[Organization and functioning of health services of the IMSS-Solidaridad program].
Velázquez-Díaz, G
1992-01-01
In this report the organization and performance of the IMSS-Solidaridad Program of Mexico is described. This program is managed by the Mexican Institute for Social Security, which services 10.5 million inhabitants of the rural underserved areas, with federal government resources in 18 states. This study compares the structure and functioning of the IMSS-Solidaridad Program with Local Health Systems, as they have been proposed by the Panamerican Health Organization for country members and by the Ministry of Health of Mexico, particularly in relation to the decision-making process at local level. Some assets and limitations of the IMSS-Solidaridad Program are analyzed and, finally, concrete procedures to improve coordination between the IMSS-Solidaridad Program and other health services for similar populations (populations without social security protection) in Mexico are suggested, with the purpose of using resources more adequately and succeed in the national goal to achieve equity in health.
Paola Adanari Ortega-Ceballos; Jyoti Mudgal; Yvonne Flores; Leonor Rivera-Rivera; Juan Carlos Díaz-Montiel; Jorge Salmerón
2007-01-01
OBJETIVO: Identificar la ocurrencia de violencia de pareja y evaluar los factores asociados a este fenómeno en una muestra de trabajadoras del Instituto Mexicano del Seguro Social (IMSS) Morelos. MATERIAL Y MÉTODOS: Un total de 1 173 mujeres de la cohorte de trabajadores del IMSS proporcionó información sobre frecuencia y percepción de severidad de violencia psicológica, física o sexual durante los últimos 12 meses. El estudio se realizó en el estado de Morelos, entre octubre de 1998 y marzo ...
Lugo-Palacios, David G; Cairns, John; Masetto, Cynthia
2016-08-02
The prevalence of diabetes among adults in Mexico has increased markedly from 6.7 % in 1994 to 14.7 % in 2015. Although the main diabetic complications can be prevented or delayed with timely and effective primary care, a high percentage of diabetic patients have developed them imposing an important preventable burden on Mexican society and on the health system. This paper estimates the financial and health burden caused by potentially preventable hospitalisations due to diabetic complications in hospitals operated by the largest social security institution in Latin America, the Mexican Institute of Social Security (IMSS), in the period 2007-2014. Hospitalisations in IMSS hospitals whose main cause was a diabetic complication were identified. The financial burden was estimated using IMSS diagnostic-related groups. To estimate the health burden, DALYs were computed under the assumption that patients would not have experienced complications if they had received timely and effective primary care. A total of 322,977 hospitalisations due to five diabetic complications were identified during the period studied, of which hospitalisations due to kidney failure and diabetic foot represent 78 %. The financial burden increased by 8.4 % in real terms between 2007 and 2014. However, when measured as cost per IMSS affiliate, it decreased by 11.3 %. The health burden had an overall decrease of 13.6 % and the associated DALYs in 2014 reached 103,688. Resources used for the hospital treatment of diabetic complications are then not available for other health care interventions. In order to prevent these hospitalisations more resources might need to be invested in primary care; the first step could be to consider the financial burden of these hospitalisations as a potential target for switching resources from hospital care to primary care services. However, more evidence of the effectiveness of different primary care interventions is needed to know how much of the burden could
Determinants of partner violence in health workers of IMSS, Morelos
Ortega-Ceballos, Paola Adanari; Mudgal, Jyoti; Flores, Yvonne; Rivera-Rivera, Leonor; Díaz-Montiel, Juan Carlos; Salmerón, Jorge
2007-01-01
OBJETIVO: Identificar la ocurrencia de violencia de pareja y evaluar los factores asociados a este fenómeno en una muestra de trabajadoras del Instituto Mexicano del Seguro Social (IMSS) Morelos. MATERIAL Y MÉTODOS: Un total de 1 173 mujeres de la cohorte de trabajadores del IMSS proporcionó información sobre frecuencia y percepción de severidad de violencia psicológica, física o sexual durante los últimos 12 meses. El estudio se realizó en el estado de Morelos, entre octubre de 1998 y marzo ...
