolled in the initial Vanguard Study. We used multiple regression models of FT4 and TSH that included perchlorate equivalent concentration (PEC, which estimates combined inhibitory effects of the anions perchlorate, SCN, and NO{sub 3} on the NIS). We used multiple regression to model predictors of each urinary anion, using FFQ results, drinking water source, season of year, smoking status, and demographic characteristics. Descriptive statistics were calculated for pregnant women in NHANES 2001–2012. The geometric mean (GM) for urinary perchlorate was 4.04 µg/L, for TSH 1.46 mIU/L, and the arithmetic mean for FT4 1.11 ng/dL in 359 NCS women. In 330 women with completed FFQs, consumption of leafy greens, winter season, and Hispanic ethnicity were significant predictors of higher urinary perchlorate, which differed significantly by study site and primary drinking water source, and bottled water was associated with higher urinary perchlorate compared to filtered tap water. Leafy greens consumption was associated with higher urinary NO{sub 3

  12. Farmācijas doktors profesors Jānis Maizīte - viens no farmācijas muzeja veidotājiem

    Directory of Open Access Journals (Sweden)

    Inta Vegnere

    2010-12-01

    Full Text Available Pagājušajā gadā vienam no pirmās Latvijas brīvvalsts laika ievērojamākajiem farmaceitiem profesoram Jānim Maizītem apritēja 125 gadi. Profesors allaž atradies tālaika farmaceitu sabiedriskās dzīves centrā, līdzcilvēki viņu dēvējuši par Latvijas farmaceitu dvēseli. Jānis Maizīte dzimis 1883. gada 10. maijā Liepas pagasta Leču mājās kalēja ģimenē. Izglītību ieguvis Liepas pagastskolā, pēc tam mācījies privātā vidusskolā Valmierā. 1898. gadā kā eksterns nokārtojis eksāmenu Rīgas Nikolaja ģimnāzijā. Vēlēdamies iepazīties ar farmāciju, Jānis Maizīte no 1898. līdz 1901. gadam strādājis par aptiekāra mācekli Vjazmas aptiekā. 1901. gadā Tērbatas Universitātē kā eksterns nokārtojis aptiekāra palīga eksāmenu. Pēc tam līdz 1904. gadam strādājis dažādās Krievijas aptiekās (Strahovā, Astrahaņā. 1904. gadā J. Maizīte iestājies Tērbatas Universitātes Medicīnas fakultātes Farmācijas nodaļā, kuru beidzis 1908. gadā, iegūstot provizora specialitāti. Pēc tam turpat iecelts par jaunāko laborantu (asistentu, bet 1914. gadā – par vecāko asistentu. 1909. gadā. J. Maizīte nokārtojis mutiskus un rakstiskus eksāmenus farmācijas maģistra grāda iegūšanai un profesora I. Kondakova vadībā uzsācis darbu pie maģistra disertācijas "Par pinēna halogēnhidrātiem un to pārvēršanos ciklēna un santēna tipu ogļūdeņražos". Bet sākoties I Pasaules karam, Jāni Maizīti iesauca aktīvajā karadienestā par rezerves farmaceitu, tāpēc viņš šo darbu nepaguva aizstāvēt. Tikai 1924. gadā darbu par maģistra disertācijas tēmu viņš publicēja kopā ar savu skolotāju.

  13. Oral vaccine of Lactococcus lactis harbouring pandemic H1N1 2009 haemagglutinin1 and nisP anchor fusion protein elevates anti-HA1 sIgA levels in mice.

    Science.gov (United States)

    Joan, Stella Siaw Xiu; Pui-Fong, Jee; Song, Adelene Ai-Lian; Chang, Li-Yen; Yusoff, Khatijah; AbuBakar, Sazaly; Rahim, Raha Abdul

    2016-05-01

    An oral lactococcal-based vaccine which haboured the haemagglutinin1 (HA1) antigen fused to nisP anchor protein for the purpose of surface displaying the HA1 antigen was developed against H1N1 virus. Recombinant L. lactis strains expressed HA1-nisP fusion proteins when induced with nisin, as confirmed through western blotting. However, immunofluorescense did not detect any surface-displayed proteins, suggesting that the protein was either unsuccessfully translocated or improperly displayed. Despite this, oral administration of recombinant L. lactis strains to BALB/c mice revealed that significant levels of anti-HA1 sIgA antibodies were detected in mice fecal suspension samples of mice group NZ9000 (pNZ:HN) when compared to the negative control NZ9000 (pNZ8048) group. Specific anti-HA1 sIgA antibodies were locally produced and live recombinant lactococcal vaccine was able to elicit humoral response of BALB/c mice despite unsuccessful surface display of the HA1 epitope.

  14. What really separates us? Survey of attitudes of young people in the cities of Kikinda (Vojvodina, Nis, Bor (South and East Serbia, and Pristina, Pec, Prizren (Kosovo

    Directory of Open Access Journals (Sweden)

    Bašić Goran

    2014-01-01

    Full Text Available The results of the survey point to a high level of agreement among youth aged between 15 and 25 years of age, high school and college students, employed and unemployed youth, men and women in the cities of Pec, Pristina, Prizren in Kosovo, and Bor, Kikinda, and Nis in Serbia, on whether the question of mutual cooperation is burdened by prejudice and events from the past, and that the possibility and the quality of cooperation is influenced by the attitudes the receive in their primary social groups such as families and peers, and also by the attitudes they receive through education and media. At the same time, the possibilities to influence the social and political change aren’t big, and the youth have no desire to take the concrete civic or political initiatives. A certain perspective in cooperation the youth see in the European constellation and the good quality education. However, youth on both sides are not open to more intensive mutual meetings - the majority would not either host peers from the other communities gladly, nor they would respond to their invitation of hosting. They are not interested in cultural values of one another, but they do think respect of human rights should be guaranteed and they are ready for toleration of differences. The necessity of youth cooperation is important for overcoming the problems that citizens of Kosovo and Serbia are facing when it comes to exercising numerous rights, which from the perspective of individual freedoms collide with the concept of state reasons and "higher" interests. The regional stability depends on overcoming the issues that governments in Serbia and Kosovo have concerning Kosovo’s status, and also from setting a network of individual and group relations among the citizens. Youth should be the carriers of social and cultural changes. In the stated attitudes there is no direct objection to such processes, but fear of changes is clearly expressed because indirectly it can be

  15. Uptake of Iodide From Water in Atlantic Halibut Larvae (Hippoglossus Hippoglossus L.)

    DEFF Research Database (Denmark)

    Moren, Mari; Sloth, Jens Jørgen; Hamre, Kristin

    2008-01-01

    The natural diet of marine fish larvae, copepods, contain 60-350 mg I kg(-1), while live feed used in commercial hatcheries have iodine concentrations in the range of 1 mg kg(-1). Seawater is also considered to be an important source of iodine for marine fish. The question asked in this study is ......M. The uptake was partly blocked by perchlorate (ClO3-) which is a known inhibitor of the sodium iodide symporter. This indicates that the Atlantic halibut larvae accumulate iodide through both specific and non-specific uptake pathways....

  16. Inducement of radionuclides targeting therapy by gene transfection

    International Nuclear Information System (INIS)

    Luo Quanyong

    2001-01-01

    The author presents an overview of gene transfection methods to genetically induce tumor cells to express enhanced levels of cell surface antigens and receptors to intake radiolabeled antibody and peptide targeting and thus increase their therapeutic effect in radiotherapy. The current research include inducement of radioimmunotherapy through CEA gene transfection, inducement of iodine-131 therapy by sodium iodide symporter gene transfection and inducement of MIBG therapy by noradrenaline transporter gene transfection. These studies raise the prospect that gene-therapy techniques could be used to enable the treatment of a wide range of tumors with radiopharmaceuticals of established clinical acceptability

  17. [Jānis Keruss, Ineta Lipša, Inese Runce, Kaspars Zellis. Latvijas Universitātes Vēstures un filozofijas fakultātes vēsture padomju laikā: personības, struktūras, idejas (1944-1991)] / Kristine Wohlfart

    Index Scriptorium Estoniae

    Wohlfart, Kristine, 1968-

    2012-01-01

    Arvustus: Keruss, Jānis, Lipša, Ineta, Runce, Inese, Zellis, Kaspars. Latvijas Universitātes Vēstures un filozofijas fakultātes vēsture padomju laikā: personības, struktūras, idejas (1944-1991). (Riga. LU Akadēmiskais apgāds, 2010)

  18. Recent advances in radioiodine use for the management of thyroid carcinoma

    International Nuclear Information System (INIS)

    Chung, J.K.

    2007-01-01

    Full text: It has been well accepted that radioiodine is useful in the management of patients with recurrent or metastatic differentiated thyroid cancer. Although radioiodine has been used for more than 60 years in diagnosis and treatment, some improvements still appear continuously. Serum Thyroglobulin (Tg) and radioiodine whole body scans (WBS) are used to detect recurrent thyroid caner. Tg has been known to be more sensitive than WBS, and false negative WBS with elevated Tg are frequently found. However, the clinical importance of Tg negative cases with positive WBS has not been clarified. We found that 34 among 960 patients who showed negative Tg with positive post-therapy I-131 WBS had functioning metastases to extrathyroidal organs. Complementary use of radioiodine WBS is recommended to exclude Tg false negative cases. The retinoic acid (RA) is well known to induce the cellular re-differentiation and increase the expression of sodium/iodide symporter (NIS) in de-differentiated tumor cell. We performed RA treatment with I-131 in 40 patients with elevated serum Tg level but no focal iodine uptake in WBS. In 14 patients (35%), improved I-131 uptake was seen. Focal iodine uptakes were seen in 4 patients, and diffuse hepatic visualization without localized lesions were found in 10 patients. Maximal safe dose (MSD) administration based on bone marrow radiation allows the delivery of a large amount of I-131 to thyroid cancer tissue within the safety margin. We performed MSD therapy in 46 patients with differentiated thyroid cancers, which had persisted even after conventional fixed dose therapy. MSD was calculated according to the Memorial Sloan Kettering Cancer Center protocol using blood samples. Mean calculated MSD was 12.5±2.1 GBq (337.3±37.5 mCi). Of the 46 patients, 6 (13.0%) showed complete remission, 15 (32.6%) partial response, 19 stable disease, and 6 disease progression. Twenty-nine patients (63%) had a transient cytopenia after therapy. MSD therapy of

  19. Bilateral renal metastasis of 261-265huerthle cell thyroid cancer with discordant uptake between I-131 sodium iodide and F-18 FDG

    Energy Technology Data Exchange (ETDEWEB)

    Claimon, Apichaya; Suh, Min Seok; Cheon, Gi Jeong; Lee, Dong Soo; Chung, June Key [Dept. of Nuclear Medicine, Seoul National University Hospital, Seoul (Korea, Republic of); Kim, E. Edmund [Dept. of Radiological Sciences, University of California, Irvine (United States)

    2017-09-15

    Renal metastasis of thyroid cancer is extremely rare. We report the case of a 62-year-old woman with Hürthle cell thyroid cancer (HCTC) with lungs, bones, and bilateral kidneys metastases. The renal metastatic lesions were clearly demonstrated by {sup 131}I whole body scan (WBS) with SPECT/CT. However, they exhibited false-negative results in {sup 18}F-FDG PET/CT, kidney ultrasonography, and contrast-enhanced CT scan. The findings imply that tumors have low glucose metabolism and are able to accumulate radioiodine, which is not commonly found in the relatively aggressive nature of HCTC. The patient received two sessions of 200 mCi {sup 131}I therapy within 6 months duration. There was complete treatment response as evaluated by the second post-therapeutic {sup 131}I SPECT/CT and serum thyroglobulin. To our knowledge, renal metastasis from HCTC with positive {sup 131}I but negative {sup 18}F-FDG uptake has not been reported in the literature. This case suggests that {sup 131}I SPECT/CT is useful for lesion localization and prediction of {sup 131}I therapy response.

  20. Evidence of the Presence of Thyroid Hormones in Achatina fulica Snails

    Directory of Open Access Journals (Sweden)

    DANILO LUSTRINO

    Full Text Available ABSTRACT The objective of this study was to identify thyroid hormones and to examine their putative site of synthesis in Achatina fulica snails. For this purpose, radioimmunoassays were performed for T3 and T4 before and after long starvation with or without hemolymph deproteinization. Sodium/iodide symporter activity in vivo was analyzed through 125I administration with and without KClO4 pretreatment. Only T4 was detected, and its concentration decreased due to starvation or deproteinization. However, high-performance liquid chromatography analysis also showed the presence of T2 and T3 apart from T4, but rT3 was not detected in the A. fulica hemolymph. The sodium/iodide symporter activity was greater in cerebral ganglia than digestive gland, but KClO4 treatment did not inhibit iodide uptake in any of the tissues analyzed. Altogether, our data confirm for the first time the presence of thyroid hormones in A. fulica snails and suggest their participation in the metabolism control in this species, although the putative site of hormone biosynthesis remains to be elucidated.

  1. Evidence of the Presence of Thyroid Hormones in Achatina fulica Snails.

    Science.gov (United States)

    Lustrino, Danilo; Silva, Alba C M; Araujo, Iracema G; Tunholi, Victor M; Tunholi-Alves, Vinícius M; Castro, Rosane N; Carvalho, Denise P; Pinheiro, Jairo; Marassi, Michelle P

    2017-01-01

    The objective of this study was to identify thyroid hormones and to examine their putative site of synthesis in Achatina fulica snails. For this purpose, radioimmunoassays were performed for T3 and T4 before and after long starvation with or without hemolymph deproteinization. Sodium/iodide symporter activity in vivo was analyzed through 125I administration with and without KClO4 pretreatment. Only T4 was detected, and its concentration decreased due to starvation or deproteinization. However, high-performance liquid chromatography analysis also showed the presence of T2 and T3 apart from T4, but rT3 was not detected in the A. fulica hemolymph. The sodium/iodide symporter activity was greater in cerebral ganglia than digestive gland, but KClO4 treatment did not inhibit iodide uptake in any of the tissues analyzed. Altogether, our data confirm for the first time the presence of thyroid hormones in A. fulica snails and suggest their participation in the metabolism control in this species, although the putative site of hormone biosynthesis remains to be elucidated.

  2. Iodine nutrition in breast-fed infants is impaired by maternal smoking

    DEFF Research Database (Denmark)

    Laurberg, Peter; Nøhr, Susanne B; Pedersen, Klaus M

    2004-01-01

    the sodium-iodide symporter responsible for iodide transport in the lactating mammary gland. Smoking during the period of breastfeeding increases the risk of iodine deficiency-induced brain damage in the child. Women who breastfeed should not smoke, but if they do, an extra iodine supplement should......Lack of iodine for thyroid hormone formation during the fetal stage and/or the first years of life may lead to developmental brain damage. During the period of breastfeeding, thyroid function of the infant depends on iodine in maternal milk. We studied healthy, pregnant women admitted for delivery...... and their newborn infants. Cotinine in urine and serum was used to classify mothers as smokers (n = 50) or nonsmokers (n = 90). Smoking and nonsmoking mothers had identical urinary iodine on d 5 after delivery, but smoking was associated with reduced iodine content in breast milk (smokers 26.0 micro g/liter vs...

  3. La tiroides como modelo de mecanismos moleculares en enfermedades genéticas The thyroid as a model for molecular mechanisms in genetic diseases

    Directory of Open Access Journals (Sweden)

    Carina M. Rivolta

    2005-06-01

    éticas.Thyroid diseases constitute a heterogeneous collection of abnormalities associated with mutations in genes responsible for the development of thyroid: thyroid transcription factor-1 (TTF-1, thyroid transcriptions factor-2 (TTF-2 and PAX8, or in one of the genes coding for the proteins involved in thyroid hormone biosynthesis such as thyroglobulin (TG, thyroperoxidase (TPO, hydrogen peroxide-generating system (DUOX2, sodium/iodide symporter (NIS, pendrin (PDS, TSH and TSH receptor (TSHr. Congenital hypothyroidism occurs with a prevalence of 1 in 4000 newborns. Patients with this syndrome can be divided into two groups: nongoitrous (dysem/bryogenesis or goitrous (dyshormonogenesis congenital hypothyroidism. The dysembryogenesis group, which accounts for 85% of the cases, results from ectopy, agenesis and hypoplasia. In a minority of these patients, the congenital hypothyroidism is associated with mutations in TTF-1, TTF-2, PAX-8, TSH or TSHr genes. The presence of congenital goiter (15% of the cases has been linked to mutations in the NIS, TG, TPO, DUOX2 or PDS genes. The congenital hypothyroidism with dyshormonogenesis is transmitted as an autosomal recessive trait. Somatic mutations of the TSHr have been identified in hyperfunctioning thyroid adenomas. Another established thyroid disease is the resistance to thyroid hormone (RTH. It is a syndrome of reduced tissue responsiveness to hormonal action caused by mutations located in the thyroid hormone receptor b (TRb gene. Mutant TRbs interfere with the function of the wild-type receptor by a dominant negative mechanism. In conclusion, the identification of mutations in the thyroid expression genes has provided important insights into structure-function relationships. The thyroid constitutes an excellent model for the molecular study of genetic diseases.

  4. Financial impact of outpatient clinic radioiodine therapy with sodium iodide I-131 for the treatment of patients with differentiated low-risk thyroid carcinoma in relation to hospital doses

    International Nuclear Information System (INIS)

    Berenguer, P.F.; Chang, T.M.C.; Silva, R.A.M.; Neto, A.H.D.; Belo, I.B.; Santos, M.A.P.

    2017-01-01

    Differential thyroid carcinoma (CDT) is the most prevalent endocrine malignancy in the world, with an excellent prognosis and a 10-year survival rate of over 95%. By 2013, the lowest activity of I-131 authorized by the Brazilian Unified Health System (SUS) in the therapy of patients with low-risk CDT was 3,700 MBq, requiring hospitalization. Recent studies have shown similar effectiveness between low and high doses of I-131 in the treatment of low-risk CDT. In 2014, the Ministry of Health included in the list of SUS procedures the use of lower activities (1,110 MBq and 1,850 MBq) for this purpose. The Brazilian National Nuclear Energy Commission (CNEN) also authorized the outpatient use of activity up to 1,850 MBq of I-131. Objective: To evaluate the financial impact of the adoption of ambulatory radioiodine therapy in patients with CDT of low-risk when compared to the hospital dose. Methods: Analysis of patients with CDT low-risk who were treated with an outpatient dose of I-131 from August / 2014 to January / 2017 at a nuclear medicine service in Recife, PE, Brazil. The cost of outpatient versus hospital doses was calculated. Results: A total of 289 patients underwent low doses of iodine therapy were evaluated, resulting in a savings of R$227,793.80. Conclusion: Outpatient radioiodine therapy in the treatment of patients with CDT of low-risk resulted in a 61.10% reduction in SUS expense, in addition to enabling faster care

  5. Challenges/issues of NIS used in particle accelerator facilities

    Science.gov (United States)

    Faircloth, Dan

    2013-09-01

    High current, high duty cycle negative ion sources are an essential component of many high power particle accelerators. This talk gives an overview of the state-of-the-art sources used around the world. Volume, surface and charge exchange negative ion production processes are detailed. Cesiated magnetron and Penning surface plasma sources are discussed along with surface converter sources. Multicusp volume sources with filament and LaB6 cathodes are described before moving onto RF inductively coupled volume sources with internal and external antennas. The major challenges facing accelerator facilities are detailed. Beam current, source lifetime and reliability are the most pressing. The pros and cons of each source technology is discussed along with their development programs. The uncertainties and unknowns common to these sources are discussed. The dynamics of cesium surface coverage and the causes of source variability are still unknown. Minimizing beam emittance is essential to maximizing the transport of high current beams; space charge effects are very important. The basic physics of negative ion production is still not well understood, theoretical and experimental programs continue to improve this, but there are still many mysteries to be solved.

  6. Cloning of nis gene and Nisin purification from Lactococcus lactis ...

    African Journals Online (AJOL)

    user

    2014-12-31

    Dec 31, 2014 ... dimension structure of the purified Nisin was studied by CPHModels as pdb with chimera program. Key words: ..... tionists the classification of microorganisms, and makes ... towards lipid membrane (Breukink and Kruijff, 1999;.

  7. NIS tunnel junction as an x-ray photon sensor

    Science.gov (United States)

    Azgui, Fatma; Mears, Carl A.; Labov, Simon E.; Frank, Matthias A.; Sadoulet, Bernard; Brunet, E.; Hiller, Lawrence J.; Lindeman, Mark A.; Netel, Harrie

    1995-09-01

    This work presents the first results of our development of normal-insulating-superconducting tunnel junctions used as energy dispersive detectors for low energy particles. The device described here is a Ag/Al(subscript 2)O(subscript 3)/Al tunnel junction of area 1.5 multiplied by 10(superscript 4) micrometer squared with thicknesses of 200 nm for the normal Ag strip and 100 nm for the superconducting Al film. Two different high-speed SQUID systems manufactured by quantum magnetics and HYPRES, respectively, were used for the readout of this device. At 80 mK bath temperature we obtained an energy resolution DeltaE(subscript FWHM) equals 250 eV for 5.89 keV x rays absorbed directly in the normal metal. This energy resolution appears to be limited in large part by the observed strong position dependence of the device response.

  8. Network and Information Sciences (NIS) International Technology Alliance (ITA)

    Science.gov (United States)

    2016-05-01

    proposals were then assessed and a set of projects selected to create a Biennial Program Plan ( BPP ), which was then implemented and continuously...process of developing a BPP that exhibited an interdisciplinary, cross-sector culture and programme of sufficient mass. Military relevance was...to demonstrate how they had been successful in delivering the required impact in previous BPP cycles. Proposed projects were selected using these

  9. Nuclear legislation in Central and Eastern Europe and the NIS

    CERN Document Server

    2000-01-01

    This publication examines the legislation and regulations governing the peaceful uses of nuclear energy in eastern European countries. It covers 11 countries from Central and Eastern Europe and 11 countries from the New Independent States. The chapters follow a systematic format making it easier for the reader to carry out research and compare information. This study will be updated regularly. Albania Kazakhstan Armenia Latvia Belarus Lithuania Bosnia and Herzegovina Poland Bulgaria Republic of Moldova Croatia Romania Czech Republic Russian Federation Estonia Slovak Republic Former Yugoslav Re

  10. Small organic molecules modulating iodine uptake in thyroid

    International Nuclear Information System (INIS)

    Ambroise, Y.

    2006-01-01

    The thyroid gland accumulates large quantities of iodine. This uptake is needed for the production of iodinated hormones (T3 and T4). The first step in the iodine accumulation is a basolateral transport of iodide ions by the cloned 'Natrium Iodide Sym-porter' also called NIS. Using high-throughput screening techniques, we have identified a series of inhibitors of the iodide uptake in thyrocytes. These compounds are of medical significance in case of thyroid deregulation and can also offer solutions for radio-iodine detoxification in case of emergency situations (nuclear industry...). In addition, these small organic molecules can be important tools for the understanding of NIS structure and functions In parallel, we have identified and characterized a single compound capable to strongly enhance the amount of intra-cellular iodide in rat thyrocytes (FRTL5) as well as in HEK293 cells transfected with hNIS (Natrium/Iodide Sym-porter). Preliminary studies show that this effect is NIS dependant, and is induced by alternative and unknown mechanisms. Future work will consist in unraveling the mode of action of this molecule. These informations will help us not only to better understand the iodide pathways in the thyroid, but also to design more active analogues. We will use photo-labelling techniques to identify new proteins involved in the iodide transfer and retention. In addition, preliminary experiments are underway to validate our compound as an anti-cancer agent. Targeted NIS gene delivery into tumors plus radio-iodide injection leads to tumor size regression. Unfortunately, doses of radioactivity are to high for safe treatment. Our compound may lead to enhanced radio-iodide entrapment, thus necessitating lower doses of radioactivity for tumor regression. (author)

  11. Thyroid endocrine system disruption by pentachlorophenol: an in vitro and in vivo assay.

    Science.gov (United States)

    Guo, Yongyong; Zhou, Bingsheng

    2013-10-15

    The present study aimed to evaluate the disruption caused to the thyroid endocrine system by pentachlorophenol (PCP) using in vitro and in vivo assays. In the in vitro assay, rat pituitary GH3 cells were exposed to 0, 0.1, 0.3, and 1.0 μM PCP. PCP exposure significantly downregulated basal and triiodothyronine (T3)-induced Dio 1 transcription, indicating the antagonistic activity of PCP in vitro. In the in vivo assay, zebrafish embryos were exposed to 0, 1, 3, and 10 μg/L of PCP until 14 days post-fertilization. PCP exposure resulted in decreased thyroxine (T4) levels, but elevated contents of whole-body T3. PCP exposure significantly upregulated the mRNA expression of genes along hypothalamic-pituitary-thyroid (HPT) axis, including those encoding thyroid-stimulating hormone, sodium/iodide symporter, thyroglobulin, Dio 1 and Dio 2, alpha and beta thyroid hormone receptor, and uridinediphosphate-glucuronosyl-transferase. PCP exposure did not influence the transcription of the transthyretin (TTR) gene. The results indicate that PCP potentially disrupts the thyroid endocrine system both in vitro and in vivo. Copyright © 2013 Elsevier B.V. All rights reserved.

  12. Resveratrol has anti-thyroid effects both in vitro and in vivo.

    Science.gov (United States)

    Giuliani, Cesidio; Iezzi, Manuela; Ciolli, Laura; Hysi, Alba; Bucci, Ines; Di Santo, Serena; Rossi, Cosmo; Zucchelli, Mirco; Napolitano, Giorgio

    2017-09-01

    Resveratrol is a natural polyphenol with antioxidant, anti-inflammatory, and antiproliferative properties. We have shown previously that resveratrol decreases sodium/iodide symporter expression and iodide uptake in thyrocytes, both in vitro and in vivo. In the present study, we further investigated the effects of resveratrol, with evaluation of the expression of additional thyroid-specific genes in the FRTL-5 rat thyroid cell line: thyroglobulin, thyroid peroxidase, TSH receptor, Nkx2-1, Foxe1 and Pax8. We observed decreased expression of these genes in FRTL-5 cells treated with 10 μM resveratrol. The effects of resveratrol was further evaluated in vivo using Sprague-Dawley rats treated with resveratrol 25 mg/kg body weight intraperitoneally, for 60 days. No clinical signs of hypothyroidism were seen, although the treated rats showed significant increase in thyroid size. Serum TSH and thyroid hormone levels were in the normal range, with significantly higher TSH seen in resveratrol-treated rats, compared with control rats. Histological and immunohistochemical analyses confirmed increased proliferative activity in the thyroid from resveratrol-treated rats. These data suggest that resveratrol acts as a thyroid disruptor and a goitrogen, which indicates the need for caution as a supplement and for therapeutic uses. Copyright © 2017 Elsevier Ltd. All rights reserved.

  13. Inhibition of the thyroid hormone pathway in Xenopus laevis by 2-mercaptobenzothiazole

    International Nuclear Information System (INIS)

    Tietge, Joseph E.; Degitz, Sigmund J.; Haselman, Jonathan T.; Butterworth, Brian C.; Korte, Joseph J.; Kosian, Patricia A.; Lindberg-Livingston, Annelie J.

    2013-01-01

    Determining the effects of chemicals on the thyroid system is an important aspect of evaluating chemical safety from an endocrine disrupter perspective. Since there are numerous chemicals to test and limited resources, prioritizing chemicals for subsequent in vivo testing is critical. 2-Mercaptobenzothiazole (MBT), a high production volume chemical, was tested and shown to inhibit thyroid peroxidase (TPO) enzyme activity in vitro, a key enzyme necessary for the synthesis of thyroid hormone. To determine the thyroid disrupting activity of MBT in vivo, Xenopus laevis larvae were exposed using 7- and 21-day protocols. The 7-day protocol used 18–357 μg/L MBT concentrations and evaluated: metamorphic development, thyroid histology, circulating T4, circulating thyroid stimulating hormone, thyroidal sodium-iodide symporter gene expression, and thyroidal T4, T3, and related iodo-amino acids. The 21-day protocol used 23–435 μg/L MBT concentrations and evaluated metamorphic development and thyroid histology. Both protocols demonstrated that MBT is a thyroid disrupting chemical at the lowest concentrations tested. These studies complement the in vitro study used to identify MBT as a high priority for in vivo testing, supporting the utility/predictive potential of a tiered approach to testing chemicals for TPO activity inhibition. The 7-day study, with more comprehensive, sensitive, and diagnostic endpoints, provides information at intermediate biological levels that enables linking various endpoints in a robust and integrated pathway for thyroid hormone disruption associated with TPO inhibition.

  14. Estradiol decreases iodide uptake by rat thyroid follicular FRTL-5 cells

    Directory of Open Access Journals (Sweden)

    Furlanetto T.W.