Directory of Open Access Journals (Sweden)
Paola Adanari Ortega-Ceballos
2007-10-01
Full Text Available OBJETIVO: Identificar la ocurrencia de violencia de pareja y evaluar los factores asociados a este fenómeno en una muestra de trabajadoras del Instituto Mexicano del Seguro Social (IMSS Morelos. MATERIAL Y MÉTODOS: Un total de 1 173 mujeres de la cohorte de trabajadores del IMSS proporcionó información sobre frecuencia y percepción de severidad de violencia psicológica, física o sexual durante los últimos 12 meses. El estudio se realizó en el estado de Morelos, entre octubre de 1998 y marzo de 2000. Se emplearon modelos de regresión logística politómica a fin de estimar razones de momios para distintos grados de violencia. RESULTADOS: Se observó una alta prevalencia de violencia. Los principales factores asociados fueron la relación de pareja y el consumo de alcohol; el estado emocional de la pareja en el hogar; la tensión laboral de la mujer y los antecedentes de violencia en la infancia. CONCLUSIONES: Los principales factores determinantes de violencia de pareja son potencialmente modificables a través de intervenciones que ayuden a manejar el nivel de tensión. Es necesario tomar en cuenta estos hallazgos al planear programas preventivos de violencia de pareja en México.OBJECTIVE: To study the prevalence of partner violence, and to identify the associated risk factors in a sample of female workers of IMSS (Mexican Social Security Institute, Morelos State. MATERIAL AND METHODS: Cross-sectional data from 1 173 women participating in the cohort study of IMSS workers are utilized to study these associations. The study provides information on frequency of psychological, physical or sexual violence and perception of severity during the 12 months prior to the time of data collection. It was carried out in Morelos between October 1998 and March 2000. Polytomous logistic regression models were used to obtain odds ratios for different degrees of partner violence. RESULTS: A high prevalence of partner violence is observed in the sample
Ramos-Ligonio Angel; Ramírez-Sánchez Michaía Elián; González-Hernández Juan Carlos; Rosales-Encina José Luis; López-Monteon Aracely
2006-01-01
OBJETIVO: Determinar la prevalencia de anticuerpos contra Trypanosoma cruzi en donadores del Hospital General Regional del Instituto Mexicano del Seguro Social (IMSS) en la ciudad de Orizaba, Veracruz. MATERIAL Y MÉTODOS: Se examinaron muestras de donadores del banco de sangre del Hospital General Regional (HGRO) del IMSS para la búsqueda de antiT. cruzi por ELISA, Western blot e IFI, utilizando una proteína recombinante (MBP::Hsp70) y un extracto crudo de epimastigotes. Las muestras fueron o...
[Determinants of partner violence in health workers of IMSS, Morelos].
Ortega-Ceballos, Paola Adanari; Mudgal, Jyoti; Flores, Yvonne; Rivera-Rivera, Leonor; Díaz-Montiel, Juan Carlos; Salmerón, Jorge
2007-01-01
To study the prevalence of partner violence, and to identify the associated risk factors in a sample of female workers of IMSS (Mexican Social Security Institute), Morelos State. Cross-sectional data from 1 173 women participating in the cohort study of IMSS workers are utilized to study these associations. The study provides information on frequency of psychological, physical or sexual violence and perception of severity during the 12 months prior to the time of data collection. It was carried out in Morelos between October 1998 and March 2000. Polytomous logistic regression models were used to obtain odds ratios for different degrees of partner violence. A high prevalence of partner violence is observed in the sample. Main factors associated with higher severity of violence are state of the relationship and alcohol intake, emotional status of the couple at home, work burden of the woman, and a history of violence in childhood. All these factors are potentially modifiable through interventions aimed at stress reduction. These results should be considered when developing preventive programs against partner violence in Mexico.