    2001-01-01

    Full Text Available Estradiol has well-known indirect effects on the thyroid. A direct effect of estradiol on thyroid follicular cells, increasing cell growth and reducing the expression of the sodium-iodide symporter gene, has been recently reported. The aim of the present investigation was to study the effect of estradiol on iodide uptake by thyroid follicular cells, using FRTL-5 cells as a model. Estradiol decreased basal iodide uptake by FRTL-5 cells from control levels of 2.490 ± 0.370 to 2.085 ± 0.364 pmol I-/µg DNA at 1 ng/ml (P<0.02, to 1.970 ± 0.302 pmol I-/µg DNA at 10 ng/ml (P<0.003, and to 2.038 ± 0.389 pmol I-/µg DNA at 100 ng/ml (P<0.02. In addition, 4 ng/ml estradiol decreased iodide uptake induced by 0.02 mIU/ml thyrotropin from 8.678 ± 0.408 to 7.312 ± 0.506 pmol I-/µg DNA (P<0.02. A decrease in iodide uptake by thyroid cells caused by estradiol has not been described previously and may have a role in goiter pathogenesis.

  15. Monitoring the Induction of Heat Shock Factor 1/Heat Shock Protein 70 Expression following 17-Allylamino-Demethoxygeldanamycin Treatment by Positron Emission Tomography and Optical Reporter Gene Imaging

    Directory of Open Access Journals (Sweden)

    Mikhail Doubrovin

    2012-01-01

    Full Text Available The cell response to proteotoxic cell stresses is mediated primarily through activation of heat shock factor 1 (HSF1. This transcription factor plays a major role in the regulation of the heat shock proteins (HSPs, including HSP70. We demonstrate that an [124I]iodide-pQHNIG70 positron emission tomography (PET reporter system that includes an inducible HSP70 promoter can be used to image and monitor the activation of the HSF1/HSP70 transcription factor in response to drug treatment (17-allylamino-demethoxygeldanamycin [17-AAG]. We developed a dual imaging reporter (pQHNIG70 for noninvasive imaging of the heat shock response in cell culture and living animals previously and now study HSF1/HSP70 reporter activation in both cell culture and tumor-bearing animals following exposure to 17-AAG. 17-AAG (10–1,000 nM induced reporter expression; a 23-fold increase was observed by 60 hours. Good correspondence between reporter expression and HSP70 protein levels were observed. MicroPET imaging based on [124I]iodide accumulation in pQHNIG70-transduced RG2 xenografts showed a significant 6.2-fold reporter response to 17-AAG, with a corresponding increase in tumor HSP70 and in tumor human sodium iodide symporter and green fluorescent protein reporter proteins. The HSF1 reporter system can be used to screen anticancer drugs for induction of cytotoxic stress and HSF1 activation both in vitro and in vivo.

  16. Normalization of lymphocyte count after high ablative dose of I-131 in a patient with chronic lymphoid leukemia and secondary papillary carcinoma of the thyroid: case report

    International Nuclear Information System (INIS)

    Thom, Anneliese Rosmarie Gertrud Fischer; Hamerschlak, Nelson; Osawa, Akemi; Santos, Fabio Pires de Souza; Pasqualin, Denise da Cunha; Wagner, Jairo; Yamaga, Lilian Yuri Itaya; Cunha, Marcelo Livorsi da; Campos Neto, Guilherme de Carvalho; Funari, Marcelo Buarque de Gusmao; Teles, Veronica Goes

    2014-01-01

    The authors report the case of a 70-year-old male patient with chronic lymphoid leukemia who presented subsequently a papillary carcinoma of the thyroid with metastases to regional lymph nodes. The patient was treated with surgical thyroidectomy with regional and cervical lymph node excision and radioiodine therapy (I-131). The protocolar control scintigraphy 4 days after the radioactive dose showed I-131 uptake in both axillae and even in the inguinal regions. PET/CT showed faint FDG-F-18 uptake in one lymph node of the left axilla. An ultrasound guided fine needle biopsy of this lymph node identified by I-131 SPECT/CT and FDG-F-18 PET/CT revealed lymphoma cells and was negative for thyroid tissue and thyroglobulin content. The sequential blood counts done routinely after radiation treatment showed a marked fall until return to normal values of leucocytes and lymphocytes (absolute and relative), which were still normal in the last control 19 months after the radioiodine administration. Chest computed tomography showed a decrease in size of axillary and paraaortic lymph nodes. By immunohistochemistry, cells of the lymphoid B lineage decreased from 52% before radioiodine therapy to 5% after the procedure. The authors speculate about a possible sodium iodide symporter expression by the cells of this lymphoma, similar to some other non-thyroid tumors, such as breast cancer cells. (author)

  17. Normalization of lymphocyte count after high ablative dose of I-131 in a patient with chronic lymphoid leukemia and secondary papillary carcinoma of the thyroid: case report; Normalizacao da contagem de linfocitos apos dose ablativa de I-131 em um paciente com leucemia linfoide cronica e carcinoma papilifero da tireoide: relato de caso

    Energy Technology Data Exchange (ETDEWEB)

    Thom, Anneliese Rosmarie Gertrud Fischer; Hamerschlak, Nelson; Osawa, Akemi; Santos, Fabio Pires de Souza; Pasqualin, Denise da Cunha; Wagner, Jairo; Yamaga, Lilian Yuri Itaya; Cunha, Marcelo Livorsi da; Campos Neto, Guilherme de Carvalho; Funari, Marcelo Buarque de Gusmao, E-mail: afthom@einstein.br [Hospital Israelita Albert Einstein, Sao Paulo, SP (Brazil); Teles, Veronica Goes [Sociedade Brasileira de Diabetes, Sao Paulo, SP (Brazil)

    2014-07-01

    The authors report the case of a 70-year-old male patient with chronic lymphoid leukemia who presented subsequently a papillary carcinoma of the thyroid with metastases to regional lymph nodes. The patient was treated with surgical thyroidectomy with regional and cervical lymph node excision and radioiodine therapy (I-131). The protocolar control scintigraphy 4 days after the radioactive dose showed I-131 uptake in both axillae and even in the inguinal regions. PET/CT showed faint FDG-F-18 uptake in one lymph node of the left axilla. An ultrasound guided fine needle biopsy of this lymph node identified by I-131 SPECT/CT and FDG-F-18 PET/CT revealed lymphoma cells and was negative for thyroid tissue and thyroglobulin content. The sequential blood counts done routinely after radiation treatment showed a marked fall until return to normal values of leucocytes and lymphocytes (absolute and relative), which were still normal in the last control 19 months after the radioiodine administration. Chest computed tomography showed a decrease in size of axillary and paraaortic lymph nodes. By immunohistochemistry, cells of the lymphoid B lineage decreased from 52% before radioiodine therapy to 5% after the procedure. The authors speculate about a possible sodium iodide symporter expression by the cells of this lymphoma, similar to some other non-thyroid tumors, such as breast cancer cells. (author)

  18. Thyroglobulin Gene Mutation with Cold Nodule on Thyroid Scintigraphy

    Directory of Open Access Journals (Sweden)

    Toshio Kahara

    2012-01-01

    Full Text Available Thyroglobulin gene mutation is a rare cause of congenital hypothyroidism, but thyroglobulin gene mutations are thought to be associated with thyroid cancer development. A 21-year-old Japanese man treated with levothyroxine for congenital hypothyroidism had an enlarged thyroid gland with undetectable serum thyroglobulin despite elevated serum TSH level. The patient was diagnosed with thyroglobulin gene mutation, with compound heterozygosity for Gly304Cys missense mutation and Arg432X nonsense mutation. Ultrasonography showed a hypovascular large tumor in the left lobe that appeared as a cold nodule on thyroid scintigraphy. He underwent total thyroidectomy, but pathological study did not reveal findings of thyroid carcinoma, but rather a hyperplastic nodule with hemorrhage. Strong cytoplasmic thyroglobulin immunostaining was observed, but sodium iodide symporter immunostaining was hardly detected in the hyperplastic nodule. The clinical characteristics of patients with thyroglobulin gene mutations are diverse, and some patients are diagnosed by chance on examination of goiter in adults. The presence of thyroid tumors that appear as cold nodules on thyroid scintigraphy should consider the potential for thyroid carcinoma, if the patient has relatively low serum thyroglobulin concentration in relation to the degree of TSH without thyroglobulin autoantibody.

  19. Iodide transport and breast cancer.

    Science.gov (United States)

    Poole, Vikki L; McCabe, Christopher J

    2015-10-01

    Breast cancer is the second most common cancer worldwide and the leading cause of cancer death in women, with incidence rates that continue to rise. The heterogeneity of the disease makes breast cancer exceptionally difficult to treat, particularly for those patients with triple-negative disease. To address the therapeutic complexity of these tumours, new strategies for diagnosis and treatment are urgently required. The ability of lactating and malignant breast cells to uptake and transport iodide has led to the hypothesis that radioiodide therapy could be a potentially viable treatment for many breast cancer patients. Understanding how iodide is transported, and the factors regulating the expression and function of the proteins responsible for iodide transport, is critical for translating this hypothesis into reality. This review covers the three known iodide transporters - the sodium iodide symporter, pendrin and the sodium-coupled monocarboxylate transporter - and their role in iodide transport in breast cells, along with efforts to manipulate them to increase the potential for radioiodide therapy as a treatment for breast cancer. © 2015 Society for Endocrinology.

  20. Molecularly targeted therapeutic radiopharmaceuticals

    International Nuclear Information System (INIS)

    Saw, M.M.

    2007-01-01

    Full text: It is generally agreed that current focus of nuclear medicine development should be on molecular imaging and therapy. Though, the widespread use of the terminology 'molecular imaging' is quite recent, nuclear medicine has used molecular imaging techniques for more than 20 years ago. A variety of radiopharmaceuticals have been introduced for the internal therapy of malignant and inflammatory lesions in nuclear medicine. In the field of bio/medical imaging, nuclear medicine is one of the disciplines which has the privilege of organized and well developed chemistry/ pharmacy section; radio-chemistry/radiopharmacy. Fundamental principles have been developed more than 40 years ago and advanced research is going well into postgenomic era. The genomic revolution and dramatically increased insight in the molecular mechanisms underlying pathology have led to paradigm shift in drug development. Likewise does in the nuclear medicine. Here, the author will present current clinical and pre-clinical therapeutic radiopharmaceuticals based on molecular targets such as membrane-bound receptors, enzymes, nucleic acids, sodium iodide symporter, etc, in correlation with fundamentals of radiopharmacy. (author)

  1. Crystal structure of a bacterial homologue of the bile acid sodium symporter ASBT

    Science.gov (United States)

    Hu, Nien-Jen; Iwata, So; Cameron, Alexander D.; Drew, David

    2011-01-01

    High cholesterol levels greatly increase the risk of cardiovascular disease. By its conversion into bile acids, about 50% of cholesterol is eliminated from the body. However bile acids released from the bile duct are constantly recycled, being reabsorbed in the intestine via the Apical Sodium dependent Bile acid Transporter (ASBT). It has been shown in animal models that plasma cholesterol levels are significantly lowered by specific inhibitors of ASBT1,2, thus ASBT is a target for hypercholesterolemia drugs. Here, we describe the crystal structure of a bacterial homologue of ASBT from Neisseria meningitidis (ASBTNM) at 2.2Å. ASBTNM contains two inverted structural repeats of five transmembrane helices. A Core domain of six helices harbours two sodium ions while the remaining helices form a Panel-like domain. Overall the architecture of the protein is remarkably similar to the sodium-proton antiporter NhaA3 despite no detectable sequence homology. A bile acid molecule is situated between the Core and Panel domains in a large hydrophobic cavity. Residues near to this cavity have been shown to affect the binding of specific inhibitors of human ASBT4. The position of the bile acid together with the molecular architecture suggests the rudiments of a possible transport mechanism. PMID:21976025

  2. Osmotolerance of Dekkera bruxellensis and the role of two Stl glycerol–proton symporters

    Czech Academy of Sciences Publication Activity Database

    Zemančíková, Jana; Dušková, Michala; Elicharová, Hana; Papoušková, Klára; Sychrová, Hana

    2018-01-01

    Roč. 365, č. 5 (2018), č. článku fny020. ISSN 0378-1097 R&D Projects: GA ČR(CZ) GA15-03708S Institutional support: RVO:67985823 Keywords : glycerol uptake * osmotolerance * non-conventional yeasts Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 1.765, year: 2016

  3. Environmental biotechnology for the eco-efficient decontamination of petroleum hydrocarbon polluted sites in the NIS

    International Nuclear Information System (INIS)

    Kerstin, S.; Andreas, P. L.; Hildegard, A.

    2005-01-01

    Full text : Pollution of soil and ground water with petroleum hydrocarbons is a major environmental problem in many oil producing regions of the New Independent States. Decontamination of these areas using conventional technologies based on physical, chemical and / or thermal pollutant removal would require major financial resources and represent a great economical burden for these regions. Thus, contaminated land management (CLM) has to focus on efficient yet low-cost strategies yielding the optimum ecological outcome. Approaching such eco-efficient, i.e ecologically sound and economically feasible solutions includes the consideration of technical, scientific and socio-economic aspects. A comprehensive risk assessment states the basis for these CLM strategies, which considers both technical (e.g. soil type, groundwater characteristics) and regional aspects (e.g. demographic and socio-economic details). This requires a holistic understanding of these capacious problems and its communication to and the involvement of the stakeholders. Such eco-efficient technologies that are suitable for the clean-up of soils and aquifers polluted with organic chemicals (e.g. crude oil and its derivatives) are offered by environmental biotechnology. Decontamination techniques such as bioremediation, based on the engineered promotion of the soil's intrinsic microbiological capability to recover from environmental stresses, are fit to re-establish acceptable environmental conditions on a reasonable time-scale while requiring comparably little resources. Bioremediation techniques may be applied after excavation of the polluted soil (ex situ) or on the site as is, leaving contaminated material in place (in situ). Surface, ex situ, treatment (biopiles, landfarming) facilitates the homogenous addition of additives such as surfactants, nutrients or pollutant degrading microorganisms. By contrast, in situ technologies (e.g. bioventing, biosparging) are, as they do not require soil excavation, more cost-efficient. In addition, these state the only alternative in case the soil is not to be removed, or for sites covered with buildings. Thus, bioremediation strategies are offered for and can be implemented on a wide range of boundary conditions. Considering the comparably low remediation costs, the sustainability, ecoefficiency and public acceptance of biotechnological processes, these techniques represent a highly efficient toolbox for the reduction of risk posed by polluted sites. Other than in Europe, where two decades of experience exists, the implementation of CLM strategies is limited in the New Independent States. In Azerbaijan, laboratory facilities and expert know how in oil chemistry and exploration is available, but environmental aspects have long been underestimated. Moreover, the integration of socio-economic aspects into CLM strategies has not gone very far neither in these countries nor in Europe

  4. Fourth National Incidende Study of Child Abuse and Neglect (NIS-4)

    Data.gov (United States)

    U.S. Department of Health & Human Services — NIS–4 data were collected to provide updated estimates of the incidence of child abuse and neglect in the United States and measure changes in incidence from the...

  5. A Case Study of the NATO Identification System (NIS) Codevelopment Program

    Science.gov (United States)

    1988-09-01

    the otherhand are unrelated to the military equipment being purchased. These offsets include foreign investment, technology transfer, and countertrade ...manufacturer and a foreign entity. 6. Countertrade - a transaction that specifies the exchange of selected goods and services for another of equivalent...arrangements. In fact, U.S. agencies are permitted to provide advisory and marketing intelligence services to U.S. exporters involved in countertrade

  6. Deliverable D8.4 - Report on Collaboration with Standardization Bodies, NIS and Other External Groups

    OpenAIRE

    Papastergiou, Spyros; Karantjias, Thanos; Chatzikou, Menia; Vidali, Peggy; Douligeris, Christos; Stavrakakis, Ioannis; Kalogeraki, Eleni-Maria; Zacharias, Marios; Purcarea, Razvan; Cocor, Gabriel; Schauer, Stefan; König, Sandra; Mouratidis, Haris; Pavlidis, Michalis; Polatidis, Nikolaos

    2018-01-01

    Despite the importance of Critical Information Infrastructures (CIIs) and dynamic ICT‐based maritime supply chains (SCs) for port operations, state‐of‐the‐art Risk Management (RM) methodologies for maritime environments pay limited attention to cyber‐security and do not adequately address security processes for international SCs. Motivated by these limitations, MITIGATE will introduce, integrate, validate and commercialize a novel RM system, which will empower stakeholders’ collaboration for ...

  7. NIS method for uncertainty estimation of airborne sound insulation measurement in field

    Directory of Open Access Journals (Sweden)

    El-Basheer Tarek M.

    2017-01-01

    Full Text Available In structures, airborne sound insulation is utilized to characterize the acoustic nature of barriers between rooms. However, the assessment of sound insulation index is once in a while troublesome or indeed, even questionable, both in field and laboratory measurements, notwithstanding the way that there are some unified measurement methodology indicated in the ISO 140 series standards. There are issues with the reproducibility and repeatability of the measurement results. A few troubles might be brought on by non-diffuse acoustic fields, non-uniform reverberation time, or blunders of the reverberation time measurements. Some minor issues are additionally postured by flanking transmission. In this paper, investigation of the uncertainties of the above specified measurement parts and their impact on the consolidated uncertainty in 1/3-octave frequency band. The total measurement uncertainty model contributes several different partial uncertainties, which are evaluated by the method of type A or type B. Also, the determination of the sound reduction index decided by ISO 140-4 has been performed.

  8. NIS occurrence - Non-native species impacts on threatened and endangered salmonids

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The objectives of this project: a) Identify the distribution of non-natives in the Columbia River Basin b) Highlight the impacts of non-natives on salmonids c)...

  9. Rahvuslik - kohustuslik publikupüünis / Anneli Aasmäe

    Index Scriptorium Estoniae

    Aasmäe, Anneli, 1973-

    2001-01-01

    Muusikalidest Eesti lavadel - 23. veebr. esietendub Pärnu Endlas "Hea lugu", 11. märtsil Vanemuises "Verevennad", 16. märtsil Tallinna Linnahallis "No, No, Nanette" ja 2. nov Tallinna Linnahallis "Hüljatud"

  10. Test program for NIS calibration to reactor thermal output in HTTR

    International Nuclear Information System (INIS)

    Nakagawa, Shigeaki; Shinozaki, Masayuki; Tachibana, Yukio; Kunitomi, Kazuhiko

    2000-03-01

    Rise-to-power test program for reactor thermal output measurement has been established to calibrate a neutron instrumentation system taking account of the characteristics of the High Temperature Engineering Test Reactor (HTTR). An error of reactor thermal output measurement was evaluated taking account of a configuration of instrumentation system. And the expected dispersion of measurement in the full power operation was evaluated from non-nuclear heat-up of primary coolant up to 213degC. From the evaluation, it was found that an error of reactor thermal output measurement would be less than ±2.0% at the rated power. This report presents the detailed program of rise-to-power test for reactor thermal output measurement and discusses its measurement error. (author)

  11. Integrity of the core mitochondrial RNA-binding complex 1/nis vital for trypanosome RNA editing

    Czech Academy of Sciences Publication Activity Database

    Huang, Zhenqiu; Faktorová, Drahomíra; Křížová, A.; Kafková, L.; Read, L. K.; Lukeš, Julius; Hashimi, Hassan

    2015-01-01

    Roč. 21, č. 12 (2015), s. 2088-2102 ISSN 1355-8382 R&D Projects: GA ČR GA15-21974S EU Projects: European Commission(XE) 289007 Institutional support: RVO:60077344 Keywords : RNA editing * mitochondrion * trypanosome Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.344, year: 2015

  12. MV-NIS or Investigator's Choice Chemotherapy in Treating Patients With Ovarian, Fallopian, or Peritoneal Cancer

    Science.gov (United States)

    2018-04-27

    Fallopian Tube Transitional Cell Carcinoma; Malignant Ovarian Clear Cell Tumor; Malignant Ovarian Endometrioid Tumor; Malignant Ovarian Serous Tumor; Ovarian Seromucinous Carcinoma; Ovarian Transitional Cell Carcinoma; Primary Peritoneal Serous Adenocarcinoma; Recurrent Fallopian Tube Carcinoma; Recurrent Ovarian Carcinoma; Recurrent Primary Peritoneal Carcinoma; Undifferentiated Fallopian Tube Carcinoma; Undifferentiated Ovarian Carcinoma

  13. NisC Binds the FxLx Motif of the Nisin Leader Peptide

    NARCIS (Netherlands)

    Abts, Andre; Montalban-Lopez, Manuel; Kuipers, Oscar P.; Smits, Sander H.; Schmitt, Lutz

    2013-01-01

    Nisin is a model system for lantibiotics, a class of peptides displaying antimicrobial activity against various Gram-positive bacteria. After ribosomal synthesis, the precursor peptide is modified in two steps, of which the last one involves consecutive cyclization reactions mediated by the cyclase

  14. An assessment of environmental damage caused by NATO bombing of NIS Jugopetrol facilities

    International Nuclear Information System (INIS)

    Milosevic, D.; Radu, A.; Novakovic, J.

    2002-01-01

    This paper present our investigation of the effects of NATO bombing of the Jugopetrol facilities in Serbia during the Spring of 1999. Concentrations of hazardous material in air, water and soil have been measured and compared to the situation before the bombing. Only partial results are presented in this paper. High concentrations of hydrocarbons were detected in the air immediately after the bombing and the destruction of installations, due to burning and evaporation of oil derivatives. A great amount of spilled mineral oils has been detected in water and soil near the destroyed installations. We have detected a noticeable increase in pollution after the NATO bombing. In addition to above mentioned pollution, the destruction of large parts of waste treatment system within the Jugopetrol's installations caused severe environmental problems. The recovery of the destroyed installation and waste treatment systems require considerable amount of money and time, and cannot be accomplished without the help of foreign investment. (author)

  15. SUSCEPTIBILITY OF RESPIRATORY ISOLATES OF STREPTOCOCCUS PNEUMONIAE ISOLATED FROM CHILDREN HOSPITALIZED IN THE CLINICAL CENTER NIS.

    Science.gov (United States)

    Dinić, Marina M; Mladenović Antić, Snezana; Kocić, Branislava; Stanković Dordević, Dobrila; Vrbić, Miodrag; Bogdanović, Milena

    2016-01-01

    Streptococcus pneumoniae is one of the most common causes of respiratory infections. The aim was to study the susceptibility to antimicrobial agents of respiratory isolates ofStreptococcus pneumoniae obtained from hospitalized children. A total of 190 respiratory pneumococcal isolates obtained from children aged from 0 to 14 years were isolated and identified by using standard microbiological methods. Susceptibility to oxacillin, erythromycin, clindamycin, tetracycline, cotrimoxazole, ofloxacin and rifampicin was tested by disc diffusion method. Minimal inhibitory concentrations for amoxicillin and ceftriaxone were determined by means of E test. The macrolide-resistant phenotype was detected by double disc diffusion test. All tested isolates were susceptible to amoxicillin and ceftriaxone. The minimal amoxicillin concentration inhibiting the growth of 50% of isolates and of 90% of isolates was 0.50 microg/ml and 1.0 microg/ml, respectively and the minimal ceftriaxone concentration inhibiting the growth of 50% of isolates and of 90% of isolates was 0.25 microg/ml and 0.50 microg/ml, respectively. Susceptibility to erythromycin and clindamycin was observed in 21.6% and 29.47% of isolates, respectively. The resistence to macrolides-M phenotype was detected in 10.07% of isolates and constitutive macrolide-lincosamide-streptogramin phenotype (constitutive MLS phenotype) was found in 89.93% of isolates. All tested isolates were susceptible to ofloxacin and rifampicin. Amoxicillin could be the therapy of choice in pediatric practice. The macrolides should not be recommended for the empirical therapy of pneumococcal respiratory tract infection in our local area.

  16. U.S. Nuclear Regulatory Commission nuclear safety assistance to the CEE and NIS countries

    International Nuclear Information System (INIS)

    Blaha, J.

    2001-01-01

    NRC participates in bilateral and multilateral efforts to strengthen the regulatory authorities of countries in which Soviet design NPPs are operated. Countries involved are the New Independent States of the Soviet Union (Armenia, Kazakhstan, Russia and Ukraine) and of Central and Eastern Europe (Bulgaria, Czech Republic, Hungary, Lithuania and Slovak Republic). NRC's goal is to see that its counterparts receive the basic tools, knowledge and understanding needed to exercise effective regulatory oversight, consistent with internationally accepted norms and standards. The bilateral assistance started in 1991. $44 mill. are provided to the countries. The multilateral activities NRC participates in include: H-7 Nuclear Safety Working Group, EBRD - Administered Nuclear Safety Account and Chernobyl Sarcophagus Fund and IAEA

  17. EXPERIENCE WITH ROBOTIC LUMЕNIS CO LASER IN ENDOSCOPIC LARYNGEAL SURGERY

    Directory of Open Access Journals (Sweden)

    E. N. Novozhilova

    2014-01-01

    Full Text Available  2 The paper describes the first experience in using robotic CO laser at the Department of Head and Neck Tumors, Moscow City Cancer Hospital Sixty-Two. With advances in endoscopic techniques and anesthesiology, there have been new possibilities of usingdirect (rigid larygoscopy in conjunction with laser systems.The Lumеnis laser assembly consists of three interconnected components: a videocamera, an operating microscope, and directly CO laser. It includes a computer system that sets a program to perform an operation.The heart of the laser system is a scanning Digital Acu Blade micromanipulator. This unique assembly makes itpossible to control the area and depth of incision, to cut intricate shapes in relation to the surface anatomy, and to precisely control ablation and hemostasis. The effect of tissue carbonization during surgery is minimal at the expense of the physical characteristics and different modes of radiation. It is noted that this system allows organ-sparing treatment in cancer patients and their prompt rehabilitation after surgical interventions.

  18. Pendrin and NIS antibodies are absent in healthy individuals and are rare in autoimmune thyroid disease

    DEFF Research Database (Denmark)

    Brix, Thomas H; Hegedüs, Laszlo; Weetman, Anthony P

    2014-01-01

    prevalence than the controls: NISAb: 17% vs 0% (P Graves' disease (GD) and 14% (5/37) of patients with Hashimoto's thyroiditis (HT) had NISAb, (P ...OBJECTIVE: Antibodies against thyroglobulin, thyroid peroxidase and the TSH receptor are accepted as pathophysiological and diagnostic biomarkers in autoimmune thyroid disease (AITD). In contrast, the prevalence, aetiology and clinical relevance of autoantibodies against the human sodium...

  19. Shared Investment by NIS and National Labs Develops Cutting-Edge Safeguards Technologies

    Energy Technology Data Exchange (ETDEWEB)

    Anheier, Norman C.; Williams, Laura S.

    2012-04-01

    This article, regarding a new technology for detecting undeclared enrichment at gas centrifuge enrichment plants, was written for the DOE/NNSA NA-24 Highlights, a newsletter intended for public release.

  20. Occurrence of perchlorate and thiocyanate in human serum from e-waste recycling and reference sites in Vietnam: association with thyroid hormone and iodide levels.

    Science.gov (United States)

    Eguchi, Akifumi; Kunisue, Tatsuya; Wu, Qian; Trang, Pham Thi Kim; Viet, Pham Hung; Kannan, Kurunthachalam; Tanabe, Shinsuke

    2014-07-01

    Perchlorate (ClO4 (-)) and thiocyanate (SCN(-)) interfere with iodide (I(-)) uptake by the sodium/iodide symporter, and thereby these anions may affect the production of thyroid hormones (THs) in the thyroid gland. Although human exposure to perchlorate and thiocyanate has been studied in the United States and Europe, few investigations have been performed in Asian countries. In this study, we determined concentrations of perchlorate, thiocyanate, and iodide in 131 serum samples collected from 2 locations in Northern Vietnam, Bui Dau (BD; electrical and electronic waste [e-waste] recycling site) and Doung Quang (DQ; rural site) and examined the association between serum levels of these anions with levels of THs. The median concentrations of perchlorate, thiocyanate, and iodide detected in the serum of Vietnamese subjects were 0.104, 2020, and 3.11 ng mL(-1), respectively. Perchlorate levels were significantly greater in serum of the BD population (median 0.116 ng mL(-1)) than those in the DQ population (median 0.086 ng mL(-1)), which indicated greater exposure from e-waste recycling operations by the former. Serum concentrations of thiocyanate were not significantly different between the BD and DQ populations, but increased levels of this anion were observed among smokers. Iodide was a significant positive predictor of serum levels of FT3 and TT3 and a significant negative predictor of thyroid-stimulating hormone in males. When the association between serum levels of perchlorate or thiocyanate and THs was assessed using a stepwise multiple linear regression model, no significant correlations were found. In addition to greater concentrations of perchlorate detected in the e-waste recycling population, however, given that lower concentrations of iodide were observed in the serum of Vietnamese females, detailed risk assessments on TH homeostasis for females inhabiting e-waste recycling sites, especially for pregnant women and their neonates, are required.

  1. Widespread Occurrence of Plant Perchlorate

    Science.gov (United States)

    Harvey, G.; Orris, G.; Jackson, W. A.; Rajagopalan, S.; Andraski, B.; Stonestrom, D.

    2007-12-01

    Perchlorate is a water soluble oxyanion containing four oxygens bonded to a single chlorine atom. High concentration of perchlorate can competitively block the uptake of iodide by the sodium iodide symporter and disrupt thyroid function. Due to this ability to potentially impair thyroid function, perchlorate in environmental exposure pathways has been of concern for more than a decade. Our knowledge of the spatial and temporal aspects of environmental perchlorate has increased dramatically in the past few years. To date, perchlorate has been found in numerous different environmental media, including water, soils and sediments, and plants, from many parts of the world. Perchlorate can be found in marine alage, food and plant samples from Asia, Africa, Europe, North and South America. It is becoming increasingly apparent that perchlorate in low levels is ubiquitous. Perchlorate has been found in several different carbon age-dated water and midden samples that pre-date the industrial age and agricultural use of Chilean nitrate fertilizers by thousands of years. While anthropogenic sources of perchlorate exist, the accumulating spatial and temporal evidence suggests that perchlorate must have a significant natural source. This natural source of perchlorate under the appropriate geochemical and climatic conditions is contributing a natural background level of perchlorate. Concentrations of perchlorate in soils appears to be influenced by soil geochemistry. Soils with low organic content usually have higher levels of perchlorate then soils with abundant organic matter. High levels of perchlorate have been found in remotely located xerophytes growing in aridosols and in deciduous phreatophytes growing in humid densely populated areas. Often the amount of perchlorate in a plant cannot be explained by the amount of perchlorate in either the soil or precipitation. Investigations into the relative source contribution of lithogenic, atmospheric and other sources and mechanisms

  2. The effects of subchronic acrylamide exposure on gene expression, neurochemistry, hormones, and histopathology in the hypothalamus-pituitary-thyroid axis of male Fischer 344 rats

    International Nuclear Information System (INIS)

    Bowyer, J.F.; Latendresse, J.R.; Delongchamp, R.R.; Muskhelishvili, L.; Warbritton, A.R.; Thomas, M.; Tareke, E.; McDaniel, L.P.; Doerge, D.R.

    2008-01-01

    Acrylamide (AA) is an important industrial chemical that is neurotoxic in rodents and humans and carcinogenic in rodents. The observation of cancer in endocrine-responsive tissues in Fischer 344 rats has prompted hypotheses of hormonal dysregulation, as opposed to DNA damage, as the mechanism for tumor induction by AA. The current investigation examines possible evidence for disruption of the hypothalamic-pituitary-thyroid axis from 14 days of repeated exposure of male Fischer 344 rats to doses of AA that range from one that is carcinogenic after lifetime exposure (2.5 mg/kg/d), an intermediate dose (10 mg/kg/d), and a high dose (50 mg/kg/d) that is neurotoxic for this exposure time. The endpoints selected include: serum levels of thyroid and pituitary hormones; target tissue expression of genes involved in hormone synthesis, release, and receptors; neurotransmitters in the CNS that affect hormone homeostasis; and histopathological evaluation of target tissues. These studies showed virtually no evidence for systematic alteration of the hypothalamic-pituitary-thyroid axis and do not support hormone dysregulation as a plausible mechanism for AA-induced thyroid cancer in the Fischer 344 rat. Specifically, there were no significant changes in: 1) mRNA levels in hypothalamus or pituitary for TRH, TSH, thyroid hormone receptor α and β, as well 10 other hormones or releasing factors; 2) mRNA levels in thyroid for thyroglobulin, thyroid peroxidase, sodium iodide symporter, or type I deiodinases; 3) serum TSH or T3 levels (T4 was decreased at high dose only); 4) dopaminergic tone in the hypothalamus and pituitary or importantly 5) increased cell proliferation (Mki67 mRNA and Ki-67 protein levels were not increased) in thyroid or pituitary. These negative findings are consistent with a genotoxic mechanism of AA carcinogenicity based on metabolism to glycidamide and DNA adduct formation. Clarification of this mechanistic dichotomy may be useful in human cancer risk

  3. Breastfeeding and maternal and infant iodine nutrition.

    Science.gov (United States)

    Azizi, Fereidoun; Smyth, Peter

    2009-05-01

    The aim of this review is to explore information available regarding iodine secretion in milk, both mothers and infants iodine nutrition during breastfeeding and to make recommendations for appropriate iodine supplementation during lactation. MEDLINE was queried for studies between 1960 and 2007 that included lactation and breastfeeding with iodine and iodine deficiency. Studies were selected if they studied (i) Secretion of iodine in breast milk; (ii) breastfeeding and iodine nutrition; (iii) factors affecting maternal iodine metabolism and (iv) recommendations for iodine supplementation during breastfeeding. Thirty-six articles met the selection criteria. The iodine content of breast milk varies with dietary iodine intake, being lowest in areas of iodine deficiency with high prevalence of goitre. Milk iodine levels are correspondingly higher when programs of iodine prophylaxis such as salt iodization or administration of iodized oil have been introduced. The small iodine pool of the neonatal thyroid turns over very rapidly and is highly sensitive to variations in dietary iodine intake. Expression of the sodium iodide symporter is up-regulated in the lactating mammary gland which results in preferential uptake of iodide. In areas of iodine sufficiency breast milk iodine concentration should be in the range of 100-150 microg/dl. Studies from France, Germany, Belgium, Sweden, Spain, Italy, Denmark, Thailand and Zaire have shown breast milk concentrations of nutrition. The current WHO/ICCIDD/UNICEF recommendation for daily iodine intake (250 microg for lactating mothers) has been selected to ensure that iodine deficiency dose not occur in the postpartum period and that the iodine content of the milk is sufficient for the infant's iodine requirement.

  4. Molecular nuclear imaging for targeting and trafficking

    International Nuclear Information System (INIS)

    Bom, Hee Seung; Min, Jung Jun; Jeong, Hwan-Jeong

    2006-01-01

    Noninvasive molecular targeting in living subjects is highly demanded for better understanding of such diverse topics as the efficient delivery of drugs, genes, or radionuclides for the diagnosis or treatment of diseases. Progress in molecular biology, genetic engineering and polymer chemistry provides various tools to target molecules and cells in vivo. We used chitosan as a polymer, and 99m Tc as a radionuclide. We developed 99m Tc-galactosylated chitosan to target asialoglycoprotein receptors for nuclear imaging. We also developed 99m Tc-HYNIC-chitosan-transferrin to target inflammatory cells, which was more effective than 67 Ga-citrate for imaging inflammatory lesions. For an effective delivery of molecules, a longer circulation time is needed. We found that around 10% PEGylation was most effective to prolong the circulation time of liposomes for nuclear imaging of 99m Tc-HMPAO-labeled liposomes in rats. Using various characteristics of molecules, we can deliver drugs into targets more effectively. We found that 99m Tc-labeled biodegradable pullulan-derivatives are retained in tumor tissue in response to extracellular ion-strength. For the trafficking of various cells or bacteria in an intact animal, we used optical imaging techniques or radiolabeled cells. We monitored tumor-targeting bacteria by bioluminescent imaging techniques, dentritic cells by radiolabeling and neuronal stem cells by sodium-iodide symporter reporter gene imaging. In summary, we introduced recent achievements of molecular nuclear imaging technologies in targeting receptors for hepatocyte or inflammatory cells and in trafficking bacterial, immune and stem cells using molecular nuclear imaging techniques

  5. Functional morphology of pituitary -thyroid and -adrenocortical axes in middle-aged male rats treated with Vitex agnus castus essential oil.

    Science.gov (United States)

    Šošić-Jurjević, Branka; Ajdžanović, Vladimir; Filipović, Branko; Trifunović, Svetlana; Jarić, Ivana; Ristić, Nataša; Milošević, Verica

    2016-09-01

    We previously reported that Vitex agnus-castus L. essential oil (VACEO), when administered to middle-aged males, exerts a bone-protective effect, induces silencing of locomotor activities and decreases pituitary prolactin immunopositivity. To further assess the putative endocrine effects of VACEO, we examined the pituitary-thyroid and -adrenocortical axes in our model. Sixteen-month-old Wistar rats were subcutaneously administered 60mg/kg of VACEO dissolved in sterile olive oil, while the control group received the same amount of vehicle alone for three weeks. Pituitaries, thyroids and adrenals were analyzed by qualitative and quantitative histological approaches. Concentration of thyroid stimulating hormone (TSH), total thyroxine and triiodothyronine (TH), adrenocorticotrophic hormone (ACTH), corticosterone in serum and in adrenal tissue were measured. In VACEO-treated rats, the relative volume density of pituitary thyrotrophs increased (p<0.001), while intensity of cytoplasmic TSHβ immunostaining decreased (p<0.001), consistent with elevated TSH in serum (p<0.01). The thyroid tissue was characterized by a micro-follicular structure, increased relative volume of follicular epithelium (p<0.05), decreased volume of luminal colloid (p<0.001) and increased basolateral expression of sodium-iodide symporter-immunopositivity (p<0.05). Serum TH also increased (p<0.01). The relative volume density of pituitary corticotrophs decreased (p<0.05), compatible with decline in circulating ACTH (p<0.05). Neither tissue nor serum corticosterone levels were affected by VACEO treatment. In conclusion, the observed changes in TSH and ACTH strongly indicate central endocrine effects of prolonged VACEO treatment. In this respect, production of ACTH decreased without impact on corticosterone production. Increase in serum concentration of both TH and TSH are not compatible with a negative feedback loop and suggest a major change in set-point regulation of the hypothalamic

  6. Evaluation of perturbations in serum thyroid hormones during human pregnancy due to dietary iodide and perchlorate exposure using a biologically based dose-response model.

    Science.gov (United States)

    Lumen, Annie; Mattie, David R; Fisher, Jeffrey W

    2013-06-01

    A biologically based dose-response model (BBDR) for the hypothalamic pituitary thyroid (HPT) axis was developed in the near-term pregnant mother and fetus. This model was calibrated to predict serum levels of iodide, total thyroxine (T4), free thyroxine (fT4), and total triiodothyronine (T3) in the mother and fetus for a range of dietary iodide intake. The model was extended to describe perchlorate, an environmental and food contaminant, that competes with the sodium iodide symporter protein for thyroidal uptake of iodide. Using this mode-of-action framework, simulations were performed to determine the daily ingestion rates of perchlorate that would be associated with hypothyroxinemia or onset of hypothyroidism for varying iodide intake. Model simulations suggested that a maternal iodide intake of 75 to 250 µg/day and an environmentally relevant exposure of perchlorate (~0.1 µg/kg/day) did not result in hypothyroxinemia or hypothyroidism. For a daily iodide-sufficient intake of 200 µg/day, the dose of perchlorate required to reduce maternal fT4 levels to a hypothyroxinemic state was estimated at 32.2 µg/kg/day. As iodide intake was lowered to 75 µg/day, the model simulated daily perchlorate dose required to cause hypothyroxinemia was reduced by eightfold. Similarly, the perchlorate intake rates associated with the onset of subclinical hypothyroidism ranged from 54.8 to 21.5 µg/kg/day for daily iodide intake of 250-75 µg/day. This BBDR-HPT axis model for pregnancy provides an example of a novel public health assessment tool that may be expanded to address other endocrine-active chemicals found in food and the environment.

  7. High-performance imaging of stem cells using single-photon emissions

    Science.gov (United States)

    Wagenaar, Douglas J.; Moats, Rex A.; Hartsough, Neal E.; Meier, Dirk; Hugg, James W.; Yang, Tang; Gazit, Dan; Pelled, Gadi; Patt, Bradley E.

    2011-10-01

    Radiolabeled cells have been imaged for decades in the field of autoradiography. Recent advances in detector and microelectronics technologies have enabled the new field of "digital autoradiography" which remains limited to ex vivo specimens of thin tissue slices. The 3D field-of-view (FOV) of single cell imaging can be extended to millimeters if the low energy (10-30 keV) photon emissions of radionuclides are used for single-photon nuclear imaging. This new microscope uses a coded aperture foil made of highly attenuating elements such as gold or platinum to form the image as a kind of "lens". The detectors used for single-photon emission microscopy are typically silicon detectors with a pixel pitch less than 60 μm. The goal of this work is to image radiolabeled mesenchymal stem cells in vivo in an animal model of tendon repair processes. Single-photon nuclear imaging is an attractive modality for translational medicine since the labeled cells can be imaged simultaneously with the reparative processes by using the dual-isotope imaging technique. The details our microscope's two-layer gold aperture and the operation of the energy-dispersive, pixellated silicon detector are presented along with the first demonstration of energy discrimination with a 57Co source. Cell labeling techniques have been augmented by genetic engineering with the sodium-iodide symporter, a type of reporter gene imaging method that enables in vivo uptake of free 99mTc or an iodine isotope at a time point days or weeks after the insertion of the genetically modified stem cells into the animal model. This microscopy work in animal research may expand to the imaging of reporter-enabled stem cells simultaneously with the expected biological repair process in human clinical trials of stem cell therapies.

  8. Iodine uptake and prostate cancer in the TRAMP mouse model.

    Science.gov (United States)

    Olvera-Caltzontzin, Paloma; Delgado, Guadalupe; Aceves, Carmen; Anguiano, Brenda

    2013-11-08

    Iodine supplementation exerts antitumor effects in several types of cancer. Iodide (I⁻) and iodine (I₂) reduce cell proliferation and induce apoptosis in human prostate cancer cells (LNCaP and DU-145). Both chemical species decrease tumor growth in athymic mice xenografted with DU-145 cells. The aim of this study was to analyze the uptake and effects of iodine in a preclinical model of prostate cancer (transgenic adenocarcinoma of the mouse prostate [TRAMP] mice/SV40-TAG antigens), which develops cancer by 12 wks of age. ¹²⁵I⁻ and ¹²⁵I₂ uptake was analyzed in prostates from wild-type and TRAMP mice of 12 and 24 wks in the presence of perchlorate (inhibitor of the Na⁺/I⁻ symporter [NIS]). NIS expression was quantified by quantitative polymerase chain reaction (qPCR). Mice (6 wks old) were supplemented with 0.125 mg I⁻ plus 0.062 mg I₂/mouse/day for 12 or 24 wks. The weight of the genitourinary tract (GUT), the number of acini with lesions, cell proliferation (levels of proliferating cell nuclear antigen [PCNA] by immunohistochemistry), p53 and p21 expression (by qPCR) and apoptosis (relative amount of nucleosomes by enzyme-linked immunosorbent assay) were evaluated. In both age-groups, normal and tumoral prostates take up both forms of iodine, but only I⁻ uptake was blocked by perchlorate. Iodine supplementation prevented the overexpression of NIS in the TRAMP mice, but had no effect on the GUT weight, cell phenotype, proliferation or apoptosis. In TRAMP mice, iodine increased p53 expression but had no effect on p21 (a p53-dependent gene). Our data corroborate NIS involvement in I⁻ uptake and support the notion that another transporter mediates I₂ uptake. Iodine did not prevent cancer progression. This result could be explained by a strong inactivation of the p53 pathway by TAG antigens.

  9. Financial impact of outpatient clinic radioiodine therapy with sodium iodide I-131 for the treatment of patients with differentiated low-risk thyroid carcinoma in relation to hospital doses; Impacto financeiro da radioiodoterapia ambulatorial com iodeto de sódio I-131 para tratamento de pacientes com carcinoma diferenciado da tireóide de baixo risco em relação às doses hospitalares

    Energy Technology Data Exchange (ETDEWEB)

    Berenguer, P.F.; Chang, T.M.C.; Silva, R.A.M.; Neto, A.H.D.; Belo, I.B., E-mail: pricilaberenguer@gmail.com [Instituto de Medicina Integral Professor Fernando Figueira, Recife, PE (Brazil). Serviço de Medicina Nuclear; Santos, M.A.P. [Centro Regional de Ciências Nucleares do Nordeste (CRCN-NE/CNEN-PE), Recife (Brazil). Coordenação de Radioproteção

    2017-07-01

    Differential thyroid carcinoma (CDT) is the most prevalent endocrine malignancy in the world, with an excellent prognosis and a 10-year survival rate of over 95%. By 2013, the lowest activity of I-131 authorized by the Brazilian Unified Health System (SUS) in the therapy of patients with low-risk CDT was 3,700 MBq, requiring hospitalization. Recent studies have shown similar effectiveness between low and high doses of I-131 in the treatment of low-risk CDT. In 2014, the Ministry of Health included in the list of SUS procedures the use of lower activities (1,110 MBq and 1,850 MBq) for this purpose. The Brazilian National Nuclear Energy Commission (CNEN) also authorized the outpatient use of activity up to 1,850 MBq of I-131. Objective: To evaluate the financial impact of the adoption of ambulatory radioiodine therapy in patients with CDT of low-risk when compared to the hospital dose. Methods: Analysis of patients with CDT low-risk who were treated with an outpatient dose of I-131 from August / 2014 to January / 2017 at a nuclear medicine service in Recife, PE, Brazil. The cost of outpatient versus hospital doses was calculated. Results: A total of 289 patients underwent low doses of iodine therapy were evaluated, resulting in a savings of R$227,793.80. Conclusion: Outpatient radioiodine therapy in the treatment of patients with CDT of low-risk resulted in a 61.10% reduction in SUS expense, in addition to enabling faster care.

  10. Genetic disruption of lactate/H+ symporters (MCTs) and their subunit CD147/BASIGIN sensitizes glycolytic tumor cells to phenformin.

    Science.gov (United States)

    Marchiq, Ibtissam; Le Floch, Renaud; Roux, Danièle; Simon, Marie-Pierre; Pouyssegur, Jacques

    2015-01-01

    Rapidly growing glycolytic tumors require energy and intracellular pH (pHi) homeostasis through the activity of two major monocarboxylate transporters, MCT1 and the hypoxia-inducible MCT4, in intimate association with the glycoprotein CD147/BASIGIN (BSG). To further explore and validate the blockade of lactic acid export as an anticancer strategy, we disrupted, via zinc finger nucleases, MCT4 and BASIGIN genes in colon adenocarcinoma (LS174T) and glioblastoma (U87) human cell lines. First, we showed that homozygous loss of MCT4 dramatically sensitized cells to the MCT1 inhibitor AZD3965. Second, we demonstrated that knockout of BSG leads to a decrease in lactate transport activity of MCT1 and MCT4 by 10- and 6-fold, respectively. Consequently, cells accumulated an intracellular pool of lactic and pyruvic acids, magnified by the MCT1 inhibitor decreasing further pHi and glycolysis. As a result, we found that these glycolytic/MCT-deficient cells resumed growth by redirecting their metabolism toward OXPHOS. Third, we showed that in contrast with parental cells, BSG-null cells became highly sensitive to phenformin, an inhibitor of mitochondrial complex I. Phenformin addition to these MCT-disrupted cells in normoxic and hypoxic conditions induced a rapid drop in cellular ATP-inducing cell death by "metabolic catastrophe." Finally, xenograft analysis confirmed the deleterious tumor growth effect of MCT1/MCT4 ablation, an action enhanced by phenformin treatment. Collectively, these findings highlight that inhibition of the MCT/BSG complexes alone or in combination with phenformin provides an acute anticancer strategy to target highly glycolytic tumors. This genetic approach validates the anticancer potential of the MCT1 and MCT4 inhibitors in current development. ©2014 American Association for Cancer Research.

  11. Structural insights into the elevator-like mechanism of the sodium/citrate symporter CitS.

    Science.gov (United States)

    Kim, Ji Won; Kim, Subin; Kim, Songwon; Lee, Haerim; Lee, Jie-Oh; Jin, Mi Sun

    2017-05-31

    The sodium-dependent citrate transporter of Klebsiella pneumoniae (KpCitS) belongs to the 2-hydroxycarboxylate transporter (2-HCT) family and allows the cell to use citrate as sole carbon and energy source in anaerobic conditions. Here we present crystal structures of KpCitS in citrate-bound outward-facing, citrate-bound asymmetric, and citrate-free inward-facing state. The structures reveal that the KpCitS dimerization domain remains stationary throughout the transport cycle due to a hydrogen bond network as well as extensive hydrophobic interactions. In contrast, its transport domain undergoes a ~35° rigid-body rotation and a ~17 Å translocation perpendicular to the membrane to expose the substrate-binding site alternately to either side of the membrane. Furthermore, homology models of two other 2-HCT proteins based on the KpCitS structure offer structural insights into their differences in substrate specificity at a molecular level. On the basis of our results and previous biochemical data, we propose that the activity of the 2-HCT CitS involves an elevator-like movement in which the transport domain itself traverses the lipid bilayer, carrying the substrate into the cell in a sodium-dependent manner.

  12. Structural evidence for induced fit and a mechanism for sugar/H+ symport in LacY

    DEFF Research Database (Denmark)

    Mirza, Osman Asghar; Guan, Lan; Verner, Gill

    2006-01-01

    Cation-coupled active transport is an essential cellular process found ubiquitously in all living organisms. Here, we present two novel ligand-free X-ray structures of the lactose permease (LacY) of Escherichia coli determined at acidic and neutral pH, and propose a model for the mechanism...... of coupling between lactose and H+ translocation. No sugar-binding site is observed in the absence of ligand, and deprotonation of the key residue Glu269 is associated with ligand binding. Thus, substrate induces formation of the sugar-binding site, as well as the initial step in H+ transduction....

  13. Immuno-PET of undifferentiated thyroid carcinoma with radioiodine-labelled antibody cMAb U36: application to antibody tumour uptake studies

    Energy Technology Data Exchange (ETDEWEB)

    Fortin, Marc-Andre [Centre Hospitalier Universitaire de Quebec and Laval University, Laboratory for Biomaterials and Bioengineering, Quebec City (Canada); Uppsala University, Biomedical Radiation Sciences, Department of Oncology, Radiology, and Clinical Immunology, Rudbeck Laboratory, Uppsala (Sweden); Salnikov, Alexei V. [Uppsala University, BMC, Department of Medical Biochemistry and Microbiology, Uppsala (Sweden); German Cancer Research Center, Division of Molecular Immunology, Heidelberg (Germany); Nestor, Marika [Uppsala University, Division of Otolaryngology and Head and Neck Surgery, Department of Surgical Sciences, Uppsala (Sweden); Heldin, Nils-Erik [Uppsala University, Department of Genetics and Pathology, Rudbeck Laboratory, Uppsala (Sweden); Rubin, Kristofer [Uppsala University, BMC, Department of Medical Biochemistry and Microbiology, Uppsala (Sweden); Lundqvist, Hans [Uppsala University, Biomedical Radiation Sciences, Department of Oncology, Radiology, and Clinical Immunology, Rudbeck Laboratory, Uppsala (Sweden)

    2007-09-15

    We tested the suitability of the chimeric monoclonal anti-human CD44 splice version 6 antibody (cMAb U36) for targeting and visualising human anaplastic thyroid carcinoma with PET. We also performed experiments aimed at elucidating the relation between tumour interstitial fluid pressure (TIFP) and the tumour uptake of antibodies. The affinity and specificity of the cMAb U36 for KAT-4 cells were evaluated in vitro, as was the Na{sup +}/I{sup -} symporter (NIS) expression. Biodistribution studies were performed on KAT-4 carcinoma-bearing mice injected with {sup 124}I-cMAb U36 or free iodine. Biodistribution studies were also performed in animals treated with the specific TGF-{beta}1 and -{beta}3 inhibitor Fc:T{beta}RII, which lowers TIFP. Treated and non-treated animals were scanned by microPET. Cultured human undifferentiated/anaplastic thyroid carcinoma KAT-4 cells expressed low levels of NIS and uptake of free iodine was insignificant. The cMAb U36 expressed an affinity (K{sub D}) of 11 {+-} 2 nM. Tumour radioactivity uptake reached maximum values 48 h after injection of {sup 124}I-cMAb U36 ({proportional_to}22%IA/g). KAT-4 carcinomas were readily identified in all {sup 124}I-immuno-PET images. Radioactivity tumour uptake in Fc:T{beta}RII-treated animals was significantly lower at 24 and 48 h after injection, and five times higher thyroid uptake was also noted. We successfully used {sup 124}I-cMAb U36 to visualise CD44v6-expressing human anaplastic thyroid carcinoma. Given the lack of NIS expression in KAT-4, tumour visualisation is not due to free iodine uptake. Lowering the TIFP in KAT-4 carcinomas did not increase the uptake of mAbs into tumour tissue. (orig.)

  14. Combined Natural Gas and Solar Technologies for Heating and Cooling in the City of NIS in Serbia

    Science.gov (United States)

    Stefanović, Velimir P.; Bojić, Milorad Lj.

    2010-06-01

    The use of conventional systems for heat and electricity production in Niš and Serbia means a constant waste of energy, and money. This problem is present in both industrial and public sector. Using conventional systems, means not only low-energy efficient systems, and technologies, but also using very "dirty" technologies, which cause heavy environment pollution. The lack of electricity in our country, and region is also present. The gas pipeline in Niš was finished not long ago, and second gas pipeline is about to be made in the next couple of years. This opens a door for implementing new technologies and the use of new methods for production of heat and electricity, while preserving our environment. This paper reports discussion of this technology with management of public institutions, which use both heat and electricity.

  15. Temporal Trends in Percutaneous Coronary Intervention Associated Acute Cerebrovascular Accident (From the 1998–2008 Nationwide Inpatient Sample [NIS] Database)

    Science.gov (United States)

    Shivaraju, Anupama; Yu, Changhong; Kattan, Michael W.; Xie, Hui; Shroff, Adhir R.; Vidovich, Mladen I.

    2014-01-01

    Acute cerebrovascular accident (CVA) after percutaneous coronary intervention (PCI) for acute coronary syndrome (ACS) and coronary artery disease (CAD) is associated with high morbidity and mortality. Nationwide Inpatient Sample from 1998 to 2008 was utilized to identify 1,552,602 PCIs performed for ACS and CAD. We assessed temporal trends in the incidence, predictors and prognostic impact of CVA in a broad range of patients undergoing PCI. The overall incidence of CVA was 0.56% (95% confidence interval (CI), 0.55%–0.57%). The incidence of CVA remained unchanged over the study period (adjusted p for trend = 0.2271). The overall mortality in the CVA group was 10.76% (95% CI, 10.1%–11.4%). The adjusted odds ratio (OR) of CVA for in-hospital mortality was 7.74 (95% CI, 7.00–8.57; p<0.0001); this remained high but decreased over the study period (adjusted p for trend <0.0001). Independent predictors of CVA included older age (OR, 1.03, 95% CI, 1.02–1.03; p<0.0001), disorder of lipid metabolism (OR, 1.31, 95% CI, 1.24–1.38; p<0.001), history of tobacco use (OR, 1.21, 95% CI, 1.10–1.34; p=0.0002), coronary atherosclerosis (OR 1.56, 95% CI, 1.43–1.71; p<0.0001), and IABP use (OR 1.39, 95% CI, 1.09–1.77; p=0.0073). A nomogram for predicting the probability of CVA achieved a concordance index of 0.73 and was well calibrated. In conclusion, the incidence of CVA associated with PCI has remained unchanged from 1998–2008 in face of improved equipment, techniques and adjunctive pharmacology. The risk of CVA associated in-hospital mortality is high; however, this risk has declined over the study period. PMID:24952927

  16. COPING WITH AND MANAGING STRESS STYLES OF FRESHMEN PHYSICAL EDUCATION STUDENTS AT THE PE FACULTY IN NIS

    Directory of Open Access Journals (Sweden)

    Danica Pirsl

    2005-05-01

    Full Text Available Stress is frequently viewed as an enemy. This is a misconception. Stress is often neither positive nor negative. Selye referred to stress judged as "good" as eustress. Distress, on the other hand, is stress that results in negative responses. Unchecked negative stress can interfere with the physiological and psychological functioning of the body and may ultimately result in disease or disability. A stressor is any physical, psychological or environmental event, or condition that initiates the stress. The body responds with the same threestage process. This series of changes is known as the general adaptation syndrome (GAS. The three phases are alarm, resistance, and exhaustion. It is interesting to note that PE students form their own stress copying styles in the mental, emotional and physical areas. Results are enhanced activities, sense of control and high energy level. Both male and female students show similar patterns of behaviour in stressful situations but female students show more interest in sporting activities when in stress-related situation

  17. Trends in records and contribution of non-indigenous species (NIS) to biotic communities in Danish marine waters

    DEFF Research Database (Denmark)

    Stæhr, Peter Anton; Jakobsen, Hans Henrik; Hansen, Jørgen L.S.

    The report investigates trends in the temporal and spatial changes of non-indigenous marine species in the Danish part of the OSPAR and HELCOM regions. The assessment is based on a quantitative analysis of data available in national monitoring databases and covers the period 1989 to 2014 and othe...