Directory of Open Access Journals (Sweden)
José Luis Vázquez-Martínez
2005-07-01
Full Text Available OBJECTIVE: To estimate the prevalence and risk factors for overweight (OW and obesity (OB in women working at the Mexican Social Security Institute (IMSS, per its abbreviation in Spanish in Mexico City, using two different classification criteria. MATERIAL AND METHODS: A cross-sectional study was performed from July 1999 to September 2000. It included 588 women 20 to 65 years of age and who were working at the IMSS. The criteria used to estimate the prevalence of OW and OB were the WHO criteria and the Mexican Official Norm (NOM for the integrated management of obesity in Mexico. RESULTS: The frequency of OB, according to WHO criteria, was 27.6% (26% adjusted and for OW 43.2% (40.2% adjusted. According to the NOM, the levels of OB in those with short height (1.50 m. Comparison of BMI between the two height groups showed no differences. The risk factor associated with OB and OW was age. Education and exercise were protective factors. CONCLUSIONS: The high prevalences detected in this particular working group highlight the importance of prevention and control of OB in health personnel because it can result in a high number of disability and premature retirement due to disease. The use of the NOM criteria for the identification of women at risk may be useful for early detection of high-risk groups.OBJETIVO: Estimar la prevalencia de obesidad (OB y sobrepeso (SP en mujeres trabajadoras del IMSS en la Ciudad de México, aplicando dos criterios de clasificación y su asociación con algunos factores de riesgo. MATERIAL Y MÉTODOS: Estudio transversal realizado entre julio de 1999 y septiembre de 2000 que incluyó a 588 mujeres trabajadoras en el IMSS entre 20 y 65 años. Los criterios utilizados para medir la prevalencia de OB y SP fueron los propuestos por la OMS y la Norma Oficial Mexicana para el manejo integral de la obesidad (NOM. RESULTADOS: La frecuencia de OB fue 27.6% (26% ajustada y de SP de 43.2% (40.2% ajustada al aplicar los criterios de
Héctor Gómez-Dantés; José Luis Vázquez-Martínez; Sonia B Fernández-Cantón
2006-01-01
OBJETIVO: Comparar la prevalencia y determinar los factores de riesgo asociados a la violencia entre las mujeres derechohabientes del IMSS y sin servicios de seguridad social (SSS). MATERIAL Y MÉTODOS: Se analizó la información sobre violencia doméstica de la ENVIM notificada por las mujeres usuarias de los servicios de salud del IMSS y de la población femenina sin servicios de seguridad social SSA y seguro popular. El análisis bivariado y multivariado se realizó en STATA V.7. RESULTADOS: La ...
Directory of Open Access Journals (Sweden)
Héctor Gómez-Dantés
2006-01-01
Full Text Available OBJETIVO: Comparar la prevalencia y determinar los factores de riesgo asociados a la violencia entre las mujeres derechohabientes del IMSS y sin servicios de seguridad social (SSS. MATERIAL Y MÉTODOS: Se analizó la información sobre violencia doméstica de la ENVIM notificada por las mujeres usuarias de los servicios de salud del IMSS y de la población femenina sin servicios de seguridad social SSA y seguro popular. El análisis bivariado y multivariado se realizó en STATA V.7. RESULTADOS: La prevalencia en mujeres derechohabientes del IMSS de violencia psicológica fue 18%; seguida por la física (9.1%; la sexual (6.7% y la económica (5%. En mujeres sin seguridad social fue: psicológica (21.4%; física (10.5%; sexual (7.5% y económica (5.2%. Las mujeres entre 25 y 44 años, con nivel secundaria o menor instrucción educativa, casadas, sufren de mayor violencia doméstica en ambas poblaciones. Los factores de riesgo identificados para los cuatro tipos de violencia fueron el consumo de alcohol en la pareja, las edades jóvenes, el estar casadas o en unión libre y el antecedente de violencia ejercida por los padres u otros miembros de la familia. CONCLUSIONES: La violencia es ligeramente mayor en mujeres sin seguridad social. El consumo diario de alcohol por su pareja es un factor de riesgo muy importante para cualquier tipo de violencia, en particular cuando el consumo es diario o casi habitual. La detección de la violencia doméstica en los servicios de salud es indispensable para conocer su magnitud como problema social.OBJECTIVE: To compare the prevalence of violence and determine its risk factors among women who use Mexican Social Services (IMSS clinics and do not have access to social security services. MATERIAL AND METHODS: Sociodemographic data linked to domestic violence reported by women attending the Mexican Institute of Social Security (IMSS health services was analyzed. Bivariate and multivariate analysis was performed using
Directory of Open Access Journals (Sweden)
Luz Myriam Reynales-Shigematsu
2005-12-01
Full Text Available OBJETIVO: Estimar los costos de atención médica en el Instituto Mexicano del Seguro Social (IMSS, Delegación Morelos, de las enfermedades mayores atribuibles al consumo de tabaco. MATERIAL Y MÉTODOS: Las estimaciones de costos se realizaron desde la perspectiva del proveedor utilizando la metodología de costeo de enfermedad. Un panel de expertos multidisciplinario caracterizó la atención médica, en términos de la frecuencia de utilización de servicios en el primer y segundo niveles de atención, considerando el grado de severidad de la enfermedad. Los costos unitarios se estimaron en pesos mexicanos del 2001. Para estimar los costos atribuibles al tabaquismo se utilizó la fracción atribuible al consumo de tabaco para cada enfermedad (FA. RESULTADOS: Los costos promedio anuales de atención médica en el primer y segundo niveles de atención en la Delegación Morelos corresponden a 79 530 pesos para infarto agudo del miocardio (IAM, 73 303 pesos para enfermedad pulmonar obstructiva crónica (EPOC y 102 215 pesos para cáncer de pulmón (CP. El costo total anual para la Delegación por estas tres enfermedades asciende a 147 millones 390 mil 688 pesos. Los costos atribuibles al consumo de tabaco corresponden a 124 millones de pesos, lo cual equivale a 7.3% del presupuesto anual de la Delegación. CONCLUSIONES: Estos resultados confirman el alto costo de la atención médica en el IMSS correspondiente a las enfermedades atribuibles al consumo de tabaco. Se recomienda realizar este estudio en el plano nacional, de tal manera que los tomadores de decisiones tengan herramientas para fortalecer las políticas de control del tabaquismo en México.OBJECTIVE: To estimate the cost of medical care for the major diseases attributable to tobacco consumption at the IMSS, Morelos. MATERIAL AND METHODS: A cost of illness (COI analysis was carried out from the perspective of the health provider. An expert panel characterized medical care in primary and
Directory of Open Access Journals (Sweden)
Angel Ramos-Ligonio
2006-02-01
Full Text Available OBJETIVO: Determinar la prevalencia de anticuerpos contra Trypanosoma cruzi en donadores del Hospital General Regional del Instituto Mexicano del Seguro Social (IMSS en la ciudad de Orizaba, Veracruz. MATERIAL Y MÉTODOS: Se examinaron muestras de donadores del banco de sangre del Hospital General Regional (HGRO del IMSS para la búsqueda de antiT. cruzi por ELISA, Western blot e IFI, utilizando una proteína recombinante (MBP::Hsp70 y un extracto crudo de epimastigotes. Las muestras fueron obtenidas entre los meses de octubre de 2001 a enero de 2002. RESULTADOS: Los 420 donadores de sangre analizados fueron seronegativos para HBV, HCV, BrA, VDRL y HIV. Después del tamizaje de los 420 donadores, se identificaron dos individuos seropositivos por las pruebas de ELISA, Western blot e IFI, con una seroprevalencia de 0.48%. CONCLUSIONES: En este estudio se muestran evidencias de seropositividad para T. cruzi en donadores de sangre del HGRO, lo que sugiere la existencia de riesgo de contaminación por transfusión sanguínea. Por tal motivo, es necesario aplicar programas para el tamizaje serológico a través de técnicas inmunológicas con alta sensibilidad y especificidad.OBJECTIVE: To estimate the prevalence of antibodies against Trypanosoma cruzi in blood donors from Hospital General Regional (HGRO of the Mexican Institute of Social Security (IMSS per its abbreviation in Spanish. MATERIAL AND METHODS: Between October 2001 and January 2002, blood samples were collected from voluntary donors at the blood bank of the Hospital General Regional of IMSS in Orizaba; Veracruz, Mexico. The samples were assayed for anti-T. cruzi by ELISA, Western blot and IFI, using a recombinant protein (MBP::Hsp70, and crude extract from epimastigotes. RESULTS: A total of 420 blood donors were studied; two of them were seropositive for ELISA, Western blot and IFI, with a seroprevalence of 0.48%. CONCLUSIONS: Some blood donors at the HGRO hospital were seropositive for T
International Nuclear Information System (INIS)
1995-01-01
This manual is intended to be read by people who will use the IMSS system on a regular basis, who will be referred to as IMSS system operators. Portions of this manual are intended to be read by operations staff who need to understand certain aspects of the IMSS system since their staff will be working near the IMSS vehicle and docking station. Sections 1 through 4 provide general information of interest both to operations staff and IMSS system operators. The remainder of this manual provides information of interest mainly to IMSS system operators. This manual is customized for use of the IMSS system at the DOE Idaho National Engineering Laboratory (INEL), specifically in Buildings 628 through 634 at INEL's Radioactive Waste Management Complex (RWMC). The vast majority of this manual is applicable to any installation site--only a few minor details are specific to INEL. This manual will be complemented by one-on-one training provided to INEL personnel by the IMSS system development team