  18. Disruption of the hypothalamic-pituitary-thyroid axis in zebrafish embryo-larvae following waterborne exposure to BDE-47, TBBPA and BPA

    Energy Technology Data Exchange (ETDEWEB)

    Chan, Winson K. [Biochemistry Program, School of Life Sciences, Chinese University of Hong Kong, Sha Tin, Hong Kong (Hong Kong); Chan, King Ming, E-mail: kingchan@cuhk.edu.hk [Biochemistry Program, School of Life Sciences, Chinese University of Hong Kong, Sha Tin, Hong Kong (Hong Kong); Environmental Science Program, School of Life Sciences, Chinese University of Hong Kong, Sha Tin, Hong Kong (Hong Kong)

    2012-02-15

    We performed waterborne exposures of 2,2 Prime ,4,4 Prime -tetrabromodiphenyl ether (BDE-47), tetrabromobisphenol A (TBBPA) or bisphenol A (BPA) on zebrafish (Danio rerio) embryo-larvae and quantitatively measured the expression of genes belonging to the hypothalamic-pituitary-thyroid (HPT) axis to assess for adverse thyroid function. For analysis on the effects of BDE-47, TBBPA and BPA on the hypothalamic-pituitary-thyroid genes, zebrafish embryo-larvae were acutely exposed to lethal concentrations of the chemical agents in order to determine the 96 h-LC50 (96 h lethal median concentration) and 96 h-EC50 (96 h effective median concentration) values. Further exposures at sub-lethal concentrations were then carried out and total RNA samples were extracted to quantify the mRNA expression levels of the genes of interest. In larvae, BDE-47 was found to have significantly induced many genes of interest, namely thyroglobulin, thyroid peroxidase, thyroid receptors {alpha} and {beta}, thyroid stimulating hormone, and transthyretin. TBBPA only significantly induced three genes of interest (thyroid receptor {alpha}, thyroid stimulating hormone, and transthyretin) while BPA only induced thyroid stimulating hormone. In embryos, BDE-47 significantly induced the sodium iodide symporter and thyroid stimulating hormone. TBBPA significantly induced thyroid receptor {alpha} and thyroid stimulating hormone, while BPA did not significantly induce any of the genes. Most genes were only induced at the 75% 96 h-LC50 or 96 h-EC50 value; however, thyroid peroxidase and thyroid stimulating hormone demonstrated upregulation in a level as little as the 10% 96 h-LC50 value. The present study provides a new set of data on zebrafish mRNA induction of hypothalamic-pituitary-thyroid genes from exposure to BDE-47, TBBPA, or BPA. This information would serve useful for elucidating the toxicological mechanism of brominated flame retardants, assessing appropriate safety levels in the environment for

  19. An Enantiomer of an Oral Small-Molecule TSH Receptor Agonist Exhibits Improved Pharmacologic Properties.

    Science.gov (United States)

    Neumann, Susanne; Padia, Umesh; Cullen, Mary Jane; Eliseeva, Elena; Nir, Eshel A; Place, Robert F; Morgan, Sarah J; Gershengorn, Marvin C

    2016-01-01

    We are developing an orally available small-molecule, allosteric TSH receptor (TSHR) agonist for follow-up diagnostics of patients with thyroid cancer. The agonist C2 (NCGC00161870) that we have studied so far is a racemic mixture containing equal amounts of two enantiomers, E1 and E2. As enantiomers of many drugs exhibit different pharmacologic properties, we assessed the properties of E1 and E2. We separated the two enantiomers by chiral chromatography and determined E2 as the (S)-(+) isomer via crystal structure analysis. E1 and E2 were shown to bind differently to a homology model of the transmembrane domain of TSHR in which E2 was calculated to exhibit lower binding energy than E1 and was, therefore, predicted to be more potent than E1. In HEK293 cells expressing human TSHRs, C2, E1, and E2 were equally efficacious in stimulating cAMP production, but their potencies were different. E2 was more potent (EC50 = 18 nM) than C2 (EC50 = 46 nM), which was more potent than E1 (EC50 = 217 nM). In primary cultures of human thyrocytes, C2, E1, and E2 stimulated increases in thyroperoxidase mRNA of 92-, 55-, and 137-fold and in sodium-iodide symporter mRNA of 20-, 4-, and 121-fold above basal levels, respectively. In mice, C2 stimulated an increase in radioactive iodine uptake of 1.5-fold and E2 of 2.8-fold above basal level, whereas E1 did not have an effect. C2 stimulated an increase in serum T4 of 2.4-fold, E1 of 1.9-fold, and E2 of 5.6-fold above basal levels, and a 5-day oral dosing regimen of E2 increased serum T4 levels comparable to recombinant human TSH (rhTSH, Thyrogen(®)). Thus, E2 is more effective than either C2 or E1 in stimulating thyroid function and as efficacious as rhTSH in vivo. E2 represents the next step toward developing an oral drug for patients with thyroid cancer.

  20. An Enantiomer of an Oral Small Molecule TSH Receptor Agonist Exhibits Improved Pharmacologic Properties

    Directory of Open Access Journals (Sweden)

    Susanne Neumann

    2016-07-01

    Full Text Available We are developing an orally available small molecule, allosteric TSH receptor (TSHR agonist for follow up diagnostics of patients with thyroid cancer. The agonist C2 (NCGC00161870 that we have studied so far is a racemic mixture containing equal amounts of two enantiomers, E1 and E2. As enantiomers of many drugs exhibit different pharmacologic properties, we assessed the properties of E1 and E2. We separated the two enantiomers by chiral chromatography and determined E2 as the (S-(+ isomer via crystal structure analysis. E1 and E2 were shown to bind differently to a homology model of the transmembrane domain of TSHR in which E2 was calculated to exhibit lower binding energy than E1 and was therefore predicted to be more potent than E1. In HEK293 cells expressing human TSHRs, C2, E1, and E2 were equally efficacious in stimulating cAMP production, but their potencies were different. E2 was more potent (EC50 = 18 nM than C2 (EC50 = 46 nM which was more potent than E1 (EC50 = 217 nM. In primary cultures of human thyrocytes, C2, E1, and E2 stimulated increases in thyroperoxidase mRNA of 92-, 55-, and 137-fold and in sodium-iodide symporter mRNA of 20-fold, 4-fold and 121-fold above basal levels, respectively. In mice, C2 stimulated an increase in radioactive iodine uptake of 1.5-fold and E2 of 2.8-fold above basal level, whereas E1 did not have an effect. C2 stimulated an increase in serum T4 of 2.4-fold, E1 of 1.9-fold, and E2 of 5.6-fold above basal levels, and a 5 day oral dosing regimen of E2 increased serum T4 levels comparable to recombinant human TSH (rhTSH, Thyrogen®. Thus, E2 is more effective than either C2 or E1 in stimulating thyroid function and as efficacious as rhTSH in vivo. E2 represents the next step toward developing an oral drug for patients with thyroid cancer.

  1. Disruption of the hypothalamic-pituitary-thyroid axis in zebrafish embryo–larvae following waterborne exposure to BDE-47, TBBPA and BPA

    International Nuclear Information System (INIS)

    Chan, Winson K.; Chan, King Ming

    2012-01-01

    We performed waterborne exposures of 2,2′,4,4′-tetrabromodiphenyl ether (BDE-47), tetrabromobisphenol A (TBBPA) or bisphenol A (BPA) on zebrafish (Danio rerio) embryo–larvae and quantitatively measured the expression of genes belonging to the hypothalamic-pituitary-thyroid (HPT) axis to assess for adverse thyroid function. For analysis on the effects of BDE-47, TBBPA and BPA on the hypothalamic-pituitary-thyroid genes, zebrafish embryo–larvae were acutely exposed to lethal concentrations of the chemical agents in order to determine the 96 h-LC50 (96 h lethal median concentration) and 96 h-EC50 (96 h effective median concentration) values. Further exposures at sub-lethal concentrations were then carried out and total RNA samples were extracted to quantify the mRNA expression levels of the genes of interest. In larvae, BDE-47 was found to have significantly induced many genes of interest, namely thyroglobulin, thyroid peroxidase, thyroid receptors α and β, thyroid stimulating hormone, and transthyretin. TBBPA only significantly induced three genes of interest (thyroid receptor α, thyroid stimulating hormone, and transthyretin) while BPA only induced thyroid stimulating hormone. In embryos, BDE-47 significantly induced the sodium iodide symporter and thyroid stimulating hormone. TBBPA significantly induced thyroid receptor α and thyroid stimulating hormone, while BPA did not significantly induce any of the genes. Most genes were only induced at the 75% 96 h-LC50 or 96 h-EC50 value; however, thyroid peroxidase and thyroid stimulating hormone demonstrated upregulation in a level as little as the 10% 96 h-LC50 value. The present study provides a new set of data on zebrafish mRNA induction of hypothalamic-pituitary-thyroid genes from exposure to BDE-47, TBBPA, or BPA. This information would serve useful for elucidating the toxicological mechanism of brominated flame retardants, assessing appropriate safety levels in the environment for these compounds, as well

  2. In vitro identification and characterization of CD133(pos cancer stem-like cells in anaplastic thyroid carcinoma cell lines.

    Directory of Open Access Journals (Sweden)

    Giovanni Zito

    Full Text Available Recent publications suggest that neoplastic initiation and growth are dependent on a small subset of cells, termed cancer stem cells (CSCs. Anaplastic Thyroid Carcinoma (ATC is a very aggressive solid tumor with poor prognosis, characterized by high dedifferentiation. The existence of CSCs might account for the heterogeneity of ATC lesions. CD133 has been identified as a stem cell marker for normal and cancerous tissues, although its biological function remains unknown.ATC cell lines ARO, KAT-4, KAT-18 and FRO were analyzed for CD133 expression. Flow cytometry showed CD133(pos cells only in ARO and KAT-4 (64+/-9% and 57+/-12%, respectively. These data were confirmed by qRT-PCR and immunocytochemistry. ARO and KAT-4 were also positive for fetal marker oncofetal fibronectin and negative for thyrocyte-specific differentiating markers thyroglobulin, thyroperoxidase and sodium/iodide symporter. Sorted ARO/CD133(pos cells exhibited higher proliferation, self-renewal, colony-forming ability in comparison with ARO/CD133(neg. Furthermore, ARO/CD133(pos showed levels of thyroid transcription factor TTF-1 similar to the fetal thyroid cell line TAD-2, while the expression in ARO/CD133(neg was negligible. The expression of the stem cell marker OCT-4 detected by RT-PCR and flow cytometry was markedly higher in ARO/CD133(pos in comparison to ARO/CD133(neg cells. The stem cell markers c-KIT and THY-1 were negative. Sensitivity to chemotherapy agents was investigated, showing remarkable resistance to chemotherapy-induced apoptosis in ARO/CD133(pos when compared with ARO/CD133(neg cells.We describe CD133(pos cells in ATC cell lines. ARO/CD133(pos cells exhibit stem cell-like features--such as high proliferation, self-renewal ability, expression of OCT-4--and are characterized by higher resistance to chemotherapy. The simultaneous positivity for thyroid specific factor TTF-1 and onfFN suggest they might represent putative thyroid cancer stem-like cells. Our in

  3. Measles to the Rescue: A Review of Oncolytic Measles Virus

    Directory of Open Access Journals (Sweden)

    Sarah Aref

    2016-10-01

    Full Text Available Oncolytic virotherapeutic agents are likely to become serious contenders in cancer treatment. The vaccine strain of measles virus is an agent with an impressive range of oncolytic activity in pre-clinical trials with increasing evidence of safety and efficacy in early clinical trials. This paramyxovirus vaccine has a proven safety record and is amenable to careful genetic modification in the laboratory. Overexpression of the measles virus (MV receptor CD46 in many tumour cells may direct the virus to preferentially enter transformed cells and there is increasing awareness of the importance of nectin-4 and signaling lymphocytic activation molecule (SLAM in oncolysis. Successful attempts to retarget MV by inserting genes for tumour-specific ligands to antigens such as carcinoembryonic antigen (CEA, CD20, CD38, and by engineering the virus to express synthetic microRNA targeting sequences, and “blinding” the virus to the natural viral receptors are exciting measures to increase viral specificity and enhance the oncolytic effect. Sodium iodine symporter (NIS can also be expressed by MV, which enables in vivo tracking of MV infection. Radiovirotherapy using MV-NIS, chemo-virotherapy to convert prodrugs to their toxic metabolites, and immune-virotherapy including incorporating antibodies against immune checkpoint inhibitors can also increase the oncolytic potential. Anti-viral host immune responses are a recognized barrier to the success of MV, and approaches such as transporting MV to the tumour sites by carrier cells, are showing promise. MV Clinical trials are producing encouraging preliminary results in ovarian cancer, myeloma and cutaneous non-Hodgkin lymphoma, and the outcome of currently open trials in glioblastoma multiforme, mesothelioma and squamous cell carcinoma are eagerly anticipated.

  4. The continuing importance of thyroid scintigraphy in the era of high-resolution ultrasound

    Energy Technology Data Exchange (ETDEWEB)

    Meller, J.; Becker, W. [Department of Nuclear Medicine, Georg August University, Goettingen (Germany)

    2002-08-01

    At the molecular level, the uptake of radioiodine and pertechnetate is proportional to the expression of the thyroidal sodium/iodine symporter (NIS). Qualitative and quantitative scintigraphic evaluation of the thyroid is performed with a gamma camera fitted with an on-line computer system and enables determination of the iodine uptake or the technetium uptake (TCTU) as an iodine clearance equivalent. Despite new molecular genetic insights into congenital hypothyroidism, the iodine-123 or pertechnetate scan remains the most accurate test for the detection of ectopic thyroid tissue. Following the identification of specific mutations of the genes coding for the NIS, thyroid peroxidase and pendrin, the discharge test has lost its role in establishing the diagnosis of inherited dyshormonogenesis, but it is still of value in the assessment of defect severity. In PDS mutations the test can be used to establish the diagnosis of syndromic disease. Quantitative pertechnetate scintigraphy is the most sensitive and specific technique for the diagnosis and quantification of thyroid autonomy. The method has proved to be valuable in risk stratification of spontaneous or iodine-induced hyperthyroidism, in the estimation of the target volume prior to radioiodine therapy and in the evaluation of therapeutic success after definitive treatment. In iodine deficiency areas the thyroid scan remains indispensable for the functional characterisation of a thyroid nodule and is still a first-line diagnostic procedure in cases of suspected thyroid malignancy. This is especially of importance in patients with Graves' disease, among whom a relatively high prevalence of cancer has been found in cold thyroid nodules. While determination of the TCTU is without any value in the differentiation between autoimmune thyroiditis and Graves' disease in most cases, it is of substantial importance in the differentiation between hyperthyroid autoimmune thyroiditis and Graves' disease. (orig.)

  5. Cancer-specific transgene expression mediated by systemic injection of nanoparticles.

    Science.gov (United States)

    Chisholm, Edward J; Vassaux, Georges; Martin-Duque, Pilar; Chevre, Raphael; Lambert, Olivier; Pitard, Bruno; Merron, Andrew; Weeks, Mark; Burnet, Jerome; Peerlinck, Inge; Dai, Ming-Shen; Alusi, Ghassan; Mather, Stephen J; Bolton, Katherine; Uchegbu, Ijeoma F; Schatzlein, Andreas G; Baril, Patrick

    2009-03-15

    The lack of safe and efficient systemic gene delivery vectors has largely reduced the potential of gene therapy in the clinic. Previously, we have reported that polypropylenimine dendrimer PPIG3/DNA nanoparticles are capable of tumor transfection upon systemic administration in tumor-bearing mice. To be safely applicable in the clinic, it is crucial to investigate the colloidal stability of nanoparticles and to monitor the exact biodistribution of gene transfer in the whole body of the live subject. Our biophysical characterization shows that dendrimers, when complexed with DNA, are capable of forming spontaneously in solution a supramolecular assembly that possesses all the features required to diffuse in experimental tumors through the enhanced permeability and retention effect. We show that these nanoparticles are of sizes ranging from 33 to 286 nm depending on the DNA concentration, with a colloidal stable and well-organized fingerprint-like structure in which DNA molecules are condensed with an even periodicity of 2.8 nm. Whole-body nuclear imaging using small-animal nano-single-photon emission computed tomography/computer tomography scanner and the human Na/I symporter (NIS) as reporter gene shows unique and highly specific tumor targeting with no detection of gene transfer in any of the other tissues of tumor-bearing mice. Tumor-selective transgene expression was confirmed by quantitative reverse transcription-PCR at autopsy of scanned animals, whereas genomic PCR showed that the tumor sites are the predominant sites of nanoparticle accumulation. Considering that NIS imaging of transgene expression has been recently validated in humans, our data highlight the potential of these nanoparticles as a new formulation for cancer gene therapy.

  6. The continuing importance of thyroid scintigraphy in the era of high-resolution ultrasound

    International Nuclear Information System (INIS)

    Meller, J.; Becker, W.

    2002-01-01

    At the molecular level, the uptake of radioiodine and pertechnetate is proportional to the expression of the thyroidal sodium/iodine symporter (NIS). Qualitative and quantitative scintigraphic evaluation of the thyroid is performed with a gamma camera fitted with an on-line computer system and enables determination of the iodine uptake or the technetium uptake (TCTU) as an iodine clearance equivalent. Despite new molecular genetic insights into congenital hypothyroidism, the iodine-123 or pertechnetate scan remains the most accurate test for the detection of ectopic thyroid tissue. Following the identification of specific mutations of the genes coding for the NIS, thyroid peroxidase and pendrin, the discharge test has lost its role in establishing the diagnosis of inherited dyshormonogenesis, but it is still of value in the assessment of defect severity. In PDS mutations the test can be used to establish the diagnosis of syndromic disease. Quantitative pertechnetate scintigraphy is the most sensitive and specific technique for the diagnosis and quantification of thyroid autonomy. The method has proved to be valuable in risk stratification of spontaneous or iodine-induced hyperthyroidism, in the estimation of the target volume prior to radioiodine therapy and in the evaluation of therapeutic success after definitive treatment. In iodine deficiency areas the thyroid scan remains indispensable for the functional characterisation of a thyroid nodule and is still a first-line diagnostic procedure in cases of suspected thyroid malignancy. This is especially of importance in patients with Graves' disease, among whom a relatively high prevalence of cancer has been found in cold thyroid nodules. While determination of the TCTU is without any value in the differentiation between autoimmune thyroiditis and Graves' disease in most cases, it is of substantial importance in the differentiation between hyperthyroid autoimmune thyroiditis and Graves' disease. (orig.)

  7. Anomalous concentration gradient in NaI solutions inadvertently frozen in transit

    International Nuclear Information System (INIS)

    Billinghurst, M.W.; Abrams, D.N.; Coutts, A.D.

    1990-01-01

    Therapeutic doses of iodine-131 ( 131 I) are frequently dispensed volumetrically from a stock vial containing a solution of sodium iodide. During the winter months the authors have observed that initial aliquots do not always have the same radioactive concentration as that calculated for the bulk solution. In order to evaluate the cause and extent of this problem, they prepared a stock solution of low radioactive concentration sodium iodide with the same concentration of sodium thiosulfate and pH as that in the stock therapeutic iodine vial. Aliquots of this solution were transferred to plastic tubes and were stored at various temperatures. These results clearly show that when there is a risk of freezing during transportation of therapeutic solutions of sodium iodide it is essential to physically mix the liquid once thawing is complete if therapeutic doses are to be dispensed accurately on a volume basis

  8. Properties of a reconstituted eukaryotic hexose/proton symporter solubilized by structurally related non-ionic detergents: specific requirement of phosphatidylcholine for permease stability

    Czech Academy of Sciences Publication Activity Database

    Robl, I.; Grassl, R.; Tanner, W.; Opekarová, Miroslava

    2000-01-01

    Roč. 1463, - (2000), s. 407-418 ISSN 0005-2736 R&D Projects: GA ČR GA204/99/0492; GA AV ČR KSK2052601 Grant - others:Deutsche Forschungsgemeinschaft(DE) SFB521; NATO Collaborative Research Grant(NQ) LST.ClG974804 Institutional research plan: CEZ:A53/98:Z5-020-9ii Subject RIV: EE - Microbiology, Virology Impact factor: 2.313, year: 2000

  9. Mechanism of the Association between Na+ Binding and Conformations at the Intracellular Gate in Neurotransmitter:Sodium Symporters

    DEFF Research Database (Denmark)

    Stolzenberg, Sebastian; Quick, Matthias; Zhao, Chunfeng

    2015-01-01

    -related conformational changes, but the intramolecular pathway of this mechanism has remained uncharted. We describe a new approach for the modeling and analysis of intramolecular dynamics in the bacterial NSS homolog LeuT. From microsecond-scale molecular dynamics simulations and cognate experimental verifications...... with global conformational changes that are critical for the transport mechanism. That the AIN between the Na+ binding sites and the intracellular gate in bacterial LeuT resembles that in eukaryotic hDAT highlights the conservation of allosteric pathways underlying NSS function....

  10. Knock out of the BASIGIN/CD147 chaperone of lactate/H+ symporters disproves its pro-tumour action via extracellular matrix metalloproteases (MMPs) induction.

    Science.gov (United States)

    Marchiq, Ibtissam; Albrengues, Jean; Granja, Sara; Gaggioli, Cédric; Pouysségur, Jacques; Simon, Marie-Pierre

    2015-09-22

    BASIGIN/CD147/EMMPRIN is a multifunctional transmembrane glycoprotein strongly expressed in tumours. BASIGIN controls tumour metabolism, particularly glycolysis by facilitating lactic acid export through the two monocarboxylate transporters MCT1 and hypoxia-inducible MCT4. However, before being recognized as a co-carrier of MCTs, BASIGIN was described as an inducer of extracellular matrix metalloproteases (MMPs). Early on, a model emerged in which, tumour cells use the extracellular domain of BASIGIN to recognize and stimulate neighbouring fibroblasts to produce MMPs. However, this model has remained hypothetical since a direct link between BASIGIN and MMPs production has not yet been clearly established. To validate the BASIGIN/MMP hypothesis, we developed BASIGIN knockouts in three human tumour cell lines derived from glioma, colon, and lung adenocarcinoma. By using co-culture experiments of either human or mouse fibroblasts and tumour cell lines we showed, contrary to what has been abundantly published, that the disruption of BASIGIN in tumour cells and in MEFs has no action on the production of MMPs. Our findings do not support the notion that the pro-tumoural action of BASIGIN is mediated via induction of MMPs. Therefore, we propose that to date, the strongest pro-tumoural action of BASIGIN is mediated through the control of fermentative glycolysis.

  11. Production technology of 131I-rose bengal

    International Nuclear Information System (INIS)

    Hradilek, P.; Miklik, M.; Kopicka, K.; Kronrad, L.

    1983-01-01

    A detailed description is presented of the production equipment and production process used for Rose Bengal labelled with 131 I designed for use in nuclear medicine. The apparatus was installed in the semi-hot cell laboratory of the Nuclear Research Institute at Rez. The processed activity is around 20 GBq, the average yield of the ion exchange reaction between non-radioactive Rose Bengal and 131 I-labelled sodium iodide is 90%. The unreacted active sodium iodide is separated and the resulting product is diluted and processed into a drug presentation, sterilized and after random control is distributed in 14 days intervals to medical workplaces. (M.D.)

  12. Radiation dosimetry from breast milk excretion of radioiodine and pertechnetate

    International Nuclear Information System (INIS)

    Hedrick, W.R.; Di Simone, R.N.; Keen, R.L.

    1986-01-01

    Measurements were made of the activity in samples of breast milk obtained from a patient with postpartum thyroiditis following administration of [ 123 I]sodium iodide and subsequently [99mTc]pertechnetate 24 hr later. Both 123 I and 99mTc were found to be excreted exponentially with an effective half-life of 5.8 hr and 2.8 hr, respectively. Less than 10% of the activity was incorporated into breast-milk protein. After administration of [ 123 I]sodium iodide breast feeding should be discontinued for 24-36 hr to reduce the absorbed dose to the child's thyroid

  13. Sup(123)I excretion in breast milk - additional data

    Energy Technology Data Exchange (ETDEWEB)

    Lawes, S.C. (Queen' s Medical Centre, Nottingham (United Kingdom))

    1992-07-01

    A woman with a suspected sublingual thyroid was referred for thyroid imaging with {sup 123}I-sodium iodide. On attending it was ascertained that she was currently breastfeeding her 3-month-old baby. Reference to the available literature showed little information regarding the excretion of {sup 123}I-sodium iodide in human breast milk apart from one single case. It was felt therefore that this would be an ideal opportunity to collect some useful data. Originally the presence of impurities in the radiopharmaceutical administered had been discounted as being of little significance. However, after consideration, a review of the contribution of any impurity was undertaken. (author).

  14. [Genetic aspects in congenital hypothyrodism].

    Science.gov (United States)

    Perone, Denise; Teixeira, Silvânia S; Clara, Sueli A; Santos, Daniela C dos; Nogueira, Célia R

    2004-02-01

    Congenital hypothyroidism (CH) affects between 1:3,000 and 1:4,000 newborns. Many genes are essential for normal development of the hypothalamus-pituitary-thyroid axis and hormone production, and are associated with CH. About 85% of primary hypothyroidism is called thyroid digenesis and evidence suggests that mutations in transcription factors (TTF2, TTF1, and PAX-8) and TSH receptor gene could be responsible for the disease. Genetic defects of hormone synthesis could be caused by mutations in the following genes: NIS (natrium-iodide symporter), pendrine, thyreoglobulin (TG), peroxidase (TPO). Recently, mutations in the THOX-2 gene have also been related to organification defects. Central hypothyroidism affects about 1:20,000 newborns and has been associated with mutations in pituitary transcriptional factors (POUIF1, PROP1, LHX3, and HESX1). The syndrome of resistance to thyroid hormone is rare, implies a hypothyroidism state for some tissues and is frequently associated with dominant autosomal mutations in the beta-receptor (TRss).

  15. Prothèses péniennes : taille du pénis implanté et dimensions de la virilité

    OpenAIRE

    Kempeneers, Philippe; Andrianne, Robert; Mormont, Christian; Jeanmart, Fabian; Blochousse, Laurence

    2001-01-01

    The implantation of a penile prosthesis frequently results in a reduction of the erectile length compared with natural erections. Some patients complain about this fact and their satisfaction at prosthesis assisted sexuality is significantly diminished. Obviously, the degree of complaint is not proportional to the objective degree of penile reduction. For an objective reality to lead to complaints, subjective criteria of appreciation have to intervene. A survey questionnaire completed ...

  16. Impact of Gender-Specific Human Papillomavirus Vaccine Recommendations on Uptake of Other Adolescent Vaccines: Analysis of the NIS-Teen (2008-2012).

    Science.gov (United States)

    Bednarczyk, Robert A; Orenstein, Walter A; Omer, Saad B

    In the United States, human papillomavirus vaccination was routinely recommended for adolescent females in 2006 and provisionally recommended for adolescent males in 2009. We evaluated the hypothesis that gender-specific human papillomavirus vaccination recommendations would impact gender-specific uptake of other vaccines using National Immunization Survey-Teen public use data sets (2008-2012). Female adolescents had higher coverage than males of at least 1 other adolescent vaccine in 2008 (3.0% higher) and 2009 (4.3% higher). Gender differences abated in 2010, 2011, and 2012 (0.2%, 0.9%, and 0.4%, respectively). To evaluate unintended consequences of gender-based recommendations, countries with female-only human papillomavirus vaccination recommendations should evaluate gender-specific uptake of other adolescent vaccines.

  17. Demixing in a metal halide lamp, results from modelling

    NARCIS (Netherlands)

    Beks, M.L.; Hartgers, A.; Mullen, van der J.J.A.M.

    2006-01-01

    Convection and diffusion in the discharge region of a metal halide lamp is studied using a computer model built with the plasma modeling package Plasimo. A model lamp contg. mercury and sodium iodide is studied. The effects of the total lamp pressure on the degree of segregation of the light

  18. EGS4, case study and tutor problem

    International Nuclear Information System (INIS)

    Gupta, S.K.

    2000-01-01

    Tutor problems having sub-directory of EGS4 code for electron transfer through medium like metal plate of tantalum, sodium iodides radiation detectors are discussed. Semi infinite slab of material is placed in a vacuum and a pencil beam of electrons or photons is incident at the origin travelling along the Z-axis is described

  19. Evaporation release behavior of volatile fission products from liquid sodium pool to the inert cover gas

    Energy Technology Data Exchange (ETDEWEB)

    Nakagiri, T; Miyahara, S [Oarai Engineering Center, Power Reactor and Nuclear Fuel Development Corp., Oaraimachi, Ibaraki (Japan)

    1996-12-01

    In fuel failure of sodium cooled fast breeder reactors, released volatile fission products (VFPs) such as iodine and cesium from the fuel will be dissolved into the liquid sodium coolant and transferred to the cover vaporization. In the cover gas system of the reactor, natural convection occurs due to temperature differences between the sodium pool and the gas phase. The release rates of VFPs together with sodium vaporization are considered to be controlled by the convection. In this study, three analytical models are developed and examined to calculate the transient release rates using the equilibrium partition coefficients of VFPs. The calculated release rates are compared with experimental results for sodium and sodium iodide. The release rate of sodium is closest to the calculation by the heterogeneous nucleation theory. The release rate of sodium iodide obtained from the experiment is between the release rates calculated by the model based on heat-and-mass transfer analogy and the Hill`s theory. From this study, it is confirmed that the realistic release rate of sodium is able to be calculated by the model based on the heterogeneous nucleation theory. The conservative release rate of sodium iodide is able to be calculated by the model based on the Hill`s theory using the equilibrium partition coefficient of sodium iodide. (author) 7 figs., 1 tab., 3 refs.

  20. Uterine radiation dose from open sources: The potential for underestimation

    International Nuclear Information System (INIS)

    Cox, P.H.; Klijn, J.G.M.; Pillay, M.; Bontebal, M.; Schoenfeld, D.H.W.