Energy Technology Data Exchange (ETDEWEB)
Herrera Garcia, Antonio [HGZ No. 1 del IMSS en Aguascalientes (Mexico); Morillon Galvez, David [Instituto de Ingenieria de la UNAM (Mexico)
2003-07-01
The hospitals, since they operate 24 hours a day during 365 days per year, are great consumers of energy. They consume up to 75% of fuels for their transformation in thermal energy. Consequently it is important to study and determine the structure of the power consumption in hospitals. In the present work with the study case of the Instituto Mexicano del Seguro Social (IMSS) development in Aguascalientes, Mexico a pattern of power consumption and the distribution of annual consumption of electricity and diesel oil from 1993 to 2001 is obtained. It is observed in the study case, that with the work of the engineering equipment of conservation they managed themselves to reduce to the annual consumption of diesel oil and electricity with economic savings greater than 1'200,000 of 1999 pesos. [Spanish] Los hospitales, como trabajan 24 al dia los 365 dias del ano, son grandes consumidores de energia. Ellos consumen hasta el 75% de combustibles para su transformacion en energia termica. En consecuencia es importante estudiar y determinar la estructura del consumo energetico en hospitales. En el presente trabajo con el estudio de caso del conjunto del Instituto Mexicano del Seguro Social (IMSS) en Aguascalientes, Mexico se obtiene el patron de consumo energetico y la distribucion de consumo anual de electricidad y diesel de l993 a 2001. Se observa en el caso de estudio, que con el trabajo del equipo de ingenieros de conservacion se lograron reducir los consumos anuales de diesel y electricidad con ahorros economicos mayores a 1,200,000 pesos de 1999.
Directory of Open Access Journals (Sweden)
Svetlana V Doubova
2013-11-01
Full Text Available Objective. To estimate the requirements of human resources (HR of two models of care for diabetes patients: conventional and specific, also called DiabetIMSS, which are provided in primary care clinics of the Mexican Institute of Social Security (IMSS. Materials and methods. An evaluative research was conducted. An expert group identified the HR activities and time required to provide healthcare consistent with the best clinical practices for diabetic patients. HR were estimated by using the evidence-based adjusted service target approach for health workforce planning; then, comparisons between existing and estimated HRs were made. Results. To provide healthcare in accordance with the patients’ metabolic control, the conventional model required increasing the number of family doctors (1.2 times nutritionists (4.2 times and social workers (4.1 times. The DiabetIMSS model requires greater increase than the conventional model. Conclusions. Increasing HR is required to provide evidence-based healthcare to diabetes patients.
[Depressive disorder and issues related to DiabetIMSS beneficiaries].
Fu-Espinosa, Mario; Trujillo-Olivera, Laura Elena
2013-01-01
Diabetes mellitus type 2 (DM2) is the leading cause of death in people from 15 to 64 years in Mexico, and other regions in the world. For the chronic nature of diabetes and complications caused by inadequate metabolic control, patients may have mood disorders such as depression. Several studies have demonstrated higher prevalence of depression in diabetic patients than in general population. Our objective: is to determine prevalence and factors associated with depressive disorder in patients with type 2 diabetes mellitus enrolled in DiabetIMSS during 2010. Analytical study with random probability sampling. The analysis included prevalence, odds ratios with 95% confidence intervals. The Center Epidemiological Studies Depression Instrument was used. Prevalence of depression was 32.7% at 95% CI = 26.4-38.9%), 67.3% for women, 32.7 % for men; good metabolic control was 51.9%, CI = 95% (45.13-58.66%). We found a higher prevalence of depressive disorders than in the general population, no statistical association with glycemic control, keeping a greater proportion of women as well as the main aspect of depression associated with the perception of emotional support. We discuss DiabetIMSS program effectiveness.
Directory of Open Access Journals (Sweden)
Ramos-Ligonio Angel
2006-01-01
Full Text Available OBJETIVO: Determinar la prevalencia de anticuerpos contra Trypanosoma cruzi en donadores del Hospital General Regional del Instituto Mexicano del Seguro Social (IMSS en la ciudad de Orizaba, Veracruz. MATERIAL Y MÉTODOS: Se examinaron muestras de donadores del banco de sangre del Hospital General Regional (HGRO del IMSS para la búsqueda de antiT. cruzi por ELISA, Western blot e IFI, utilizando una proteína recombinante (MBP::Hsp70 y un extracto crudo de epimastigotes. Las muestras fueron obtenidas entre los meses de octubre de 2001 a enero de 2002. RESULTADOS: Los 420 donadores de sangre analizados fueron seronegativos para HBV, HCV, BrA, VDRL y HIV. Después del tamizaje de los 420 donadores, se identificaron dos individuos seropositivos por las pruebas de ELISA, Western blot e IFI, con una seroprevalencia de 0.48%. CONCLUSIONES: En este estudio se muestran evidencias de seropositividad para T. cruzi en donadores de sangre del HGRO, lo que sugiere la existencia de riesgo de contaminación por transfusión sanguínea. Por tal motivo, es necesario aplicar programas para el tamizaje serológico a través de técnicas inmunológicas con alta sensibilidad y especificidad.
A cost-benefit analysis of the Mexican Social Security Administration's family planning program.
Nortman, D L; Halvas, J; Rabago, A
1986-01-01
A cost-benefit analysis of the family planning program of the Mexican Social Security System (IMSS) was undertaken to test the hypothesis that IMSS's family planning services yield a net savings to IMSS by reducing the load on its maternal and infant care service. The cost data are believed to be of exceptionally high quality because they were empirically ascertained by a retrospective and prospective survey of unit time and personnel costs per specified detailed type of service in 37 IMSS hospitals and 16 clinics in 13 of Mexico's 32 states. Based on the average cost per case, the analysis disclosed that for every peso (constant 1983 currency) that IMSS spent on family planning services to its urban population during 1972-1984 inclusive, the agency saved nine pesos. The article concludes by raising the speculative question as to the proportion of the births averted by the IMSS family planning program that would have been averted in the absence of IMSS's family planning services.
Experience with the 67 Megatron in the IMSS Specialties Hospital Num. 25 in Monterrey
International Nuclear Information System (INIS)
Gonzalez V, V.Z.
1989-01-01
The basic characteristics of the 67 Megatron, the property of Hospital Num. 25 of IMSS in Monterrey, are presented here and also other data of interest to the department of oncology and the physics area. (Author)
Das, B.; Wilson, M.; Divakarla, M. G.; Chen, W.; Barnet, C.; Wolf, W.
2013-05-01
Algorithm Development Library (ADL) is a framework that mimics the operational system IDPS (Interface Data Processing Segment) that is currently being used to process data from instruments aboard Suomi National Polar-orbiting Partnership (S-NPP) satellite. The satellite was launched successfully in October 2011. The Cross-track Infrared and Microwave Sounder Suite (CrIMSS) consists of the Advanced Technology Microwave Sounder (ATMS) and Cross-track Infrared Sounder (CrIS) instruments that are on-board of S-NPP. These instruments will also be on-board of JPSS (Joint Polar Satellite System) that will be launched in early 2017. The primary products of the CrIMSS Environmental Data Record (EDR) include global atmospheric vertical temperature, moisture, and pressure profiles (AVTP, AVMP and AVPP) and Ozone IP (Intermediate Product from CrIS radiances). Several algorithm updates have recently been proposed by CrIMSS scientists that include fixes to the handling of forward modeling errors, a more conservative identification of clear scenes, indexing corrections for daytime products, and relaxed constraints between surface temperature and air temperature for daytime land scenes. We have integrated these improvements into the ADL framework. This work compares the results from ADL emulation of future IDPS system incorporating all the suggested algorithm updates with the current official processing results by qualitative and quantitative evaluations. The results prove these algorithm updates improve science product quality.