    1990-01-01

    Recent observations on the biodistribution of a therapeutic dose of sodium iodide I 131 in a patient with an unsuspected early pregnancy lead us to suspect that current dose estimates with respect to uterine exposure (ARSAC 1988) may seriously underestimate the actual exposure of the developing foetus. (orig.)

  1. Radiological evaluation of building materials used in Malumfashi ...

    African Journals Online (AJOL)

    ... in building materials (sand, cement, blocks, granite, and paints) used in the construction of buildings in Malumfashi local Government area of Katsina state, Nigeria were determined by means of a gamma-ray spectrometry system using Sodium Iodide thallium activated (NaI(Tl)) detector in a low background configuration.

  2. Assessment of radioactivity concentration in soil of some mining ...

    African Journals Online (AJOL)

    A study was conducted to determine 226Ra, 232Th, and 40K natural activity concentrations in surface soils/sediments of some mining areas in Central Nasarawa State Nigeria, using Sodium Iodide-Thallium Gamma Spectroscopy. Seven major sites were identified from the highly mining areas of the zone and a total of ...

  3. Assessment of Radioactivity Concentration in Soil of some Mining

    African Journals Online (AJOL)

    ABSTRACT. A study was conducted to determine 226Ra, 232Th, and 40K natural activity concentrations in surface soils/sediments of some mining areas in Central Nasarawa State Nigeria, using. Sodium Iodide-Thallium Gamma Spectroscopy. Seven major sites were identified from the highly mining areas of the zone.

  4. A model for additive transport in metal halide lamps containing mercury and dysprosium tri-iodide

    NARCIS (Netherlands)

    Beks, M.L.; Haverlag, M.; Mullen, van der J.J.A.M.

    2008-01-01

    The distribution of additives in a metal halide lamp is examined through numerical modelling. A model for a lamp containing sodium iodide additives has been modified to study a discharge containing dysprosium tri-iodide salts. To study the complex chemistry the method of Gibbs minimization is used

  5. Synthesis of [35]Adamanzane, 1,5,9,13-Tetraazabicyclo [7.7.3]nonadecane, by Oxidative C-N Cleavage of [36]Adamanzane, 1,5,9,13-Tetraazatricyclo[7.7.3.35,13]docosane and Crystal Structure of the Tetraprotonated Bromide Salt of [35]Adamanzane

    DEFF Research Database (Denmark)

    Springborg, Johan; Pretzmann, Ulla; Nielsen, Bente

    1998-01-01

    Reaction of the cage amine [36]adamanzane, 1,5,9,13-tetraazatricyclo-[7.7.3.35,13]docosane, with sodium iodide in 93% sulfuric acid affords the bicyclictetraamine [35]adamanzane, 1,5,9,13-tetraazabicyclo[7.7.3]nonadecane which was isolated as its tetraprotonated bromide salt, [H4[35]adz]Br4 (yield...

  6. Mandible osteoradionecrosis. Incidence and clinical evaluation of its therapy

    International Nuclear Information System (INIS)

    Biazolla, E.R.

    1989-01-01

    The incidence and the efficiency of mandible osteoradionecrosis in patients with oral neoplasms and submitted to radiotherapy were studied. The osteoradionecrosis incidence in mandible was 6,67%. The treatment with sodium iodide 2% and hydrogen peroxide 10 v was the best treatment for mandible osteoradionecrosis. (L.M.J.)

  7. Use of large sodium iodine detectors in precision π0 decay experiments

    International Nuclear Information System (INIS)

    Waltham, C.E.; Hasinoff, M.; Virtue, C.J.; Robertson, B.C.; Shor, A.; Chew, S.H.; Lowe, J.

    1987-01-01

    Three large sodium iodide detectors have been used to measure the π 0 electomagnetic form factor. The manner in which they were operated is described here with particular emphasis on optimizing energy resolution, measuring response functions and acceptance, and precise energy calibration. Neutron rejection by pulse shape discrimination was also investigated. (orig.)

  8. Plasma Levels of Advanced Glycation Endproducts N-is an element of-(carboxymethyl)lysine, N-is an element of-(carboxyethyl)lysine, and Pentosidine Are not Independently Associated With Cardiovascular Disease in Individuals With or Without Type 2 Diabetes: The Hoorn and CODAM Studies

    NARCIS (Netherlands)

    Hanssen, N.M.J.; Engelen, L.; Ferreira, I.; Scheijen, J.L.J.M.; Huijberts, M.S.; van Greevenbroek, M.M.J.; van der Kallen, C.J.H.; Dekker, J.M.; Nijpels, G.; Stehouwer, C.D.A.; Schalkwijk, C.G.

    2013-01-01

    Objective: Experimental and histological data suggest a role for advanced glycation end products (AGEs) in cardiovascular disease (CVD), particularly in type 2 diabetes (T2DM). However, the epidemiological evidence of an adverse association between AGEs and CVD remains inconclusive. We therefore

  9. Nutrition impact symptoms in advanced cancer patients: frequency and specific interventions, a case?control study

    OpenAIRE

    Omlin, Aurelius; Blum, David; Wierecky, Jan; Haile, Sarah R.; Ottery, Faith D.; Strasser, Florian

    2013-01-01

    Background Involuntary weight loss (IWL) is frequent in advanced cancer patients causing compromised anticancer treatment outcomes and function. Cancer cachexia is influenced by nutrition impact symptoms (NIS). The aim of this study was to explore the frequency of NIS in advanced patients and to assess specific interventions guided by a 12-item NIS checklist. Methods Consecutive patients from an outpatient nutrition-fatigue clinic completed the NIS checklist. The NIS checklist was developed b...

  10. The C-terminal tetrapeptide HWFW of the Chlorella HUP1 hexose/H+-symporter is essential for full activity and an alpha-helical structure of the C-terminus

    Czech Academy of Sciences Publication Activity Database

    Graál, R.; Robl, I.; Opekarová, Miroslava; Tanner, W.

    2000-01-01

    Roč. 468, - (2000), s. 225-230 ISSN 0014-5793 R&D Projects: GA ČR GA204/99/0492 Grant - others:Deutsche Forschungsgemeinschaft(DE) SFB521; NATO Collaborative Research Grant(NQ) LST.CLG974804 Institutional research plan: CEZ:A53/98:Z5-020-9ii Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.440, year: 2000

  11. Kinetics of isotopic exchanges by using radioactive indicators

    International Nuclear Information System (INIS)

    May, S.

    1958-12-01

    After having noticed that iodine 131 under the form of sodium iodide has always been used as radioactive indicator in the CEA atomic pile located in Chatillon, this research report recalls the counting technique and some historical aspects of the notion of isotopic exchange and qualitative works, and presents some generalities on isotopic exchanges (reactions and calculation of rate constants of order 1 and 2, calculation of activation energy, spectro-photometric studies, Walden inversion, alkaline hydrolysis, influence of solvent on exchange kinetics, influence of the nature of the mineral halide). The author then addresses exchanges in aliphatic series (exchange with sodium iodide and with molecular iodine), exchanges in olefin series, exchanges in alicyclic series, and exchanges in aromatic series

  12. Simultaneous and separate, low background counting of beta rays and gamma rays using the phoswich principle

    International Nuclear Information System (INIS)

    Mayhugh, M.R.; Utts, B.K.; Shoffner, B.M.

    1978-01-01

    A phoswich constructed using thin calcium fluoride optically coupled to a thicker sodium iodide crystal and operated with pulse shape analysis equipment can be used as an efficient low background counting assembly. Low background in the beta ray counting channel is achieved by judicious choice of pure materials in the assembly and by operating the analysis equipment so as to reject background events which occur simultaneously in the sodium iodide crystal. Careful survey of construction materials and methods has resulted in reducing beta ray counting background to 0.6 c/min for a 2-inch diameter assembly. The radioactivity of typical building materials will be discussed. A pulse shape analyzer has been constructed which provides separately adjusted time windows and separate output information for the beta ray and gamma ray channels. The dual channel capability combined with the low beta ray background reduces the sample counting time significantly for typical laboratory samples. (author)

  13. Radiation Dose Assessments for Shore-Based Individuals in Operation Tomodachi

    Science.gov (United States)

    2012-09-30

    Ministry of Education, Culture, Sports , Science, and Technology (MEXT) were used to fill those gaps to provide full coverage for every day during the 60... Sports , Science, and Technology [MEXT]). This order of precedence (DOD, DOE, Japanese sources) recognizes that DOD data were collected on DOD... doped , sodium iodide [NaI(Tl)] detectors for air kerma (µGy) measurements. Gamma photon energies over 3 MeV were excluded. The NaI(Tl) detectors were

  14. Radiation Dose Assessments for Shore-Based Individuals in Operation Tomodachi, Revision 1

    Science.gov (United States)

    2012-12-31

    contained data gaps, measurements from GOJ’s Ministry of Education, Culture, Sports , Science, and Technology (MEXT) were used to fill those gaps to provide...Education, Culture, Sports , Science, and Technology [MEXT]). This order of precedence (DOD, DOE, Japanese sources) recognizes that DOD data were...dose monitoring stations contained energy- compensated, thallium- doped , sodium iodide [NaI(Tl)] detectors for air kerma (µGy) measurements. Gamma photon

  15. Determination of iodide with 1,3-dibromo-5,5-dimethylhydantoin (DBH) in comparison with the ICl-method. Analytical methods of pharmacopeias with DBH in respect to environmental and economical concern. Part 3.

    Science.gov (United States)

    Hilp, M; Senjuk, S

    2001-06-01

    USP 1995 (The United States Pharmacopeia, 23rd Edit., (1995), potassium iodide p. 1265, sodium iodide p. 1424), PH. EUR. 1997 (European Pharmacopoeia, third ed., Council of Europe, Strasbourg, (1997), potassium iodide p. 1367, sodium iodide p. 1493) and JAP 1996 (The Japanes Pharmacopoeia, 13th ed. (1996), potassium iodide p. 578, sodium iodide p. 630) determine iodide with the ICl-method (J. Am. Chem. Soc. 25 (1903) 756-761; Z. Anorg. Chem. 36 (1903) 76-83; Fresenius Z. Anal. Chem. 106 (1936) 12-23; Arzneibuch-Kommentar, Wissenschaftliche Erläuterungen zum Europäischen Arzneibuch, Wissenschaftliche Verlagsgesellschaft mbH, Stuttgart, Govi-Verlag - Pharmazeutischer Verlag GmbH, Eschborn, 12th suppl. (1999), K10 p. 2), using chloroform, which is toxic and hazardous to environment. Without the application of chlorinated hydrocarbons USP 2000 (The United State Pharmacopeia, 24th ed. (2000), potassium iodide p. 1368, sodium iodide p. 1535) and Brit 1999 (British Pharmacopoeia London, (1999), Appendix VIII C, p. A162) titrate iodide with the redox indicator amaranth. A titration with potentiometric indication giving two end-points at the step of I(2) and [ICl(2)](-) is described. Due to the high concentration of hydrochloric acid required for the ICl-method, the determination with DBH (1,3-dibromo-5,5-dimethylhydantoin; 1,3-dibromo-5,5-dimethyl-2,4-imidazolidinedione) can be recommended and is performed easily. Similarly, the iodide content of gallamine triethiodide may be analyzed with DBH by application of a visual two-phase titration in water and ethyl acetate or with potentiometric indication in a mixture of 2-propanol and water. During the removal of the excess of DBH 4-bromo-triethylgallamine (2,2',2"-[1-bromo-benzene-2,3,4-triyltris(oxy)]N,N,N-triethylethanium) is formed.

  16. Production of high specific activity 123I for protein iodination for medical use

    International Nuclear Information System (INIS)

    Legoux, Y.; Cieur, M.; Crouzel, C.; Syrota, A.

    1985-01-01

    Iodine-123 is produced via xenon-133 by irradiation of a sodium iodide target with 108 MeV deuterons from the synchrocyclotron of IPN. The on-line production method is described. The specific activity of the iodine is determined by neutron activation analysis and by a radioimmunological method. The conditions labelling different proteins (insulin, angiotensin) are given and also the purification method to obtain a product ready for injection to patients. (author)

  17. Aerial radiological survey of the Argonne National Laboratory and surrounding area, Argonne, Illinois. Date of survey: May 1977

    International Nuclear Information System (INIS)

    1982-12-01

    An aerial radiological survey was conducted over the facilities of the Argonne National Laboratory in Argonne, Illinois, on 2 to 13 May 1977. The survey was flown at an altitude of 46 m by a helicopter containing 20 sodium iodide detectors. The line spacing was also 46 m. Enhanced gamma exposure rate levels, which could be attributed to Argonne operations, were observed at many locations

  18. The method of obtaining of sodium orthoiodohippurate labelled with iodine-131

    International Nuclear Information System (INIS)

    Aripov, D.; Abdukayumov, M.; Shukurov, A.Sh.

    1994-01-01

    The method of labelling of sodium orthoiodohippurate was elaborated with the purpose of increasing the preparation quality. Method includes the reaction of isotopic exchange between orthoiodhippur acid and sodium iodide solution labelled with iodine-131 with volume activity 150-200 mCu/mL and pH=6,5-7,0. Reaction occurs at temperature 120-130 C during 1,1-1,3 hours and the compound obtained is dissolved in 1% sodium bicarbonate solution. (author)

  19. Aerial radiological survey of the Fermi National accelerator Laboratory and surrounding area, Batavia, Illinois. Data of survey: 12-14 May 1977

    International Nuclear Information System (INIS)

    Jobst, J.E.

    1981-01-01

    An aerial radiological survey was conducted over the facilities of the Fermi National Accelerator Laboratory (Fermilab) near Batavia, Illinois on 12-14 May 1977. The survey was flown at an altitude of 91 m by a helicopter containing 20 sodium iodide detectors. The line spacing was also 91 m. Enhanced gamma exposure rate levels, which could be attributed to Fermilab operations, were observed at seven locations. One additional anomaly, not related to the Laboratory, was also discovered

  20. Labeling and quality control of 123I-MIBG

    International Nuclear Information System (INIS)

    Figols de Barboza, Marycel Rosa

    2002-01-01

    This report describes a method to facilitate routine production of 123 I-MIBG in Radiopharmacy Centre of IPEN-CNEN/SP. Iodine-123 radioisotope is produced in the form of sodium iodide in Cyclone-30 (IBA) at IPEN-CNEN/SP through proton irradiation of gaseous 124 Xe target. The labelling procedure uses MIBG-sulphate and leads to 123 I-MIBG with radiochemical purity at least 98% and specific activity of 300-380 MBq/mg

  1. Elaboration and test of the method of separation of alkaline metals ions with tin phosphate

    International Nuclear Information System (INIS)

    Smirnov, G.I.; Chernyak, A.S.; Kostromina, O.N.; Kachur, N.Ya.; Shpeyzer, B.G.

    1986-01-01

    Present work is devoted to elaboration and test of the method of separation of alkaline metals ions with tin phosphate. Thus, the isotherms of sorption of lithium, sodium, potassium, rubidium and cesium ions with amorphous tin phosphate depending on their concentration, ph of solution, sorbent quantity are obtained. The parameters of extraction of potassium microquantities from sodium salts are defined. Ultra pure sodium chloride, sodium iodide, sodium sulphate, sodium nitrate, sodium nitrite, sodium phosphate are synthesized.

  2. Internal contamination of nurses as a result of the therapeutic use of iodine-131

    Energy Technology Data Exchange (ETDEWEB)

    Termorshuizen, W; Gerritsen, A J.M.

    1988-02-01

    The internal contamination of nurses with sodium iodide-131 is studied in two different housing situations. Before moving, the therapy unit was an unventilated double room with a lock. In the new building, the unit consists of three single rooms and one double room with a lock and air conditioning. Also the concentration of iodine-131 in the air is measured. 2 figs.; 1 table.

  3. Production of high specific activity /sup 123/I for protein iodination for medical use

    Energy Technology Data Exchange (ETDEWEB)

    Legoux, Y; Cieur, M [Paris-11 Univ., 91 - Orsay (France). Inst. de Physique Nucleaire; Goutheraud, R; Drouet, J [Centre National de Transfusion Sanguine, 75 - Paris (France); Crouzel, C; Syrota, A [CEA, 91 - Orsay (France). Service Hospitalier Frederic Joliot

    1985-01-01

    Iodine-123 is produced via xenon-133 by irradiation of a sodium iodide target with 108 MeV deuterons from the synchrocyclotron of IPN. The on-line production method is described. The specific activity of the iodine is determined by neutron activation analysis and by a radioimmunological method. The conditions labelling different proteins (insulin, angiotensin) are given and also the purification method to obtain a product ready for injection to patients.

  4. Composantes psychologiques des plaintes relatives à la taille du pénis après implantation d'une prothèse pénienne

    OpenAIRE

    Kempeneers, Philippe; Andrianne, Robert; Mormont, Christian; Jeanmart, F.

    2004-01-01

    A survey questionnaire completed by 39 users of penile prosthesis shows that complaints related to the size of the implanted penis involve a decrease in satisfaction towards the prosthetic device. However, a reduced penile size is not necessary considered as a problem by all patients. Beyond functional considerations, the disappointment concerning the length of the penis is mostly related to the representation of a virility debased by the notions of artifice and assistance which are ass...

  5. AVALIAÇÃO DOS GÂNGLIOS REGIONAIS NO CARCINOMA EPIDERMÓIDE DO PÊNIS (CEP ATRAVÉS DE UM ÍNDICE DE RISCO

    Directory of Open Access Journals (Sweden)

    Cologna A. J.

    2001-01-01

    Full Text Available O objetivo desse estudo foi investigar a validade de um índice de risco (IR no prognóstico de metástases ganglionares no carcinoma epidermóide do pênis (CEP. Foram analisados 53 pacientes com CEP atendidos no Hospital das Clínicas da FMRP-USP, de janeiro de 1978 a dezembro de 1995. A idade variou de 32 a 97 anos. Os tumores foram graduados de acordo com a classificação de Broders e estadiados retrospectivamente (TNM 1999. O IR foi determinado pela soma de TeG (IR = T+G. A linfadenectomia inguinal bilateral (LD foi indicada naqueles que apresentaram gânglios suspeitos após a antibioticoterapia ou que vieram apresentar alterações durante o período de observação. Faleceram 17 pacientes; A LD foi realizada em 14 pacientes e os 39 restantes permaneceram em observação clínica, sendo que em 8 deles foi feito LD após tempo mediano de 9 meses. Dos pacientes com índice de risco 2 e 3 92% e 80% respectivamente não apresentavam metastase ganglionar, ao passo que a totalidade daqueles com IR=6 tinha gânglios comprometidos. A associação dos grupos 2 e 3, comparada ao conjunto 4, 5 e 6, mostrou percentual maior de comprometimento nestes últimos (p = 0,0046. Dos 36 pacientes inicialmente No, 27 apresentavam IR 2 ou 3, dos quais 5 evoluíram para N+ (19%; os 9 restantes eram IR > 4 e 3 também evoluíram para N+ (33%. Apesar da diferença, não houve significância estatística entre eles (p = 0,3837. Embora tenha ocorrido maior comprometimento naqueles com IR > 4, o índice de risco não foi capaz de identificar previamente pacientes que evoluíram para N+.

  6. Infrastructure design & road safety : OECD Workshop B3 (Infrastructure design and road safety) for CEE's and NIS held on 15th-18th November 1994, Prague (Czech Republic). Part 2: Lectures.

    NARCIS (Netherlands)

    2012-01-01

    The workshop 'Infrastructure design and road safety ' was one of the initiatives which the OECO Steering Committee for Road Transport Research developed with the aim of exchanging information in the road transport sector, in order to respond to the urgent needs expressed by Central and Eastern

  7. Role of commercial harbours and recreational marinas in the spread of non-indigenous fouling species.

    Science.gov (United States)

    Ferrario, Jasmine; Caronni, Sarah; Occhipinti-Ambrogi, Anna; Marchini, Agnese

    2017-09-01

    The role of commercial harbours as sink and source habitats for non-indigenous species (NIS) and the role of recreational boating for their secondary spread were investigated by analysing the fouling community of five Italian harbours and five marinas in the western Mediterranean Sea. It was first hypothesised that NIS assemblages in the recreational marinas were subsets of those occurring in commercial harbours. However, the data did not consistently support this hypothesis: the NIS pools of some marinas significantly diverged from harbours even belonging to the same coastal stretches, including NIS occurring only in marinas. This study confirms harbours as hotspots for marine NIS, but also reveals that numbers of NIS in some marinas is higher than expected, suggesting that recreational vessels effectively facilitate NIS spread. It is recommended that this vector of NIS introduction is taken into account in the future planning of sustainable development of maritime tourism in Europe.

  8. Andragogy as a didactic perspective in the attitudes of nurse instructors in Finland.

    Science.gov (United States)

    Janhonen, S

    1991-08-01

    In this article the didactic perspectives of nurse instructors (NIs) is examined with the help of andragogy defined by the concepts of self-directed learning, learning as a process and lifelong learning. The results of a pilot study of ongoing research on the educational perspective of NIs, are used as examples to discuss how far NIs have accepted the features of andragogy as their didactic perspective both in their public stance and in their actions as described by NIs themselves.

  9. Zn2+ modulation of neurotransmitter transporters

    DEFF Research Database (Denmark)

    Nørgaard-Nielsen, K.; Gether, U.

    2006-01-01

    of neurotransmitter transporters have been identified based on sequence homology: (1) the neurotransmitter sodium symporter family (NSS), which includes the Na+/C1(-)-dependent transporters for dopamine, norepinephrine, and serotonin; and (2) the dicarboxylate/amino acid cation symporter family (DAACS), which...

  10. NCBI nr-aa BLAST: CBRC-CREM-01-1344 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CREM-01-1344 ref|ZP_01513006.1| sodium:dicarboxylate symporter [Burkholderia phytofirm...ans PsJN] gb|EAV02321.1| sodium:dicarboxylate symporter [Burkholderia phytofirmans PsJN] ZP_01513006.1 4e-73 66% ...

  11. NCBI nr-aa BLAST: CBRC-DDIS-01-0039 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-01-0039 ref|YP_928285.1| proton/peptide symporter family protein [Shewanella amazon...ensis SB2B] gb|ABM00616.1| proton/peptide symporter family protein [Shewanella amazonensis SB2B] YP_928285.1 2e-29 28% ...

  12. NCBI nr-aa BLAST: CBRC-XTRO-01-0098 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-0098 ref|NP_522097.1| PROBABLE SUGAR-PROTON SYMPORTER TRANSMEMBRANE PR...OTEIN [Ralstonia solanacearum GMI1000] emb|CAD17687.1| probable sugar-proton symporter transmembrane protein [Ralstonia solanacearum] NP_522097.1 0.38 30% ...

  13. NCBI nr-aa BLAST: CBRC-PMAR-01-0648 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0648 ref|ZP_00741686.1| Sodium/pantothenate symporter [Bacillus thuringiensis serovar israel...ensis ATCC 35646] gb|EAO54033.1| Sodium/pantothenate symporter [Bacillus thuringiensis serovar israelensis ATCC 35646] ZP_00741686.1 0.14 31% ...

  14. NCBI nr-aa BLAST: CBRC-MDOM-01-0280 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MDOM-01-0280 ref|ZP_01754765.1| sodium:galactoside symporter family protein [Rose...obacter sp. SK209-2-6] gb|EBA16396.1| sodium:galactoside symporter family protein [Roseobacter sp. SK209-2-6] ZP_01754765.1 1.3 26% ...

  15. Treatment response in oncology

    International Nuclear Information System (INIS)

    Pandit-Taskar, Neeta; Batraki, Maria; Divgi, Chaitanya

    2004-01-01

    Full text: Currently, the evaluation of response to therapy in Oncology consists of determination of changes in size of lesions measurable by structural imaging, notably computerized tomography. These criteria, formalized using RECIST (Response Evaluation Criteria in Solid Tumors), are the current standard for evaluation (http://www3.cancer. gov/dip/RECIST.htm). An increasing body of evidence suggests that functional changes in tumors precede structural changes, and that methodologies that measure such changes may be able to evaluate the potential of therapy, allowing for better and earlier selection of these potentially cytotoxic therapies. Nuclear Medicine imaging is distinguished by its ability to determine functional characteristics. These include: 1. Receptor status - for example, the presence of sodium iodide symporters detected by radioiodine or pertechnetate imaging, the presence of somatostatin or norepinephrine receptors by pentetreotide or metaiodobenzylguanidine (mIBG) imaging respectively. Such imaging can help guide appropriate therapies with iodine-131, somatostatin analogues (radiolabeled or otherwise) or iodine-131 labeled mIBG. 2. Metabolic status - for example, glycolytic status (with fluorine-18 labeled fluorodeoxyglucose); amino acid metabolism (e.g. using carbon-11 labeled methionine), or tumor proliferation (using radiolabeled thymidine or deoxyuridine). These methods have advantages over structural imaging because in the vast majority of tumors, changes in the functional or molecular status of tumors are seen earlier than are structural changes. 3. Overall cellular status - these imaging agents are still in their early development but hold great promise for the determination of cellular viability. Annexin imaging is the archetype of such imaging modalities that predict the overall fate of the cell, in this instance its entry into the apoptotic pathway. This review will highlight the uses of functional imaging using radiotracers in all three

  16. Nutrition impact symptoms in advanced cancer patients: frequency and specific interventions, a case-control study.

    Science.gov (United States)

    Omlin, Aurelius; Blum, David; Wierecky, Jan; Haile, Sarah R; Ottery, Faith D; Strasser, Florian

    2013-03-01

    Involuntary weight loss (IWL) is frequent in advanced cancer patients causing compromised anticancer treatment outcomes and function. Cancer cachexia is influenced by nutrition impact symptoms (NIS). The aim of this study was to explore the frequency of NIS in advanced patients and to assess specific interventions guided by a 12-item NIS checklist. Consecutive patients from an outpatient nutrition-fatigue clinic completed the NIS checklist. The NIS checklist was developed based on literature review and multiprofessional clinical expert consensus. Chart review was performed to detect defined NIS typical interventions. Oncology outpatients not seen in the nutrition-fatigue clinic were matched for age, sex, and tumor to serve as controls. In 52 nutrition-fatigue clinic patients, a mixed cancer population [IWL in 2 months 5.96 % (mean)], the five most frequent NIS were taste and smell alterations 27 %, constipation 19 %, abdominal pain 14 %, dysphagia 12 %, and epigastric pain 10 %. A statistically significant difference for NIS typical interventions in patients with taste and smell alterations (p = 0.04), constipation (p = 0.01), pain (p = 0.0001), and fatigue (p = 0.0004) were found compared to the control population [mixed cancer, 3.53 % IWL in 2 months (mean)]. NIS are common in advanced cancer patients. The NIS checklist can guide therapeutic nutrition-targeted interventions. The awareness for NIS will likely evoke more research in assessment, impact, and treatment.

  17. Optimising measles virus-guided radiovirotherapy with external beam radiotherapy and specific checkpoint kinase 1 inhibition

    International Nuclear Information System (INIS)

    Touchefeu, Yann; Khan, Aadil A.; Borst, Gerben; Zaidi, Shane H.; McLaughlin, Martin; Roulstone, Victoria; Mansfield, David; Kyula, Joan; Pencavel, Tim; Karapanagiotou, Eleni M.; Clayton, Jamie; Federspiel, Mark J.; Russell, Steve J.; Garrett, Michelle; Collins, Ian; Harrington, Kevin J.

    2013-01-01

    Background and purpose: We previously reported a therapeutic strategy comprising replication-defective NIS-expressing adenovirus combined with radioiodide, external beam radiotherapy (EBRT) and DNA repair inhibition. We have now evaluated NIS-expressing oncolytic measles virus (MV-NIS) combined with NIS-guided radioiodide, EBRT and specific checkpoint kinase 1 (Chk1) inhibition in head and neck and colorectal models. Materials and methods: Anti-proliferative/cytotoxic effects of individual agents and their combinations were measured by MTS, clonogenic and Western analysis. Viral gene expression was measured by radioisotope uptake and replication by one-step growth curves. Potential synergistic interactions were tested in vitro by Bliss independence analysis and in in vivo therapeutic studies. Results: EBRT and MV-NIS were synergistic in vitro. Furthermore, EBRT increased NIS expression in infected cells. SAR-020106 was synergistic with EBRT, but also with MV-NIS in HN5 cells. MV-NIS mediated 131 I-induced cytotoxicity in HN5 and HCT116 cells and, in the latter, this was enhanced by SAR-020106. In vivo studies confirmed that MV-NIS, EBRT and Chk1 inhibition were effective in HCT116 xenografts. The quadruplet regimen of MV-NIS, virally-directed 131 I, EBRT and SAR-020106 had significant anti-tumour activity in HCT116 xenografts. Conclusion: This study strongly supports translational and clinical research on MV-NIS combined with radiation therapy and radiosensitising agents

  18. National Innovation System And Culture A Cross-Country Analysis

    Directory of Open Access Journals (Sweden)

    Joseph Gogodze

    2015-08-01

    Full Text Available This study assesses the relationship between Hofstedes cultural dimensions and the constituents of a National Innovation System NIS. We consider an NIS as a special kind of intangible latent asset and identify its two constituents input and output capital. These are extracted through a modern NIS measurement model based on the Global Innovation Index. Using structural equation models we show that power distance and uncertainty avoidance and long-term orientation and indulgence vs. restraint act through the latent constructs PDUA and LTIV respectively. Moreover individualism IDV and NIS constituents are directly and negatively affected by PDUA. IDV and LTIV directly and positively affect the NIS constituents. Further the results show that masculinity vs. femininity significantly and negatively affects the NIS input constituent and significantly affects the NIS output constituent but its impact is negative for high-income countries and positive for non-high income countries.

  19. Nuclear-plus-interference-scattering effect on the energy deposition of multi-MeV protons in a dense Be plasma.

    Science.gov (United States)

    Wang, Zhigang; Fu, Zhenguo; He, Bin; Hu, Zehua; Zhang, Ping

    2016-09-01

    The nuclear plus interference scattering (NIS) effect on the stopping power of hot dense beryllium (Be) plasma for multi-MeV protons is theoretically investigated by using the generalized Brown-Preston-Singleton (BPS) model, in which a NIS term is taken into account. The analytical formula of the NIS term is detailedly derived. By using this formula, the density and temperature dependence of the NIS effect is numerically studied, and the results show that the NIS effect becomes more and more important with increasing the plasma temperature or density. Different from the cases of protons traveling through the deuterium-tritium plasmas, for a Be plasma, a prominent oscillation valley structure is observed in the NIS term when the proton's energy is close to E_{p}=7MeV. Furthermore, the penetration distance is remarkably reduced when the NIS term is considered.

  20. Production of gaseous radiotracers CH3I and I2 through Na123I salt

    International Nuclear Information System (INIS)

    Candeiro, R.E.M.; Pereira, W.P.

    2011-01-01

    The objective of the present work was to develop, separately, methodology for production of two gaseous tracers through the sodium iodide NaI marked with 123 I. Found in the nature in form different, the iodine has been used in diverse works in the area of the industry and health. These two forms of the gaseous iodine, the methyl iodide, CH 3 I, and molecular iodine, I 2 , are very unstable and volatile in the ambient temperature and presents different problems in clean-up and monitoring systems. The syntheses were processed with sodium iodide (NaI) 1M aqueous solution marked with 1 23I . The production of gas I 2 was realized with in chlorine acid (HCl) and sodium iodate salt (NaIO 3 ) and the CH 3 I was used, the salt of NaI and the reagent (CH 3 ) 2 SO 4 . The production of gases was initially realized through in unit in glass with an inert material and the purpose was to study the kinetic of reaction and to determine the efficiency of production. The two synthesis occurs in the reaction bottle and after of produced, the gas is stored in the collect bottle that contains a starch solution for fixed the I 2 , and in syntheses of CH 3 I contains a silver nitrate solution for your fixation. To determine the efficiency of production of gases, analytic tests were realized, where the consumption of iodide ions of the bottle of reaction are measured. The optimization of production of the each gaseous tracer was studied varying parameter as: concentration of iodide, concentration of acid and temperature. After, the syntheses of the radiotracers were realized in the compact unit, having been used as main reagent the salt radiated of sodium iodide, Na 123 I. The transportation of elementary iodine and methyl iodine was studied by a scintillation detector NaI (2 x 2)' positioned in the reaction bottle. (author)

  1. Autoradiolytic decomposition and reductant-free sodium sup 124 I- and sup 123 I-iodide

    Energy Technology Data Exchange (ETDEWEB)

    Sajjad, M.; Lambrecht, R.M.; Bakr, S.A. (King Faisal Specialist Hospital and Research Centre, Riyadh (Saudi Arabia). Radionuclide and Cyclotron Operations)

    1990-01-01

    The presence of salts and metal cations in {sup 124}I- and {sup 123}I-sodium iodide solutions separated from {sup 124}Te targets promots autoradiolytic decomposition of iodide to several different iodine species dependent upon the chemical environment. The stabilization of the radioiodine as iodide by removal of trace salts and trace metal cations and in the absence of reducing agents is described. The high specific activity {sup 123}I- and {sup 124}I-iodide is suitable for labeling antibodies, proteins and radiopharmaceuticals. (orig.).

  2. Nuclear assay of coal. Volume 1. Coal composition by prompt neutron activation analysis: basic experiments. Final report

    International Nuclear Information System (INIS)

    Reynolds, G.; Bozorganesh, H.; Elias, E.; Gozani, T.; Maung, T.; Orphan, V.

    1979-01-01

    Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium--iodide and germanium--lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully be traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses

  3. Panel on accelerators and detectors in the 1950s

    International Nuclear Information System (INIS)

    Jones, L.W.; Amaldi, U.; Hofstadter, R.; Kerst, D.W.; Wilson, R.R.

    1989-01-01

    The article takes the form of a panel of famous particle physics scientists discussing accelerator design and detectors used in the 1950s. The discussion ranges over accelerator energy capacities, the invention of alternating-gradient focusing, and colliding beam machines, beam stacking and the application of digital computers to accelerator calculations. The development of particle beams using strong-focusing lenses and electrostatic separators rounded off the decade. Detectors moved from bubble chambers, the use of plastic and inorganic scintillators, to hadron calorimeters, Cherenkov counters and finally spark chambers. Various discoveries made using sodium iodide scintillation counters are noted. (UK)

  4. Accurate and simple measurement method of complex decay schemes radionuclide activity

    International Nuclear Information System (INIS)

    Legrand, J.; Clement, C.; Bac, C.

    1975-01-01

    A simple method for the measurement of the activity is described. It consists of using a well-type sodium iodide crystal whose efficiency mith monoenergetic photon rays has been computed or measured. For each radionuclide with a complex decay scheme a total efficiency is computed; it is shown that the efficiency is very high, near 100%. The associated incertainty is low, in spite of the important uncertainties on the different parameters used in the computation. The method has been applied to the measurement of the 152 Eu primary reference [fr

  5. 65Zn and 133Ba standardizing by photon-photon coincidence counting

    Science.gov (United States)

    Loureiro, Jamir S.; da Cruz, Paulo A. L.; Iwahara, Akira; Delgado, José U.; Lopes, Ricardo T.

    2018-03-01

    The LNMRI/Brazil has deployed a system using X-gamma coincidence technique for the standardizing radionuclide, which present simple and complex decay scheme with X-rays of energy below 100 keV. The work was carried on radionuclide metrology laboratory using a sodium iodide detector, for gamma photons, in combination with a high purity germanium detector for X-rays. Samples of 65Zn and 133Ba were standardized and the results for both radionuclides showed good precision and accuracy when compared with reference values. The standardization differences were 0.72 % for 65Zn and 0.48 % for 133Ba samples.

  6. 6. Radiopharmaceuticals

    International Nuclear Information System (INIS)

    Schiller, P.; Havranek, E.; Majer, J.

    1981-01-01

    Radionuclides commonly used in medicine are surveyed and their nuclear characteristics are presented. The methods are given of their preparation, most frequent use and detection. The list is given of radiopharmaceuticals included in the Czechoslovak Pharmacopoeia CsL 3 , ie., sodium chromate( 51 Cr), sodium iodide( 131 I), hippuran( 131 I), sodium phosphate( 32 P), colloidal gold( 198 Au), rose bengal sodium salt( 131 I), and sodium pertechnetate(sup(99m)Tc) injections. Characteristics, chemical preparation, identification tests, packaging, storage, application and dosage are shown for each preparation. Also listed are important unofficial radiopharmaceuticals, their main characteristics and data on their preparation and application. (B.S.)

  7. 27 CFR 21.151 - List of denaturants authorized for denatured spirits.

    Science.gov (United States)

    2010-04-01

    ..., liquid S.D.A. 36. Cedar leaf oil, U.S.P.XIII S.D.A. 38-B. Chloroform S.D.A. 20. Chlorothymol, N.F.XII S.D... (Glycerol), U.S.P S.D.A. 31-A. Green soap, U.S.P S.D.A. 27-B. Guaiacol, N.F.X S.D.A. 38-B. Heptane C.D.A. 18...) S.D.A. 45. Soap, hard, N.F.XI S.D.A. 31-A. Sodium iodide, U.S.P S.D.A. 25, 25-A. Sodium, metallic S...

  8. A Compton Suppressed Gamma Ray Counter For Radio Assay of Materials

    Science.gov (United States)

    Godfrey, Benjamin

    2016-03-01

    Rare event searches, such as direct dark matter experiments, require materials with ultra-low levels of natural radioactivity. We present a neutron activation analysis (NAA) technique for assaying metals, specifically titanium used for cryostat construction. Earlier attempts at NAA encountered limitations due to bulk activation via (n, p) reactions, which contributed to large continuum backgrounds due to Compton tails. Our method involves a heavy water shielded exposure to minimize (n,p) reactions and a sodium iodide shielded high purity germanium counter for the gamma ray assay. Preliminary results on assays for U/Th/K contamination in titaniumwill be presented.

  9. The assessment of iodine-in-milk levels in bulk milk supplies following a reactor accident

    International Nuclear Information System (INIS)

    Davis, R.E.

    1961-10-01

    The suitability of some readily available, portable, beta-gamma measuring instruments has been assessed for field use in monitoring bulk supplies of milk, contained in standard 10 gallon cans, contaminated with Iodine-131 in the range 400 μμc/litre to 325 mμc/litre. The Jefferson probe scintillation detector, employing a 1 1/2 inch diameter by 1 inch thick sodium iodide crystal, used in conjunction with a 1320c rate-meter was shown to be the most satisfactory. Air hazard and decontamination problems were also evaluated. (author)

  10. Synthesis of 17α-[(E)-2-[125I]iodoethenyl]androsta-4-6-dien-17β-o l-3-one, an active -site-directed photoaffinity radiolabel for androgen-binding proteins

    International Nuclear Information System (INIS)

    Diaz Cruz, P.J.; Smith, H.E.; Vanderbilt Univ., Nashville, TN; Danzo, B.J.; Clanton, J.A.; Mason, N.S.

    1993-01-01

    The active-site-directed photoaffinity radiolabel for androgen-binding proteins, 17α-[(E)-2-[ 125 I]iodoethenyl]androsta-4,6-dien-17β-ol-3-one, was prepared by reaction of 17α-[(E)-2-tributyltin(IV)ethenyl]androsta-4,6-dien-17β-ol-3-one with carrier added sodium iodide-125 in the presence of hydrogen peroxide and acetic acid. Purification by HPLC gave the radiolabeled steroid in 52% radiochemical yield with a specific activity of 27 Ci/mmol and 100% radiochemical purity. (author)

  11. Grooved windows for scintillation crystals and light pipes of high refractive index

    International Nuclear Information System (INIS)

    Swinehart, C.F.

    1975-01-01

    Scintillation crystals are disclosed which have improved resolution and pulse height. An improved crystal has shallow grooves or spot depressions cut in the window, usually an end surface. Typical grooves are about 1.5 mm wide and about .1 mm deep. The grooves may be either horizontal, generally parallel grooves in spaced apart relationship, or concentric rings in radially spaced apart relationship. A light pipe of high refractive index, such as a crystal of pure sodium iodide, may also be improved with shallow grooves or spot depressions cut in an end surface

  12. 65Zn and 133Ba standardizing by photon-photon coincidence counting

    International Nuclear Information System (INIS)

    Loureiro, Jamir S.; Cruz, Paulo A.L. da; Iwahara, Akira; Delgado, José U.; Lopes, Ricardo T.

    2017-01-01

    The LNMRI/Brazil has deployed a system using X-gamma coincidence technique for the standardizing radionuclide, which present simple and complex decay scheme with X-rays of energy below 100 keV. The work was carried on radionuclide metrology laboratory using a sodium iodide detector, for gamma photons, in combination with a high purity germanium detector for X-rays. Samples of 65 Zn and 133 Ba were standardized and the results for both radionuclides showed good precision and accuracy when compared with reference values. The standardization differences were 0.72 % for 65 Zn and 0.48 % for 133 Ba samples. (author)

  13. Synthesis and biodistribution of 2-[123I]iodomelatonin in normal mice

    International Nuclear Information System (INIS)

    Al-Jammaz, I.; Al-Otaibi, B.; Aboul-Enein, H.; Amartey, J.K.

    2006-01-01

    Melatonin demands that this hormone and its receptors be well understood. With this aim in mind, synthetic melatonin was radioiodinated with no-carrier-added (n.c.a.) sodium iodide-123 using in situ generated peracetic acid as oxidizing agent for electrophilic iodination at room temperature. The radiochemical yield was typically greater than 80% after 20 min reaction time especially when relatively small amounts of activities were used (10 mCi). Biological evaluation was performed in normal mice. The distribution of the tracer did not reveal any specificity during the time frame studied. There was no significant retention in the whole brain

  14. Synthesis and biodistribution of 2-[{sup 123}I]iodomelatonin in normal mice

    Energy Technology Data Exchange (ETDEWEB)

    Al-Jammaz, I. [Cyclotron and Radiopharmaceuticals Department, King Faisal Specialist Hospital and Research Centre, P.O. Box 3354, Riyadh 11211 (Saudi Arabia)]. E-mail: jammaz@kfshrc.edu.sa; Al-Otaibi, B. [Cyclotron and Radiopharmaceuticals Department, King Faisal Specialist Hospital and Research Centre, P.O. Box 3354, Riyadh 11211 (Saudi Arabia); Aboul-Enein, H. [Cyclotron and Radiopharmaceuticals Department, King Faisal Specialist Hospital and Research Centre, P.O. Box 3354, Riyadh 11211 (Saudi Arabia); Amartey, J.K. [Cyclotron and Radiopharmaceuticals Department, King Faisal Specialist Hospital and Research Centre, P.O. Box 3354, Riyadh 11211 (Saudi Arabia)

    2006-01-01

    Melatonin demands that this hormone and its receptors be well understood. With this aim in mind, synthetic melatonin was radioiodinated with no-carrier-added (n.c.a.) sodium iodide-123 using in situ generated peracetic acid as oxidizing agent for electrophilic iodination at room temperature. The radiochemical yield was typically greater than 80% after 20 min reaction time especially when relatively small amounts of activities were used (10 mCi). Biological evaluation was performed in normal mice. The distribution of the tracer did not reveal any specificity during the time frame studied. There was no significant retention in the whole brain.

  15. Observations of galactic center for annihilation line at 0.511 MeV

    International Nuclear Information System (INIS)

    Jayanthi, U.B.; Martin, I.M.; Braga, J.; Neri, J.A.C.F.; Jardim, M.V.A.; Rao, K.R.

    1983-10-01

    The presence of the 0.511 MeV gamma line emission from galactic center is well-established from various balloon experiments. Recent results in 1980-82 from balloon and satellite experiments show significant decrease in this line intensity. To confirm these results a fly on balloon is performed with a large area sodium iodide detector to measure 0.511 MeV line from galactic center. The preliminary results indicate flux -3 photons cm -2 s -1 . (Author) [pt

  16. Basic elements of nuclear geophysics

    International Nuclear Information System (INIS)

    Nordemann, D.J.R.; Pereira, E.B.

    1984-01-01

    Nuclear Geophysics applies the nuclear radiation detection methodology to the geosciences, specially to study the dynamical processes of the lithosphere, the hydrosphere and the atmosphere as well as some aspects of planetology and astrophysics. Here the main methods are described: alpha-ray and gamma-ray spectrometry, the interaction of alpha and gamma radiation with matter and the detectors used (grid chambers, surface barrier silicon detector for alpha radiation; and sodium iodide thallium activated phosphors, hyperpure and lithium drifted germanium semiconductor detectors for gamma radiation). The principal applications of Nuclear Geophysics are given as examples to ilustrate the use of the methods described. (AUthor) [pt

  17. New syntheses of No-carrier-added 123I-labeled agents via organoborane chemistry

    International Nuclear Information System (INIS)

    Kabalka, G.W.

    1985-01-01

    No-carrier-added 123 I-labeled agents are readily prepared via the reaction of organoboranes with sodium iodide- 123 I in the presence of mild oxidizing agents. The reactions are rapid and regiospecific, and they produce excellent yields of the labeled products. The organoboranes are readily prepared from alkenes and alkynes via the hydroboration reaction. A wide variety of functional groups are tolerated by the hydroboration-iodination sequence. The sequence has been utilized to prepare 123 I-labeled steroids and fatty acids, as well as a number of labeled esters, and aromatic derivatives

  18. Progress report : Technical Physics Division

    International Nuclear Information System (INIS)

    Gopalaraman, C.P.; Deshpande, R.Y.

    1978-01-01

    The research and development work carried out in the Technical Physics Division of the Bhabha Atomic Research Centre, Bombay, is reported. Some of the achievements are: (1) fabrication of mass spectrometers for heavy water analysis and lithium 6/7 isotope ratio measurement, (2) fabrication of electronic components for mass spectrometers, (3) growing of sodium iodide crystals for radiation detectors, (4) development of sandwich detectors comprising of NaI(Tl) and CaI(Na), (5) fabrication of mass spectrometer type leak detectors and (6) fabrication of the high vacuum components of the vacuum system of the variable energy cyclotron based at Calcutta. (M.G.B.)

  19. Scintillators module for the detection of X or gamma rays, realization process, and detector set up incorporating such modules

    International Nuclear Information System (INIS)

    Colomb, Gilbert; Delattre, Dominique; Ricodeau, Jean; Roziere, Guy.

    1981-01-01

    The invention concerns a scintillator module (sodium iodide) for the detection of X and γ rays by light conversion into electrical signals. This conversion is made through optical elements associated to the scintillator and receiving the light generated by X and γ rays. This module is constituted of elementary scintillators separated by interstices, arranged on a transparent support exposed to incident radiations. These interstices constitute optical discontinuities at the surface between two elementary and successive scintillators. The interstices are blocked up by polymerisable and transparent resin to the light of the scintillator, and charged by magnesia powder reflecting this light [fr

  20. Quality Managment Program (QMP) report: A review of quality management programs developed in response to Title 10, Section 35.32 of the Code of Federal Regulations

    Energy Technology Data Exchange (ETDEWEB)

    Witte, M.C.

    1994-10-01

    In July of 1991, the Nuclear Regulatory Commission published a Final Rule in the Federal Register amending regulations governing medical therapeutic administrations of byproduct material and certain uses of radioactive sodium iodide. These amendments required implementation of a Quality Management Program (QMP) to provide high confidence that the byproduct material -- or radiation from byproduct material -- will be administered as directed by an authorized user physician. Herein, this rule is referred to as the QM rule. The Final Rule was published after two proposed rules had been published in the Federal Register.

  1. Aerial radiological survey of the United States Department of Energy's Pantex Plant and surrounding area Amarillo, Texas. Date of survey: October 1979

    International Nuclear Information System (INIS)

    Boyns, P.K.

    1981-07-01

    An aerial radiological survey was conducted over the United States Department of Energy's Pantex Plant and Pantex Lake areas in October, 1979. The Pantex Plant survey covered an area of approximately 64 km 2 . The Pantex Lake survey area was approximately 2 km 2 . Both areas were surveyed at an altitude of 46 m (150 feet) with lines spaced at 91 m (300 foot) intervals. Several passes were also made over the shipping areas at the Amarillo International Airport. An array of sodium iodide detectors were mounted in a helicopter to collect gamma ray spectral data. As expected, the spectral data indicated the presence of several areas containing man-made sources

  2. Development of Scintillators in Nuclear Medicine

    OpenAIRE

    Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

    2015-01-01

    High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce “lutetium aluminum garnet activated by cerium” CRY018 “CRY019” lanthanum br...

  3. Development of Scintillators in Nuclear Medicine.

    Science.gov (United States)

    Khoshakhlagh, Mohammad; Islamian, Jalil Pirayesh; Abedi, Seyed Mohammad; Mahmoudian, Babak

    2015-01-01

    High-quality image is necessary for accurate diagnosis in nuclear medicine. There are many factors in creating a good image and detector is the most important one. In recent years, several detectors are studied to get a better picture. The aim of this paper is comparison of some type of these detectors such as thallium activated sodium iodide bismuth germinate cesium activated yttrium aluminum garnet (YAG: Ce) YAP: Ce "lutetium aluminum garnet activated by cerium" CRY018 "CRY019" lanthanum bromide and cadmium zinc telluride. We studied different properties of these crystals including density, energy resolution and decay times that are more important factors affecting the image quality.

  4. {sup 65}Zn and {sup 133}Ba standardizing by photon-photon coincidence counting

    Energy Technology Data Exchange (ETDEWEB)

    Loureiro, Jamir S.; Cruz, Paulo A.L. da; Iwahara, Akira; Delgado, José U., E-mail: palcruz@ird.gov.br [Instituto de Radioproteção e Dosimetria (LNMRI/IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Lab. Nacional de Metrologia das Radiações Ionizantes; Lopes, Ricardo T. [Coordenacao de Pos-Graduacao e Pesquisa de Engenharia (PEN/COPPE/UFRJ), Rio de Janeiro, RJ (Brazil). Programa de Engenharia Nuclear

    2017-07-01

    The LNMRI/Brazil has deployed a system using X-gamma coincidence technique for the standardizing radionuclide, which present simple and complex decay scheme with X-rays of energy below 100 keV. The work was carried on radionuclide metrology laboratory using a sodium iodide detector, for gamma photons, in combination with a high purity germanium detector for X-rays. Samples of {sup 65}Zn and {sup 133}Ba were standardized and the results for both radionuclides showed good precision and accuracy when compared with reference values. The standardization differences were 0.72 % for {sup 65}Zn and 0.48 % for {sup 133}Ba samples. (author)

  5. Penetration of protective gloves as a route of intake for tritiated water and 125I-labelled sodium iodine solution

    International Nuclear Information System (INIS)

    Harris, S.J.; Gilmore, A.

    1980-01-01

    Measurements have been made of the rate at which tritiated water and 125 I-labelled sodium iodide solution penetrate various types of protective gloves, both isotopes being in common use in this form in universities and similar establishments. Diffusion coefficients relating to the glove materials are also determined. The health physics aspects are discussed and it is concluded that intakes by workers through intact gloves are not likely to be of major significance and can easily be minimised by the correct use and choice of glove. (author)

  6. Cryogenic method for measuring nuclides and fission gases

    Science.gov (United States)

    Perdue, P.T.; Haywood, F.F.

    1980-05-02

    A cryogenic method is provided for determining airborne gases and particulates from which gamma rays are emitted. A special dewar counting vessel is filled with the contents of the sampling flask which is immersed in liquid nitrogen. A vertically placed sodium-iodide or germanium-lithium gamma-ray detector is used. The device and method are of particular use in measuring and identifying the radioactive noble gases including emissions from coal-fired power plants, as well as fission gases released or escaping from nuclear power plants.

  7. Treatment of alcaline metals halides for developing crystals

    International Nuclear Information System (INIS)

    Spurney, R.W.

    1974-01-01

    A process is described whereby crystals of an alkaline metal halide may be dried and placed in a crucible for development by the Bridgeman-Stockbarger method. Purified alkaline halides from a suspension are dried and formed into dense cakes of transverse section slightly smaller than that of the crucible, where they are packed, melted and grown into crystals according to the Bridgeman-Stockbarger technique. This method applies to the preparation of alkaline halide crystals, particularly sodium iodide for optical elements or scintillation counters [fr

  8. Ultraviolet-induced cutaneous hyperemia and steroid-induced cutaneous hypoemia measured by 133Xe disappearance in dogs

    International Nuclear Information System (INIS)

    Chimoskey, J.E.; Flanagan, W.

    1974-01-01

    133 Xe disappearance rates in dog skin were determined by injection of 100 μc 133 Xe dissolved in 0.025 ml physiologic saline solution into the skin with a 30-gauge needle and external detection of gamma radiation with a 2-inch sodium iodide crystal, photomultiplier, rate meter, and timer-scaler system. Skin temperature was measured by a thermistor. Skin blood flow was manipulated by the topical application of fluocinolone acetonide and by ultraviolet radiation. Fluocinolone acetonide caused significant reduction of skin blood flow, and ultraviolet irradiation caused significant increase in skin blood flow

  9. Automated robotic workcell for waste characterization

    International Nuclear Information System (INIS)

    Dougan, A.D.; Gustaveson, D.K.; Alvarez, R.A.; Holliday, M.

    1993-01-01

    The authors have successfully demonstrated an automated multisensor-based robotic workcell for hazardous waste characterization. The robot within this workcell uses feedback from radiation sensors, a metal detector, object profile scanners, and a 2D vision system to automatically segregate objects based on their measured properties. The multisensor information is used to make segregation decisions of waste items and to facilitate the grasping of objects with a robotic arm. The authors used both sodium iodide and high purity germanium detectors as a two-step process to maximize throughput. For metal identification and discrimination, the authors are investigating the use of neutron interrogation techniques

  10. An Aerial Radiological Survey of the Nevada Test Site - Areas 18 and 20 Corrective Action Unit 372

    International Nuclear Information System (INIS)

    Lyons, Craig

    2010-01-01

    A series of aerial radiological surveys were conducted over the Little Feller I and II ground zero areas in Area 18 and the Palanquin and Cabriolet ground zero areas in Area 20. The surveys were performed in October and November 2009 utilizing a large array of helicopter mounted sodium iodide detectors. The purpose of the survey was to update the previous radiological survey levels of the environment and surrounding areas of the ground zeros. Gross Counts, inferred exposure rates, man-made activity, and Americium-241 activity, as calculated from the aerial data are presented in the form of isopleth maps superimposed on imagery of the surveyed areas.

  11. Mass absorption and mass energy transfer coefficients for 0.4-10 MeV gamma rays in elemental solids and gases

    Energy Technology Data Exchange (ETDEWEB)

    Gurler, O. [Physics Department, Faculty of Arts and Sciences, Uludag University, Gorukle Campus, 16059 Bursa (Turkey)], E-mail: ogurler@uludag.edu.tr; Oz, H. [Physics Department, Faculty of Arts and Sciences, Uludag University, Gorukle Campus, 16059 Bursa (Turkey); Yalcin, S. [Education Faculty, Kastamonu University, 37200 Kastamonu (Turkey); Gundogdu, O. [Department of Physics, University of Surrey, Guildford GU2 7XH (United Kingdom); NCCPM, Medical Physics, Royal Surrey County Hospital, GU2 7XX (United Kingdom)

    2009-01-15

    The mass energy absorption, the mass energy transfer and mass absorption coefficients have been widely used for problems and applications involving dose calculations. Direct measurements of the coefficients are difficult, and theoretical computations are usually employed. In this paper, analytical equations are presented for determining the mass energy transfer and mass absorption coefficients for gamma rays with an incident energy range between 0.4 and 10 MeV in nitrogen, silicon, carbon, copper and sodium iodide. The mass absorption and mass energy transfer coefficients for gamma rays were calculated, and the results obtained were compared with the values reported in the literature.

  12. Mass absorption and mass energy transfer coefficients for 0.4-10 MeV gamma rays in elemental solids and gases

    International Nuclear Information System (INIS)

    Gurler, O.; Oz, H.; Yalcin, S.; Gundogdu, O.

    2009-01-01

    The mass energy absorption, the mass energy transfer and mass absorption coefficients have been widely used for problems and applications involving dose calculations. Direct measurements of the coefficients are difficult, and theoretical computations are usually employed. In this paper, analytical equations are presented for determining the mass energy transfer and mass absorption coefficients for gamma rays with an incident energy range between 0.4 and 10 MeV in nitrogen, silicon, carbon, copper and sodium iodide. The mass absorption and mass energy transfer coefficients for gamma rays were calculated, and the results obtained were compared with the values reported in the literature

  13. Neutron Capture and Transmission Measurements and Resonance Parameter Analysis of Niobium

    International Nuclear Information System (INIS)

    NJ Drindak; JA Burke; G Leinweber; JA Helm; JG Hoole; RC Block; Y Danon; RE Slovacek; BE Moretti; CJ Werner; ME Overberg; SA Kolda; MJ Trbovich; DP Barry

    2005-01-01

    Epithermal neutron capture and transmission measurements were performed using the time-of-flight method at the RPI linac using metallic Nb samples. The capture measurements were made at the 25-meter flight station with a 16-section sodium iodide multiplicity detector and the transmission measurements at the 25-meter flight station with a Li-6 glass scintillation detector. Resonance parameters were determined for all resonances up to 500eV with a combined analysis of capture and transmission data using the multi-level R-matrix Bayesian code SAMMY. The present results are compared to those presented in ENDF/B-VI, updated through Release 3

  14. Mechanisms and Functions within a National Innovation System

    Directory of Open Access Journals (Sweden)

    Joseph Gogodze

    2016-12-01

    Full Text Available In modern society, the competitive success of countries is increasingly dependent on the effective management of their national innovation system (NIS. Therefore, understanding the mechanisms behind NISs has become essential. After reviewing the current understanding of the NIS concept and the existing measurement models, this study proposes to consider the NIS as an intangible (underlying asset of a specific kind and identifies its seven fundamental components, which are extracted with a new measurement model, the Global Innovation Index (GII. This study employs the Structural Equation Modeling (SEM techniques to analyze the relationships among the components of an NIS. Our results support the existence of a causal link between the constituents of an NIS and provide several perspectives regarding NIS management opportunities. In particular, we find that the efficient management of institutional capital is a key determinant of innovation success for non-high-income countries.

  15. Intracellular loop 5 is important for the transport mechanism and molecular pharmacology of the human serotonin transporter

    DEFF Research Database (Denmark)

    Said, Saida; Neubauer, Henrik Amtoft; Müller, Heidi Kaastrup

    2015-01-01

    The serotonin transporter (SERT) belongs to a family of transport proteins called the neurotransmitter:sodium symporters. The specialized members of this family transport different neurotransmitters across the cell membrane, thereby regulating signaling between neurons. Most of these transporters...

  16. InterProScan Result: FS725897 [KAIKOcDNA[Archive

    Lifescience Database Archive (English)

    Full Text Available um/solute symporter Molecular Function: transporter activity (GO:0005215)|Biological Process: transport (GO:...0006810)|Cellular Component: membrane (GO:0016020)|Biological Process: transmembrane transport (GO:0055085) ...

  17. Nuclear material accounting and control: Co-ordinating assistance to newly independent States

    International Nuclear Information System (INIS)

    Thorstensen, S.

    1995-01-01

    This article outlines work under way among the IAEA, its Member States, and the Newly Independent States (NIS) relating to the establishment and development in the NIS of State Systems of Accounting and Control (SSACs) of nuclear material. It describes IAEA activities in the NIS, including fact-finding missions at technical visits, the successful attempts to find donor States providing voluntary funding and expertise, and the co-ordination of technical support between the IAEA and the donor States. 3 tabs

  18. A Study of the 384 KeV Complex Gamma Emission from Plutonium-239

    International Nuclear Information System (INIS)

    Forsyth, R.S.; Ronqvist, N.

    1965-11-01

    Plutonium-239 has been reported to emit a gamma of energy 384 KeV. Subsequent workers, using radiation of this energy as a nondestructive measure of the plutonium content of various materials, found that the peak obtained by sodium iodide scintillation spectrometry showed a pronounced shoulder at about 330 KeV. This shoulder has been attributed to protactinium-233 and to uranium-237. From the width of the peak, however, it is obvious that at least three contributors are present. The present paper describes gamma spectrometric studies of plutonium samples of several isotopic compositions using a sodium iodide detector and a lithium-drifted germanium detector. The 384 KeV peak has been shown to be a complex peak containing 12 gamma components due to plutonium-239 between 300 - 450 KeV, and their relative intensities have been estimated. Anion exchange and solvent extraction experiments have also demonstrated that two further contributions due to uranium-237 are present in plutonium containing significant amounts of plutonium-241

  19. Determination of C0-60 in Cobalt Slugs and Slabs and Radionuclides in Curium Sampler Slugs L-Reactor Disassembly Basin

    International Nuclear Information System (INIS)

    Casella, V.R.

    2004-01-01

    Co-60 was historically produced in the SRS reactors. Cobalt slugs were irradiated in the early 1970s. Post-production, remaining cobalt slugs (including slab form) were consolidated for storage. There are approximately nine hundred cobalt slugs currently stored awaiting final disposition. These slugs had historically incomplete documentation for activity rates; therefore, assaying was required in order to determine their activity levels. Since the gamma dose rate from these slugs is extremely high, the most cost effective way to shield a source of this magnitude from personnel and the radiation detector was to use the basin water in which the slugs are stored as the shield. A sodium iodide gamma detector was placed above a specially designed air collimator assembly, so that slug was at least eight feet from the detector and was shielded by the basin water. Using a sodium iodide detector and multichannel analyzer system and an underwater collimator assembly, Co-60 concentrations we re determined for Disassembly Basin cobalt slugs and slabs and 18 curium sampler slugs. The total activity of all of the assayed slugs summed to 31,783 curies. From the Co-60 concentrations of the curium sampler slugs, the irradiation flux was determined for the known irradiation time. The amounts of Pu-238, 239, 240, 241, 242; Am-241, 243; and Cm-242, 244 produced were then obtained based on the original amount of Pu-239 irradiated

  20. Impact of detector efficiency and energy resolution on gamma-ray background rejection in mobile spectroscopy and imaging systems

    Energy Technology Data Exchange (ETDEWEB)

    Aucott, Timothy J., E-mail: Timothy.Aucott@SRS.gov [Lawrence Berkeley National Laboratory, Nuclear Science Division, Berkeley, CA (United States); Bandstra, Mark S. [Lawrence Berkeley National Laboratory, Nuclear Science Division, Berkeley, CA (United States); Negut, Victor; Curtis, Joseph C. [University of California, Berkeley, Department of Nuclear Engineering, Berkeley, CA (United States); Meyer, Ross E.; Chivers, Daniel H. [Lawrence Berkeley National Laboratory, Nuclear Science Division, Berkeley, CA (United States); Vetter, Kai [University of California, Berkeley, Department of Nuclear Engineering, Berkeley, CA (United States); Lawrence Berkeley National Laboratory, Nuclear Science Division, Berkeley, CA (United States)

    2015-07-21

    The presence of gamma-ray background significantly reduces detection sensitivity when searching for radioactive sources in the field, and the systematic variability in the background will limit the size and energy resolution of systems that can be used effectively. An extensive survey of the background was performed using both sodium iodide and high-purity germanium. By using a bivariate negative binomial model for the measured counts, these measurements can be resampled to simulate the performance of a detector array of arbitrary size and resolution. The response of the system as it moved past a stationary source was modeled for spectroscopic and coded aperture imaging algorithms and used for source injection into the background. The performance of both techniques is shown for various sizes and resolutions, as well as the relative performance for sodium iodide and germanium. It was found that at smaller detector sizes or better energy resolution, spectroscopy has higher detection sensitivity than imaging, while imaging is better suited to larger or poorer resolution detectors.

  1. Renaturation of the androgen receptor after denaturation in SDS

    International Nuclear Information System (INIS)

    Johnson, M.P.; Young, C.Y.F.; Rowley, D.R.; Tindall, D.J.

    1986-01-01

    Renaturation of the steroid binding activity of receptor proteins is a potentially useful tool for their purification and analysis. Cytosol was prepared from rat Dunning prostate tumor in buffer containing molybdate and then denatured by addition of SDS buffer and heating. Aliquots were precipitated in cold acetone and the resulting pellets were washed and solubilized with a small volume of solution containing a chaotropic agent such as 6M guanidine, 8M urea, or 5M sodium iodide. After a 20-minute incubation, samples were diluted 20-fold with buffer containing 4nM [ 3 H]dihydrotestosterone with or without excess unlabeled dihydrotestosterone. Diluted samples were incubated at 0 0 C for varying periods of time prior to assay of bound radioactivity using hydroxylapatite. A time-course of renaturation after exposure to guanidine showed a steady increase of specific binding activity during the first 7 hrs post-dilution that remained stable up to 22 hrs. Experiments with guanidine consistently demonstrated that 25-50% of binding activity was recoverable. Preliminary results using urea or sodium iodide were similar. Efforts to optimize recovery and to characterize the renatured androgen receptor are in progress

  2. Preparation of [125I]triiodothyronine by isotopic exchange

    International Nuclear Information System (INIS)

    Kopicka, K.; Kronrad, L.; Hradilek, P.

    1981-01-01

    The effect was studied of various factors on isotopic exchange. The reaction proceeded in an ethanol-water (1:1) medium under the catalytic effect of elemental iodine added in form of an ethanol solution at a temperature of 25 degC. The yield is significantly affected by the sequence of adding components in the reaction mixture. The highest yield of labelled triiodothyronine was obtained using the following procedure: a solution of radioactive sodium iodide and elemental iodine was mixed and after 5 seconds, a triiodothyronine solution was added. The yield also depended on the concentrations of I 2 , of triiodothyronine and of the nonactive carrier in the radioactive sodium iodide solution. The specific activity of 2.6 GBq/mg was achieved for a triiodothyronine concentration in the reaction mixture of 2.4x10 -4 M and an I 2 concentration of 10 -4 N. For analytical chromatographic separation of reaction products, the n-hexane/amyl alcohol/2M ammonia system was used reliably separating triiodothyronine and thyroxine. (Ha)

  3. A blood-mimicking fluid for particle image velocimetry with silicone vascular models

    Science.gov (United States)

    Yousif, Majid Y.; Holdsworth, David W.; Poepping, Tamie L.

    2011-03-01

    For accurate particle image velocimetry measurements in hemodynamics studies, it is important to use a fluid with a refractive index ( n) matching that of the vascular models (phantoms) and ideally a dynamic viscosity matching human blood. In this work, a blood-mimicking fluid (BMF) composed of water, glycerol, and sodium iodide was formulated for a range of refractive indices to match most common silicone elastomers ( n = 1.40-1.43) and with corresponding dynamic viscosity within the average cited range of healthy human blood (4.4 ± 0.5 cP). Both refractive index and viscosity were attained at room temperature (22.2 ± 0.2°C), which eliminates the need for a temperature-control system. An optimally matched BMF, suitable for use in a vascular phantom ( n = 1.4140 ± 0.0008, Sylgard 184), was demonstrated with composition (by weight) of 47.38% water, 36.94% glycerol (44:56 glycerol-water ratio), and 15.68% sodium iodide salt, resulting in a dynamic viscosity of 4 .31 ± 0 .03 cP.

  4. A Study of the 384 KeV Complex Gamma Emission from Plutonium-239

    Energy Technology Data Exchange (ETDEWEB)

    Forsyth, R S; Ronqvist, N

    1965-11-15

    Plutonium-239 has been reported to emit a gamma of energy 384 KeV. Subsequent workers, using radiation of this energy as a nondestructive measure of the plutonium content of various materials, found that the peak obtained by sodium iodide scintillation spectrometry showed a pronounced shoulder at about 330 KeV. This shoulder has been attributed to protactinium-233 and to uranium-237. From the width of the peak, however, it is obvious that at least three contributors are present. The present paper describes gamma spectrometric studies of plutonium samples of several isotopic compositions using a sodium iodide detector and a lithium-drifted germanium detector. The 384 KeV peak has been shown to be a complex peak containing 12 gamma components due to plutonium-239 between 300 - 450 KeV, and their relative intensities have been estimated. Anion exchange and solvent extraction experiments have also demonstrated that two further contributions due to uranium-237 are present in plutonium containing significant amounts of plutonium-241.

  5. Improvements to the Hunter Dose tracking system

    Energy Technology Data Exchange (ETDEWEB)

    Whiteside, T. S. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Aucott, T. J. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Brand, A. D. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Diprete, D. P. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2017-07-01

    Since 1965, the Savannah River Site (SRS) has conducted deer hunts which are open to the general public. SRS performs field monitoring for cesium-137 (Cs-137) of each harvested animal to determine whether the animal may be released to the hunter. A new field system for measuring Cs-137 in the harvested animals has been developed. The system incorporates numerous enhancements compared to the original system. The original system was composed of two Ludlum Measurements scalar-driven 2 inch x 2 inch sodium iodide counters, while the new system is based on a single Ametek Ortec Digibase-driven 2 inch x 4 inch x 16 inch sodium iodide gamma spectrometer. The new system includes a series of easy-to-assemble stainless steel encapsulated lead shields. The combination of the larger detector size and lead shielding improved the detection limit of the new system by a factor of approximately three compared to the original system. This lower detection limit allows for a larger number of measurements to be directly compared to the laboratory results, in cases where animal portions have been sampled. The results from developing and using this system are presented as well as recommendations on improvements to the overall field monitoring of the SRS hunts.

  6. National systems of innovation: determinants and industrial policy measures, empirical evidence for OECD; Sistemas nacionales de innovacion: determinantes y acciones de politica industrial. Evidencia empirica para la OCDE

    Energy Technology Data Exchange (ETDEWEB)

    Hervas, J. L.; Rojas, R.; Sempere, F.; Albors, J.

    2012-11-01

    The paper presents an attempt to tackle the main gaps in the national innovation systems (NIS) literature: the problem specifying the boundaries of the NIS and the lack of connection between theory and empirics. For this purpose, the paper uses 55 countries as sample and constructs an NIS index based on a factor analysis of 28 variables. Empirical evidence shows that a firm's strategies, technology infrastructure, government governance, education and linkages are the main components of the NIS. The implications are important for policy-makers and the academia. (Author) 49 refs.

  7. Dicty_cDB: CFI277 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available nslated Amino Acid sequence (All Frames) Frame A: ---xxxxxxxxxxxxxnxxxxxxkgxxxxxkxxxxkxyxxxxqxkx*cnxknrixtfn...NKTPVKPKLGEYG QKSIKTK Frame C: ---xxxxxxxxxxxxqxxxxxxxrxxxxxkxlxxqxixxxsxxqtxmq*xk*nxhfqslq ingsspxq*nis*vsa

  8. Dicty_cDB: Contig-U08241-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available XIXXXXXXKXXXXXXKXXXXNXXXXFXXXNXDAIXKIEXPLSIP SNQWFFSXPIKHIMSFSPTYGTPSKIIDSPSKLLNTPKKKQQDKTNKTNKTPVKPKLGEY GQKSIKTK Frame B: xxxxxxxxx...xxxxxxxqxxxxxxxrxxxxxkxlxxqxixxxsxxqtxmq*xk*nxhfqsl qingsspxq*nis*vsaqxmvhhrklsihqv...nc*thqkrnnktkqtrptkhqsnqnwvnm dkka*kq Frame C: xxxxxxxxxxxxxxxxnxxxxxxkgxxxxxkxxxxkxyxxxx

  9. National innovation system in less successful developing countries

    DEFF Research Database (Denmark)

    Intarakumnerd, Patarapong; Chairatana, Pun-arj; Tangchitpiboon, Tipawan

    2002-01-01

    This paper, using Thailand as a case study, aims at understanding the national innovation system (NIS) in developing countries which are less successful in technological catching-up. In contrast to developed countries, the development level of Thailand’s NIS does not link to its economic structural...... development level. As Thailand moves from agricultural to an increasingly industrial economy, its NIS remains weak and fragmented. The mismatch between the two affected Thailand’s competitiveness and partially contributed to the recent economic crisis. Studies of NIS in countries like Thailand should focus...

  10. Surface-enhanced Raman scattering biosensor for DNA detection on nanoparticle island substrates

    DEFF Research Database (Denmark)

    Yuan, Scott Wu; Ho, Ho Pui; Lee, Rebecca K.Y.

    2009-01-01

    We present a study on the surface-enhanced Raman scattering (SERS) properties of Ag nanoparticle island substrates (NIS) and their applications for target oligonucleotide (OND) detection. It has been found that the surface nanostructure of NIS samples can be controlled with a good degree of repro......We present a study on the surface-enhanced Raman scattering (SERS) properties of Ag nanoparticle island substrates (NIS) and their applications for target oligonucleotide (OND) detection. It has been found that the surface nanostructure of NIS samples can be controlled with a good degree...

  11. Infrastructure design & road safety : OECD Workshop B3 (Infrastructure design and road safety) for CEE's and NIS held on 15th-18th November 1994, Prague (Czech Republic). Part 1: Summaries, conclusions and recommendations, and statements from Central and Eastern European countries.

    NARCIS (Netherlands)

    2012-01-01

    The workshop 'Infrastructure design and road safety ' was one of the initiatives which the OECO Steering Committee for Road Transport Research developed with the aim of exchanging information in the road transport sector, in order to respond to the urgent needs expressed by Central and Eastern

  12. A massive update of non-indigenous species records in Mediterranean marinas.

    Science.gov (United States)

    Ulman, Aylin; Ferrario, Jasmine; Occhpinti-Ambrogi, Anna; Arvanitidis, Christos; Bandi, Ada; Bertolino, Marco; Bogi, Cesare; Chatzigeorgiou, Giorgos; Çiçek, Burak Ali; Deidun, Alan; Ramos-Esplá, Alfonso; Koçak, Cengiz; Lorenti, Maurizio; Martinez-Laiz, Gemma; Merlo, Guenda; Princisgh, Elisa; Scribano, Giovanni; Marchini, Agnese

    2017-01-01

    The Mediterranean Sea is home to over 2/3 of the world's charter boat traffic and hosts an estimated 1.5 million recreational boats. Studies elsewhere have demonstrated marinas as important hubs for the stepping-stone transfer of non-indigenous species (NIS), but these unique anthropogenic, and typically artificial habitats have largely gone overlooked in the Mediterranean as sources of NIS hot-spots. From April 2015 to November 2016, 34 marinas were sampled across the following Mediterranean countries: Spain, France, Italy, Malta, Greece, Turkey and Cyprus to investigate the NIS presence and richness in the specialized hard substrate material of these marina habitats. All macroinvertebrate taxa were collected and identified. Additionally, fouling samples were collected from approximately 600 boat-hulls from 25 of these marinas to determine if boats host diverse NIS not present in the marina. Here, we present data revealing that Mediterranean marinas indeed act as major hubs for the transfer of marine NIS, and we also provide evidence that recreational boats act as effective vectors of spread. From this wide-ranging geographical study, we report here numerous new NIS records at the basin, subregional, country and locality level. At the basin level, we report three NIS new to the Mediterranean Sea ( Achelia sawayai sensu lato , Aorides longimerus , Cymodoce aff. fuscina ), and the re-appearance of two NIS previously known but currently considered extinct in the Mediterranean ( Bemlos leptocheirus, Saccostrea glomerata ). We also compellingly update the distributions of many NIS in the Mediterranean Sea showing some recent spreading; we provide details for 11 new subregional records for NIS ( Watersipora arcuata , Hydroides brachyacantha sensu lato and Saccostrea glomerata now present in the Western Mediterranean; Symplegma brakenhielmi , Stenothoe georgiana , Spirobranchus tertaceros sensu lato , Dendostrea folium sensu lato and Parasmittina egyptiaca now present in

  13. International arrivals: widespread bioinvasions in European Seas.

    Science.gov (United States)

    Galil, B S; Marchini, A; Occhipinti-Ambrogi, A; Minchin, D; Narščius, A; Ojaveer, H; Olenin, S

    2014-04-01

    The European Union lacks a comprehensive framework to address the threats posed by the introduction and spread of marine non-indigenous species (NIS). Current efforts are fragmented and suffer substantial gaps in coverage. In this paper we identify and discuss issues relating to the assessment of spatial and temporal patterns of introductions in European Seas (ES), based on a scientifically validated information system of aquatic non-indigenous and cryptogenic species, AquaNIS. While recognizing the limitations of the existing data, we extract information that can be used to assess the relative risk of introductions for different taxonomic groups, geographic regions and likely vectors. The dataset comprises 879 multicellular NIS. We applied a country-based approach to assess patterns of NIS richness in ES, and identify the principal introduction routes and vectors, the most widespread NIS and their spatial and temporal spread patterns. Between 1970 and 2013, the number of recorded NIS has grown by 86, 173 and 204% in the Baltic, Western European margin and the Mediterranean, respectively; 52 of the 879 NIS were recorded in 10 or more countries, and 25 NIS first recorded in European seas since 1990 have since been reported in five or more countries. Our results highlight the ever-rising role of shipping (commercial and recreational) as a vector for the widespread and recently spread NIS. The Suez Canal, a corridor unique to the Mediterranean, is responsible for the increased introduction of new thermophilic NIS into this warming sea. The 2020 goal of the EU Biodiversity Strategy concerning marine Invasive Alien Species may not be fully attainable. The setting of a new target date should be accompanied by scientifically robust, sensible and pragmatic plans to minimize introductions of marine NIS and to study those present.

  14. Information Quality of a Nursing Information System depends on the nurses: A combined quantitative and qualitative evaluation

    NARCIS (Netherlands)

    Michel-Verkerke, M.B.

    2012-01-01

    Purpose Providing access to patient information is the key factor in nurses’ adoption of a Nursing Information System (NIS). In this study the requirements for information quality and the perceived quality of information are investigated. A teaching hospital in the Netherlands has developed a NIS as

  15. Utilizing Graphics Processing Units for Network Anomaly Detection

    Science.gov (United States)

    2012-09-13

    pages 1266–1271, 2003. [Nis12a] Ste↵en Nissen. Fann datatypes - activation function enum, 2012. http://leenissen.dk/fann/html/files/fann data-h.html# fann...activationfunc enum. Last accessed: 7 Aug 2012. [Nis12b] Ste↵en Nissen. Fann datatypes - train enum, 2012. http://leenissen.dk/fann/html/files/fann

  16. Time-course investigation of infection with a low virulent Pasteurella multocida strain in normal and immune-suppressed 12-week-old free-range chickens

    DEFF Research Database (Denmark)

    Mbuthia, P.G.; Njagi, L.W.; Nyaga, P.N.

    2011-01-01

    Twelve-week-old indigenous chickens, either immune-suppressed using dexamethasone (IS) or non-immune-suppressed (NIS), were challenged with a low virulent strain, Pasteurella multocida strain NCTC 10322(T), and developed clinical signs and pathological lesions typical of chronic fowl cholera. NIS...

  17. A Model of the Costs of Community and Nosocomial Pediatric Respiratory Syncytial Virus Infections in Canadian Hospitals

    Directory of Open Access Journals (Sweden)

    Philip Jacobs

    2013-01-01

    Full Text Available BACKGROUND: Approximately one in 10 hospitalized patients will acquire a nosocomial infection (NI after admission to hospital, of which 71% are due to respiratory viruses, including the respiratory syncytial virus (RSV. NIs are concerning and lead to prolonged hospitalizations. The economics of NIs are typically described in generalized terms and specific cost data are lacking.

  18. Attitudinal and behavioral differences between cigarette users who do and do not identify as "smokers".

    Science.gov (United States)

    Berg, Michael B; Lin, Linda; White, Madeleine; Alfonso-Barry, Jacqueline

    2017-01-01

    The current research aimed to understand differences in smoking-related identity among college students and to illustrate the distinct characteristics of nonidentified smokers (NIS). Students from 2 colleges in Massachusetts (N = 538; April 2016). Respondents reported by online survey whether or not they had smoked a cigarette in the past 30 days and if they self-identified as smokers. Nonsmokers (NIS) and identified smokers (IS) were then compared on their smoking attitudes and behavior. NIS made up 12.5% of the sample and 64% of all tobacco users. NIS perceived themselves as less addicted and were more confident in their ability to quit smoking. They also were less likely to smoke alone, buy their own cigarettes, or have friends who smoked. College health officials can best motivate NIS to quit smoking by focusing on peer norms and the potential of long-term addiction.

  19. Shaping a holistic national innovation system. Riigi tervikliku innovatsioonisüsteemi kujundamine

    Directory of Open Access Journals (Sweden)

    Janno Reiljan

    2016-08-01

    Full Text Available For the sustainable economic development of a state the functioning national innovation system (NIS is needed. NIS covers different government policies (for instance, education policy, R&D policy innovation support to business sector, intellectual property protection, public procurement policy, etc.. All these policies have to be integrated in a holistic system through innovation policy enabling the functioning different policies in mutual relationships smoothly and effectively for sustainable economic development. The goal of this article is to highlight the role of innovation policy in shaping a holistic NIS. The first part of the article deals with the need for public sector intervention in innovation processes and problems resulting from it. In the second part a holistic NIS model that reflects the role of innovation policy is developed and presented. The third part deals with the structure of innovation policy based on a holistic NIS model

  20. Production of gaseous radiotracers CH{sub 3}I and I{sub 2} through Na{sup 123}I salt

    Energy Technology Data Exchange (ETDEWEB)

    Candeiro, R.E.M., E-mail: ricardocandeiro@cnen.gov.b [Comissao Nacional de Energia Nuclear (DIFOR/CNEN-CE), Fortaleza, CE (Brazil). Distrito de Fortaleza; Brandao, L.B. [Instituto de Engenharia Nuclear (IEN/CNEN-RJ), Rio de Janeiro, RJ (Brazil); Pereira, W.P. [Universidade Federal Fluminense (UFF), Niteroi, RJ (Brazil)

    2011-07-01

    The objective of the present work was to develop, separately, methodology for production of two gaseous tracers through the sodium iodide NaI marked with {sup 123}I. Found in the nature in form different, the iodine has been used in diverse works in the area of the industry and health. These two forms of the gaseous iodine, the methyl iodide, CH{sub 3}I, and molecular iodine, I{sub 2}, are very unstable and volatile in the ambient temperature and presents different problems in clean-up and monitoring systems. The syntheses were processed with sodium iodide (NaI) 1M aqueous solution marked with 1{sup 23I}. The production of gas I{sub 2} was realized with in chlorine acid (HCl) and sodium iodate salt (NaIO{sub 3}) and the CH{sub 3}I was used, the salt of NaI and the reagent (CH{sub 3}){sub 2}SO{sub 4}. The production of gases was initially realized through in unit in glass with an inert material and the purpose was to study the kinetic of reaction and to determine the efficiency of production. The two synthesis occurs in the reaction bottle and after of produced, the gas is stored in the collect bottle that contains a starch solution for fixed the I{sub 2}, and in syntheses of CH{sub 3}I contains a silver nitrate solution for your fixation. To determine the efficiency of production of gases, analytic tests were realized, where the consumption of iodide ions of the bottle of reaction are measured. The optimization of production of the each gaseous tracer was studied varying parameter as: concentration of iodide, concentration of acid and temperature. After, the syntheses of the radiotracers were realized in the compact unit, having been used as main reagent the salt radiated of sodium iodide, Na{sup 123}I. The transportation of elementary iodine and methyl iodine was studied by a scintillation detector NaI (2 x 2)' positioned in the reaction bottle. (author)

  1. A new FSA approach for in situ γ ray spectroscopy

    International Nuclear Information System (INIS)

    Caciolli, A.; Baldoncini, M.; Bezzon, G.P.; Broggini, C.; Buso, G.P.; Callegari, I.; Colonna, T.; Fiorentini, G.; Guastaldi, E.; Mantovani, F.; Massa, G.; Menegazzo, R.; Mou, L.; Alvarez, C. Rossi

    2012-01-01

    An increasing demand of environmental radioactivity monitoring comes both from the scientific community and from the society. This requires accurate, reliable and fast response preferably from portable radiation detectors. Thanks to recent improvements in the technology, γ spectroscopy with sodium iodide scintillators has been proved to be an excellent tool for in-situ measurements for the identification and quantitative determination of γ ray emitting radioisotopes, reducing time and costs. Both for geological and civil purposes not only 40 K, 238 U, and 232 Th have to be measured, but there is also a growing interest to determine the abundances of anthropic elements, like 137 Cs and 131 I, which are used to monitor the effect of nuclear accidents or other human activities. The Full Spectrum Analysis (FSA) approach has been chosen to analyze the γ spectra. The Non Negative Least Square (NNLS) and the energy calibration adjustment have been implemented in this method for the first time in order to correct the intrinsic problem related with the χ 2 minimization which could lead to artifacts and non physical results in the analysis. A new calibration procedure has been developed for the FSA method by using in situ γ spectra instead of calibration pad spectra. Finally, the new method has been validated by acquiring γ spectra with a 10.16 cm × 10.16 cm sodium iodide detector in 80 different sites in the Ombrone basin, in Tuscany. The results from the FSA method have been compared with the laboratory measurements by using HPGe detectors on soil samples collected particular, the 137 Cs isotopes has been implemented in the analysis since it has been found not negligible during the in-situ measurements. - Highlights: ► The Full Spectrum Analysis technique is investigated with sodium iodide scintillator. ► Artifacts due to the free chi 2 minimization in standard FSA are solved applying the NNLS. ► New calibration approach has been developed without using

  2. Evolutionary ancestry and novel functions of the mammalian glucose transporter (GLUT) family.

    Science.gov (United States)

    Wilson-O'Brien, Amy L; Patron, Nicola; Rogers, Suzanne

    2010-05-21

    In general, sugar porters function by proton-coupled symport or facilitative transport modes. Symporters, coupled to electrochemical energy, transport nutrients against a substrate gradient. Facilitative carriers transport sugars along a concentration gradient, thus transport is dependent upon extracellular nutrient levels. Across bacteria, fungi, unicellular non-vertebrates and plants, proton-coupled hexose symport is a crucial process supplying energy under conditions of nutrient flux. In mammals it has been assumed that evolution of whole body regulatory mechanisms would eliminate this need. To determine whether any isoforms bearing this function might be conserved in mammals, we investigated the relationship between the transporters of animals and the proton-coupled hexose symporters found in other species. We took a comparative genomic approach and have performed the first comprehensive and statistically supported phylogenetic analysis of all mammalian glucose transporter (GLUT) isoforms. Our data reveals the mammalian GLUT proteins segregate into five distinct classes. This evolutionary ancestry gives insight to structure, function and transport mechanisms within the groups. Combined with biological assays, we present novel evidence that, in response to changing nutrient availability and environmental pH, proton-coupled, active glucose symport function is maintained in mammalian cells. The analyses show the ancestry, evolutionary conservation and biological importance of the GLUT classes. These findings significantly extend our understanding of the evolution of mammalian glucose transport systems. They also reveal that mammals may have conserved an adaptive response to nutrient demand that would have important physiological implications to cell survival and growth.

  3. Burn-Up Determination by High Resolution Gamma Spectrometry: Spectra from Slightly-Irradiated Uranium and Plutonium between 400-830 keV

    Energy Technology Data Exchange (ETDEWEB)

    Forsyth, R S; Ronqvist, N

    1966-08-15

    Previously published studies of the short-cooled fission product spectra of irradiated uranium have been severely restricted by the poor energy resolution of the sodium iodide detectors used. In this report are presented fission product spectra of irradiated uranium and plutonium obtained by means of a lithium-drifted germanium detector. The resolved gamma peaks have been assigned to various fission products by correlation of measured energy and half-life values with published data. By simultaneous study of the spectra of two irradiated mixtures of plutonium and uranium, the possibility of using the activities of Ru-103 and Ru-106 as a measure of the relative fission rate in U-235 and Pu-239 has been briefly examined.

  4. Effects of increased shielding on gamma-radiation levels within spacecraft

    Science.gov (United States)

    Haskins, P. S.; McKisson, J. E.; Weisenberger, A. G.; Ely, D. W.; Ballard, T. A.; Dyer, C. S.; Truscott, P. R.; Piercey, R. B.; Ramayya, A. V.; Camp, D. C.

    The Shuttle Activation Monitor (SAM) experiment was flown on the Space Shuttle Columbia (STS-28) from 8 - 13 August, 1989 in a 57°, 300 km orbit. One objective of the SAM experiment was to determine the relative effect of different amounts of shielding on the gamma-ray backgrounds measured with similarly configured sodium iodide (NaI) and bismuth germante (BGO) detectors. To achieve this objective twenty-four hours of data were taken with each detector in the middeck of the Shuttle on the ceiling of the airlock (a high-shielding location) as well as on the sleep station wall (a low-shielding location). For the cosmic-ray induced background the results indicate an increased overall count rate in the 0.2 to 10 MeV energy range at the more highly shielded location, while in regions of trapped radiation the low shielding configuration gives higher rates at the low energy end of the spectrum.

  5. Natural activity in Hudson River estuary samples and their influence on the detection limits for gamma emitting radionuclides using NaI gamma spectrometry

    International Nuclear Information System (INIS)

    Wrenn, M.E.; Jinks, S.M.; Hairr, L.M.; Paschoa, A.S.; Lentsch, J.W.

    1972-01-01

    Sources of natural radioactivity in Hudson River Estuary are described. The technique of analysis for gamma spectrometry of environmental samples is presented and its pros and cons discussed. The distribution of natural radioactivity in water, biota and sediment was reported as well as the role played by the vertical distribution of cesium-137 in sediments as an indicator of the rate of sedimentation. The effect of the presence of natural radionuclides on the detection limits of man-made nuclides in the Hudson River environment is thoroughly examined. The results obtained with a 4-in. sodium iodide well crystal housed in a low background mercury shielding compare favorably with a more sophisticated Ge(Li) system which uses anticoincidence, as far as the analysis of environmental samples is concerned. (U.S.)

  6. Metal halide arc discharge lamp having short arc length

    Science.gov (United States)

    Muzeroll, Martin E. (Inventor)

    1994-01-01

    A metal halide arc discharge lamp includes a sealed light-transmissive outer jacket, a light-transmissive shroud located within the outer jacket and an arc tube assembly located within the shroud. The arc tube assembly includes an arc tube, electrodes mounted within the arc tube and a fill material for supporting an arc discharge. The electrodes have a spacing such that an electric field in a range of about 60 to 95 volts per centimeter is established between the electrodes. The diameter of the arc tube and the spacing of the electrodes are selected to provide an arc having an arc diameter to arc length ratio in a range of about 1.6 to 1.8. The fill material includes mercury, sodium iodide, scandium tri-iodide and a rare gas, and may include lithium iodide. The lamp exhibits a high color rendering index, high lumen output and high color temperature.

  7. Nuclear assay of coal. Volume 8. Continuous nuclear assay of coal (CONAC). Final report

    International Nuclear Information System (INIS)

    Lagarias, J.; Irminger, P.; Dodson, W.

    1979-01-01

    Using californium-252 as a source of exciting neutrons, prompt gamma photons emitted by elemental nuclei in the coal have been measured using several detectors, including sodium-iodide and germanium-lithium. Several coal types, including bituminous, subbituminous lignite and anthracite were crushed to various top sizes and analyzed carefully by traditional ASTM wet chemistry techniques at two or three different laboratories. The elements (sulfur, hydrogen, carbon, aluminum, silicon, iron, calcium, sodium, nitrogen, and chlorine) were determined by prompt neutron activations and the quantities compared with those of the wet chemical analyses. Since satisfactory correlation has been obtained at bench-scale level using 100 to 200 kG samples, an apparatus has been designed to analyze a coal stream of up to 50 ton/hour, at an electric power generating station

  8. Borehole Logging for Uranium by Gamma-Ray Spectrometry

    DEFF Research Database (Denmark)

    Løvborg, Leif; Nyegaard, P.; Christiansen, E. M.

    1980-01-01

    The resources in a large syngenetic deposit of low-grade uranium (U) ore with thorium at Kvanefjeld, South Greenland, were evaluated by spectrometric gamma-ray logging of 23 boreholes, 46 mm in diameter and 200 m deep. The borehole probe's detector contained 22 cm3 of sodium-iodide, and the photo......The resources in a large syngenetic deposit of low-grade uranium (U) ore with thorium at Kvanefjeld, South Greenland, were evaluated by spectrometric gamma-ray logging of 23 boreholes, 46 mm in diameter and 200 m deep. The borehole probe's detector contained 22 cm3 of sodium...... of the spectrometer system were determined by calculating the average number of U and thorium (Th) counts per meter of borehole and comparing these with the U-Th concentrations in 1-m sections of analyzed drill core. The sensitivity and the background count rate in the uranium window varied appreciably from one hole...

  9. A comparative study of 19-iodo cholesterol-125I 3-acetate and Na 125I in liquid scintillation measurements; Estudio comparativo del acetato de 19-iodocolesterol- -125I con Nal25I en medidas por centelleo liquido

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez Barquero, L.; Grau Malonda, A.; Los Arcos Merino, J. M.; Grau Carles, A.

    1994-07-01

    A comparative study of performance of 19-iodo cholesterol {sup 1}25I 3-acetate and sodium iodide samples labeled with 125I is presented for liquid scintillation counting measurements. Quench effect, count rate stability and spectral evolution of samples have been followed for several weeks in Toluene, Hisafe II, Instagel, Dioxane-naphthalene and Toluene-alcohol scintillators. Organic samples have negligible quench effect in the interval of I concentration of 0-90 {mu}g and inorganic samples only show a very small variation, lower than 12%, for Dioxane-naphthalene, in the same range of concentration. Satisfactory stability is obtained in general for both, organic and inorganic samples, but small counting losses, 0.03% for 19-iodocholesterol 1 I 3-acetate samples in Tolue ne-alcohol and 0 .04% for Na 125I samples in Dioxane-naphthalene and Toluene-alcohol, have been reported. (Author) 8 refs.

  10. Detector for deep well logging

    International Nuclear Information System (INIS)

    1976-01-01

    A substantial improvement in the useful life and efficiency of a deep-well scintillation detector is achieved by a unique construction wherein the steel cylinder enclosing the sodium iodide scintillation crystal is provided with a tapered recess to receive a glass window which has a high transmittance at the critical wavelength and, for glass, a high coefficient of thermal expansion. A special high-temperature epoxy adhesive composition is employed to form a relatively thick sealing annulus which keeps the glass window in the tapered recess and compensates for the differences in coefficients of expansion between the container and glass so as to maintain a hermetic seal as the unit is subjected to a wide range of temperature

  11. Labelling of human serum albumin with iodine-131 for diagnosis in nuclear medicine

    International Nuclear Information System (INIS)

    Silva Valente Goncalves, R. da.

    1979-01-01

    Labelling of 131 I-human serum albumin with I-131 from a solution of 131 I-sodium iodide using chloramine T as an oxidant agent is studied. Parameters which can influence on the labelling yield like mass of human serum albumin, and chloramine T, pH of the reaction, reaction time and activity of 131 I are also studied. The purification of the labeled product by means of IRA-410 Amberlite ion-exchange resin in chloride form and the sterilization of the 131 I-human serum albumin by its passage through a 0,22μ millipore filter are carried out. The radiochemistry control of the final product by paper chromatography and the microbiological control by cultivation of microorganisms in fluid medium: nutrient broth, sodium thioglycollate broth and Sabouraud, are performed. The stability of the radiopharmaceutical until ten days after its preparation is analysed by means of radiochemical control. (Author) [pt

  12. Radionuclide molecular target therapy for lung cancer

    International Nuclear Information System (INIS)

    Zhang Fuhai; Meng Zhaowei; Tan Jian

    2012-01-01

    Lung cancer harms people's health or even lives severely. Currently, the morbidity and mortality of lung cancer are ascending all over the world. Accounting for 38.08% of malignant tumor caused death in male and 16% in female in cities,ranking top in both sex. Especially, the therapy of non-small cell lung cancer has not been obviously improved for many years. Recently, sodium/iodide transporter gene transfection and the therapy of molecular target drugs mediated radionuclide are being taken into account and become the new research directions in treatment of advanced lung cancer patients with the development of technology and theory for medical molecular biology and the new knowledge of lung cancer's pathogenesis. (authors)

  13. The polymer gel electrolyte based on poly(methyl methacrylate) and its application in quasi-solid-state dye-sensitized solar cells

    International Nuclear Information System (INIS)

    Yang Hongxun; Huang Miaoliang; Wu Jihuai; Lan Zhang; Hao Sancun; Lin Jianming

    2008-01-01

    Using poly(methyl methacrylate) as polymer host, ethylene carbonate, 1,2-propanediol carbonate and dimethyl carbonate as organic mixture solvents, sodium iodide and iodine as source of I - /I 3 - , a polymer gel electrolyte PMMA-EC/PC/DMC-NaI/I 2 with ionic conductivity of 6.89 mS cm -1 was prepared. Based on the polymer gel electrolyte, a quasi-solid-state dye-sensitized solar cell (DSSC) was fabricated. The quasi-solid-state DSSC possessed a good long-term stability and a light-to-electrical energy conversion efficiency of 4.78% under irradiation of 100 mW cm -2 simulated sunlight, which is almost equal to that of DSSC with a liquid electrolyte

  14. Ginkgo biloba extract alters the binding of the sodium [123I] iodide (Na123I) on blood constituents

    International Nuclear Information System (INIS)

    Aleixo, Luiz Cláudio Martins; Moreno, Silvana Ramos Farias; Freitas, Rosimeire de Souza; Thomaz, Hélio; Santos-Filho, Sebastião David

    2012-01-01

    We evaluated the in vitro effect of an aqueous extract of Ginkgo biloba (EGb) on the distribution in blood cells (BC) and plasma (P) and on the binding of Na 123 I to the blood constituents using precipitation with trichloroacetic acid. The radioactivity percentages insoluble (SF) and insoluble fraction (IF) of blood constituents were determined. The EGb interfered (p 123 I in the P (from 69.64 to 86.13) and BC (from 30.36 to 13.87) and altered the fixation of the Na 123 I in IF-P and in IF-BC. - Highlights: ► Interaction between the Ginkgo biloba and blood constituents radiolabeled. ► Modification of the binding of sodium iodide (Na 123 I) to the blood constituents. ► This alteration should have influence in a diagnosis of nuclear medicine.

  15. The use of rare earth radiotracers in the study of solvent extraction kinetics

    International Nuclear Information System (INIS)

    Lim, T.M.; Tran, T.

    1993-01-01

    The suitability of rare earth radionuclides as tracers in research and industry are assessed. In general, the most desirable characteristics of radiotracers for process studies are a half-life in the range 5-200 days, a high yield, high energy γ-emission and low cost of production. The majority of rare earths have at least one radionuclide with acceptable characteristics. The application of radiotracers to the study of kinetics of rare earth solvent extraction have been studied using a modified Lewis cell. Terbium-160 was selected as the most suitable rare earth radionuclide for our experiments. Samples of both aqueous and organic phases were continuous withdrawn, monitored using an automated γ-counting system based on two sodium iodide detectors and then pumped back to the Lewis cell. Excellent results were obtained and the rate of extraction was shown to be first order with respect to the terbium concentration. 6 refs., 1 tab., 7 figs

  16. Hyperthyroidism with metastatic follicular thyroid carcinoma

    International Nuclear Information System (INIS)

    Chapman, C.N.; Sziklas, J.J.; Spencer, R.P.; Bower, B.F.; Rosenberg, R.J.

    1984-01-01

    A 70-yr-old woman presented with hyperthyroidism and metastatic follicular carcinoma of the thyroid. The blood level of thyroid stimulating immunoglobulin (TSIg) was elevated. A total thyroidectomy was performed. One month later she remained hyperthyroid. Three weeks after therapy with 218 mCi of I-131 sodium iodide, the patient was euthyroid. Six months after the initial radioiodide therapy, she was again hyperthyroid and was given a second oral treatment dose of I-131 (220 mCi). Five months later, the patient had again become euthyroid. It is likely that initially the woman's metastases were producing sufficient hormone to render her hyperthyroid. After thyroidectomy and two large doses of radioiodide, she has remained euthyroid without having to take exogenous hormone

  17. Clinical applications of a high quantum utilization scanner. Final report

    International Nuclear Information System (INIS)

    Crandall, P.H.; Cassen, B.

    1973-04-01

    The clinical usefulness of a tomographic imaging process employing a fast rectilinear scanner consisted of a spherical-cap nest of seven individual detectors (3'' x 1 / 2 '' activated sodium iodide) collimated to a common focal point at 10 cm. Hydraulic drives permitted a fast rectilinear scan to be made and, when raised or lowered, at different planes. Patients with well-defined brain lesions were studied using /sup 99m/Tc-pertechnetate or 203 Hg-chlormerodrin as tracers by measuring three dimensions of their lesions and anatomical location at the time of operation. Brain maps were used to identify this location at operation and also the location of images traced from film density displays of a conventional radioisotopic scan, the tomographic scan, and cerebral angiograms. (U.S.)

  18. Portable regional cerebral blood flow system based on IBM PC/AT and microprocessor electronics

    International Nuclear Information System (INIS)

    Mun, S.K.; Mun, I.K.; Petite, J.; Cohan, S.L.; Fahey, F.H.

    1986-01-01

    A portable 16-channel reginal cerebral blood flow (rCBF) measuring system has been developed using an IBM PC/AT and new microelectronics to improve processing speed and portability. The detector electronics were developed by Scan Detectronics A/S of Denmark. The counter module contains 18 16-bit counters, each programmable in four different modes. The rate meter has three independent microprocessor controllers for rate meter functions, window controller, and channel controller. The detector electronics and detection parameters can be fully controlled by the host PC/AT. The menu-driven system (Better Basic) assists the operator at each step. The collected data from 16 channels can be processed automatically or postprocessed using more flexible and sophisticated techniques within 20 minutes. The headgear holding 16 sodium iodide detectors is fabricated by modifying a motorcycle helmet

  19. Theoretical considerations on the possibility of using a television camera in scintigraphy

    International Nuclear Information System (INIS)

    Banget Mossaz, Gaston; Cezilly, Daniel; Paccard, Michel

    1969-04-01

    After a presentation of the principles of scintigraphy for the exploration of human organs, of the three main parts of scintigraphic apparels (collimator, scintillator and detector) and of their characteristics (resolving power, sensitivity, contrast), this paper describes the properties of gamma radiations interacting with matter, their absorption and their detection, some statistical notions about gamma radiations (Poisson law), the properties of the collimator, of the scintillator (sodium iodide) and of the detector. The use of a television camera is then introduced with issues concerning the limitations of a camera tube, the electronic optics of the tube, camera tubes with brightness amplification, the case of a Vidicon tube, etc. and some considerations on the potential benefits of television cameras on resolution, contrast and sensitivity

  20. Determination of primordial and cosmogenic radioactivity in achondritic meteorites by low-level, gamma-ray spectrometry

    International Nuclear Information System (INIS)

    Muntean, R.A.

    1979-08-01

    A high-sensitivity, low-background gamma-ray spectrometer containing two 23 cm by 13 cm thallium-activated, sodium iodide detectors was used to measure long-lived primordial and cosmogenic radioactivity in a suite of achondritic meteorites. Potassium, thorium, uranium, and 26 Al abundances were established for sixteen brecciated eucrites, two unbrecciated eucrites, a nakhlite, a chassignite, and a unique meteorite from Antarctica by nondestructive counting techniques. In several cases, multiple samples of the same meteorite fall were examined. Concentrations ranged from 79.8 ppM to 1150 ppM for potassium, 55.6 ppb to 663 ppb for thorium, 18.1 ppb to 190 ppb for uranium, and 45.0 dpm/kg to 99.0 dpm/kg for 26 Al. In addition, a 137 Cs concentration of 264 dpm/kg was observed in the Allan Hills 77005,9 specimen

  1. Gamma spectrometry and plastic-scintillator inherent background

    International Nuclear Information System (INIS)

    Pomerantsev, V.V.; Gagauz, I.B.; Mitsai, L.I.; Pilipenko, V.S.; Solomonov, V.M.; Chernikov, V.V.; Tsirlin, Y.A.

    1988-01-01

    The authors measured the energy resolution for a linear dependence of light yield on gamma radiation energy of gamma spectrometers based on plastic scintillation detectors for several plastic scintillators. If there were several gamma lines from the source the line with the highest energy was used to eliminate distortion due to overlap from the Compton background from gamma radiation of higher energy. Attenuation lengths were calculated. The tests were based on three modes of interaction between the gamma radiation and the scintillator: Compton scattering, the photoelectric effect, and pair formation. The contribution from light collection was also considered. The scintillators tested included polystyrene, polymethyl methacrylate, cesium iodide, and sodium iodide. Gamma sources included cesium 137, sodium 22, potassium 40, yttrium 88, thorium 232, and plutonium-beryllium

  2. The absorption of iodine-131 on a ceramic matrix

    International Nuclear Information System (INIS)

    Han, H.S.; Park, U.J.; Dash, A.

    2004-01-01

    The retention of 131 I on ceramic rod coated with silver nitrate followed by coating with a polyurethane membrane to be applied in brachytherapy was studied. The concentration of silver nitrate (20 g/l), the volume of 131 I as a sodium iodide solution (100 μl), the pH of the reaction mixture (pH 9) etc., were optimized to get a maximum uptake on the ceramic rod. The concentration of coating solution (5%, polyurethane in tetrahydrofuran) was also optimized to obtain a minimum leaching of 131 I activity in normal saline solution. After coating with a polyurethane membrane, the 131 I absorbed on the ceramic rod exhibited low leachability (0.03%). This method can be applied for the preparation of 125 I interstitial sources to be used in eye and prostate cancer therapy. (author)

  3. Performance Testing and Validation Plan for HMS4 Quantitative Gamma Measurements, K-25/K-27 D&D Project, East Tennessee Technology Park, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Thiesing, J. W.; Donohoue, Tom; McCague, Jim; Martin, Ray; Royce, Ralph; Thomas, Troy

    2008-04-14

    The Holdup Measurement System 4 (HMS4) is a portable thallium activated sodium iodide (NaI[Tl]) gamma ray energy spectrometer that, when properly calibrated, is able to make quantifiable assessment of U-235 holdup in the presence of other uranium isotopes and prevailing background radiation. The use and calibration of the HMS4 is based upon the methodologies defined by Russo in La-14206, (Russo 2005), where detection efficiency determination protocols are defined (called Generalized Geometry Holdup [GGH]). The GGH methodology together with attenuation correction algorithms and other modeling parameters are combined in the HMS4 software package to provide a comprehensive tool for conducting in situ gamma-ray measurements. The fundamental principles of these capabilities are discussed.

  4. A Scintillometer Assembly for Geological Survey

    International Nuclear Information System (INIS)

    Dissing, E.; Landstroem, O.

    1965-12-01

    An instrument for gamma radiation measurements in connection with geological survey is described. It consists of a scintillation detector with a 5x6 inch sodium iodide crystal and a pulse height analyzer with four independent channels. In field survey work these channels are usually set in fixed positions to record different components of the gamma radiation simultaneously in order to facilitate an identification of the radioactive mineral from which the radiation originates. However, the instrument can also be used for more detailed study of gamma spectra either in the field or in the laboratory. The methods for interpretation of gamma spectra from radioactive ores are briefly reviewed, and a few typical results are given from car-borne and air-borne surveys

  5. Comparison of gamma densitometer detectors used in loss of coolant studies

    International Nuclear Information System (INIS)

    Shipp, R.L.

    1979-01-01

    Ionization chamber type gamma detectors are used in water-steam density measurements in loss of coolant studies at Oak Ridge National Laboratory. Ionization chambers have replaced current-mode scintillation detectors to obtain stability and freedom from magnetic field interference. However, this change results in some loss of fast transient response. Results of studies comparing the transient response of ionization chamber detectors, plastic scintillation detectors, and sodium iodide (NaI) detectors to rapid changes in gamma intensity demonstrate that plastic scintillation detectors have the fastest response and most closely reproduce the transient; ionization chambers have an initial fast response followed by a slower response, which may produce errors in fast transient measurements; and NaI scintillation detectors have a moderately fast initial response followed by an extremely slow response, which produces errors in even slow transient measurements

  6. An Aerial Radiological Survey of the Nevada Test Site - Area 10 Corrective Action Unit 367

    International Nuclear Information System (INIS)

    Lyons, Craig

    2010-01-01

    A series of aerial radiological surveys were conducted over the Sedan, Uncle, and Ess ground zero areas in Area 10. The surveys were performed in November 2009 utilizing a large array of helicopter mounted sodium iodide detectors. The purpose of the survey was to update the previous radiological survey levels of the environment and surrounding areas of the ground zeros. Gross Counts, inferred exposure rates, man-made activity, and Americium-241 activity, as calculated from the aerial data are presented in the form of isopleth maps superimposed on imagery of the surveyed areas. In addition, spectral products are included that identify Cesium-137, Americium-241 and Cobalt-60 as the primary radionuclides present within the survey area.

  7. Radionuclides Activity and Radiological Hazard Assessment in Bananas Samples Exported to Iraq

    International Nuclear Information System (INIS)

    Al-Juboury, B.Kh.; Akram, M.A.

    2016-01-01

    The average concentration of radio nuclide's in the various banana samples were collected from being the most popular markets in Baghdad city - Iraq were measured by use Sodium Iodide Thallium [NaI(Tl)] detector.The radio nuclide's observed with reliable regularity belonged to the series-decay naturally occurring radionuclide’s headed by 232 U and 232 Th as well as the non-series nuclide, 40 K and 137 Cs.The average concentration of 40 K was found the least average concentration value recorded as 876.74625 Bq kg -1 .The average concentration of 238 U was 28.6425 Bqkg -1 for 232 Th, it was found to have the average concentration 14.1805 Bqkg -1 .The cesium concentration in the sample was found in the healthy range

  8. The in vivo measurement of radiocaesium activity in broiler chickens

    International Nuclear Information System (INIS)

    Poeschl, M.; Balas, J.

    2000-01-01

    Contamination of certain areas of Europe with radiocaesium from the Chernobyl accident led to a higher 137 Cs accumulation (i.e. 300-600 Bq kg -1 ) in grain and to potential post-accident contamination of broiler chickens. In future, such contamination may require a simple determination of the 137 Cs activity concentration in broiler chicken meat which would lead to measures for preventing the recommended limits of radionuclide contamination of the meat for human consumption from being exceeded. This paper describes the development of a rapid method for the in vivo monitoring of the broiler chicken using a lead-shielded sodium iodide detector. The method enables simply fixed live chicken to be monitored, the results showing a good correlation (R 2 =0.98) with measurements of meat from chicken previously monitored in vivo prior to slaughter

  9. Influence of agents that enhance lethal effects of radiation on the damage to bacterial membranes by x rays and ultraviolet light

    International Nuclear Information System (INIS)

    Cancelliere, G.; Giacchi, P.; Misiti-Dorello, P.; Quintiliani, M.

    1975-01-01

    Radiation damage to the cell membrane of E. coli B/r was evaluated by the release of intracellular K + ions as a function of radiation dose. It was found that x-ray-induced K + loss was (i) not affected by the presence of oxygen; (ii) enhanced by sodium iodide (NaI), iodoacetic acid (IAA), iodopropionic acid (IPA), and iodoacetamide (IAM) when cells were irradiated while in equilibrium with air; (iii) still enhanced by NaI, but not by IAM, when cell suspensions were bubbled with N 2 or O 2 before and during irradiation; (iv) decreased by N-ethylmaleimide (NEM) under any irradiation conditions. It was also found that both NEM and iodine-containing compounds protected cells from membrane damage caused by exposure to uv light. Parallel experiments carried out on cell survival confirmed the lack of correlation between the damage responsible for the loss of intracellular K + and that responsible for cell killing

  10. A comparative study of 19-iodo cholesterol-125I 3-acetate and Na 125I in liquid scintillation measurements

    International Nuclear Information System (INIS)

    Rodriguez Barquero, L.; Grau Malonda, A.; Los Arcos Merino, J. M.; Grau Carles, A.

    1994-01-01

    A comparative study of performance of 19-iodo cholesterol 1 25I 3-acetate and sodium iodide samples labeled with 125I is presented for liquid scintillation counting measurements. Quench effect, count rate stability and spectral evolution of samples have been followed for several weeks in Toluene, Hisafe II, Instagel, Dioxane-naphthalene and Toluene-alcohol scintillators. Organic samples have negligible quench effect in the interval of I concentration of 0-90 μg and inorganic samples only show a very small variation, lower than 12%, for Dioxane-naphthalene, in the same range of concentration. Satisfactory stability is obtained in general for both, organic and inorganic samples, but small counting losses, 0.03% for 19-iodocholesterol 1 I 3-acetate samples in Tolue ne-alcohol and 0 .04% for Na 125I samples in Dioxane-naphthalene and Toluene-alcohol, have been reported. (Author) 8 refs

  11. Convenient method of simultaneously analyzing aluminum and magnesium in pharmaceutical dosage forms using californium-252 thermal neutron activation

    International Nuclear Information System (INIS)

    Landolt, R.R.; Hem, S.L.

    1983-01-01

    A commercial antacid suspension containing aluminum hydroxide and magnesium hydroxide products was used as a model sample to study the use of a californium-252 thermal neutron activation as a method for quantifying aluminum content as well as for the simultaneous assay of aluminum and magnesium. A 3.5-micrograms californium-252 source was used for the activation, and the induced aluminum-28 and magnesium-27 activity was simultaneously measured by sodium iodide crystal gamma-ray spectrometry using dual single-channel analyzers and scalers. The antacid suspension was contained in a chamber designed with the unique capability of serving as the container for counting the induced radioactivity in addition to being the irradiation chamber itself. This pilot study demonstrated that use of more intense californium-252 sources, which are commonly available, would provide a method that is competitive with the ethylenediaminetetraacetic acid titration method in precision and in other aspects as well

  12. A Scintillometer Assembly for Geological Survey

    Energy Technology Data Exchange (ETDEWEB)

    Dissing, E; Landstroem, O

    1965-12-15

    An instrument for gamma radiation measurements in connection with geological survey is described. It consists of a scintillation detector with a 5x6 inch sodium iodide crystal and a pulse height analyzer with four independent channels. In field survey work these channels are usually set in fixed positions to record different components of the gamma radiation simultaneously in order to facilitate an identification of the radioactive mineral from which the radiation originates. However, the instrument can also be used for more detailed study of gamma spectra either in the field or in the laboratory. The methods for interpretation of gamma spectra from radioactive ores are briefly reviewed, and a few typical results are given from car-borne and air-borne surveys.

  13. Burn-Up Determination by High Resolution Gamma Spectrometry: Spectra from Slightly-Irradiated Uranium and Plutonium between 400-830 keV

    International Nuclear Information System (INIS)

    Forsyth, R.S.; Ronqvist, N.

    1966-08-01

    Previously published studies of the short-cooled fission product spectra of irradiated uranium have been severely restricted by the poor energy resolution of the sodium iodide detectors used. In this report are presented fission product spectra of irradiated uranium and plutonium obtained by means of a lithium-drifted germanium detector. The resolved gamma peaks have been assigned to various fission products by correlation of measured energy and half-life values with published data. By simultaneous study of the spectra of two irradiated mixtures of plutonium and uranium, the possibility of using the activities of Ru-103 and Ru-106 as a measure of the relative fission rate in U-235 and Pu-239 has been briefly examined

  14. Assessment of natural radionuclide content in deposits from drinking water purification station and excess lifetime cancer risk due to gamma radioactivity

    International Nuclear Information System (INIS)

    Issa, S.A.M.; Uosif, M.A.M.; Tammam, M.; Elsaman, R.

    2012-01-01

    The concentrations of natural radionuclide in deposits samples taken from Thirty-six drinking water purification stations have been measured and determined using gamma-ray spectrometry system using (sodium iodide NaI (Tl) detector). Knowledge of radioactivity present in deposits of drinking water purification station enables one to assess any possible radiological hazard to humankind by the use of such materials. The natural radionuclide ( 226 Ra, 232 Th and 40 K) contents have been analyzed for the deposits samples with an aim of evaluating the radiation hazard nature. The Absorbed dose rate, The annual effective dose equivalent, Radium equivalent activities, Hazard indices (H ex and H in ), Gamma index, Excess lifetime cancer risk and Annual gonadal dose equivalent were calculated for investigated area. Results of the study could serve as a