KEK-IMSS Slow Positron Facility
Energy Technology Data Exchange (ETDEWEB)
Hyodo, T; Wada, K; Yagishita, A; Kosuge, T; Saito, Y; Kurihara, T; Kikuchi, T; Shirakawa, A; Sanami, T; Ikeda, M; Ohsawa, S; Kakihara, K; Shidara, T, E-mail: toshio.hyodo@kek.jp [High Energy Accelerator Research Organization (KEK) 1-1 Oho, Tsukuba, Ibaraki, 305-0801 (Japan)
2011-12-01
The Slow Positron Facility at the Institute of Material Structure Science (IMSS) of High Energy Accelerator Research Organization (KEK) is a user dedicated facility with an energy tunable (0.1 - 35 keV) slow positron beam produced by a dedicated 55MeV linac. The present beam line branches have been used for the positronium time-of-flight (Ps-TOF) measurements, the transmission positron microscope (TPM) and the photo-detachment of Ps negative ions (Ps{sup -}). During the year 2010, a reflection high-energy positron diffraction (RHEPD) measurement station is going to be installed. The slow positron generator (converter/ moderator) system will be modified to get a higher slow positron intensity, and a new user-friendly beam line power-supply control and vacuum monitoring system is being developed. Another plan for this year is the transfer of a {sup 22}Na-based slow positron beam from RIKEN. This machine will be used for the continuous slow positron beam applications and for the orientation training of those who are interested in beginning researches with a slow positron beam.
Directory of Open Access Journals (Sweden)
Mejía-Aranguré Juan
2008-11-01
Full Text Available Abstract Background Osteoarthritis (OA is one of the main causes of disability worldwide, especially in persons >55 years of age. Currently, controversy remains about the best therapeutic alternative for this disease when evaluated from a cost-effectiveness viewpoint. For Social Security Institutions in developing countries, it is very important to assess what drugs may decrease the subsequent use of medical care resources, considering their adverse events that are known to have a significant increase in medical care costs of patients with OA. Three treatment alternatives were compared: celecoxib (200 mg twice daily, non-selective NSAIDs (naproxen, 500 mg twice daily; diclofenac, 100 mg twice daily; and piroxicam, 20 mg/day and acetaminophen, 1000 mg twice daily. The aim of this study was to identify the most cost-effective first-choice pharmacological treatment for the control of joint pain secondary to OA in patients treated at the Instituto Mexicano del Seguro Social (IMSS. Methods A cost-effectiveness assessment was carried out. A systematic review of the literature was performed to obtain transition probabilities. In order to evaluate analysis robustness, one-way and probabilistic sensitivity analyses were conducted. Estimations were done for a 6-month period. Results Treatment demonstrating the best cost-effectiveness results [lowest cost-effectiveness ratio $17.5 pesos/patient ($1.75 USD] was celecoxib. According to the one-way sensitivity analysis, celecoxib would need to markedly decrease its effectiveness in order for it to not be the optimal treatment option. In the probabilistic analysis, both in the construction of the acceptability curves and in the estimation of net economic benefits, the most cost-effective option was celecoxib. Conclusion From a Mexican institutional perspective and probably in other Social Security Institutions in similar developing countries, the most cost-effective option for treatment of knee and/or hip OA
Directory of Open Access Journals (Sweden)
M.O. Coreño Juárez
2015-01-01
Full Text Available A pesar de que existen muchas pruebas para realizar tamiz para la detección de infección por el virus de la inmunodeficiencia humana (VIH o para sífilis, hasta el momento en nuestro país no se ha evaluado una prueba dual que permita disminuir las oportunidades perdidas para la detección de ambas enfermedades. El objetivo del estudio fue conocer la confiabilidad de una prueba rápida dual de tamiz para la detección de VIH y sífilis en población derechohabiente de tres delegaciones del Instituto Mexicano del Seguro Social (IMSS. Se realizó un estudio epidemiológico que permitió conocer el valor diagnóstico de la prueba, a través de la determinación de sus valores de sensibilidad y especificidad, con la finalidad de evaluar su uso como prueba de tamizaje para la infección por el VIH/sida y para sífilis, con una tasa de detección similar a la de las pruebas convencionales utilizadas por separado.
García-Gómez, Francisco; Ramírez-Méndez, Fernando
2015-01-01
To analyze the number of articles of Revista Médica del Instituto Mexicano del Seguro Social (Rev Med Inst Mex Seguro Soc) in the Scopus database and describe principal quantitative bibliometric indicators of scientific publications during the period between 2005 to 2013. Scopus database was used limited to the period between 2005 to 2013. The analysis cover mainly title of articles with the title of Revista Médica del Instituto Mexicano del Seguro Social and its possible modifications. For the analysis, Scopus, Excel and Access were used. 864 articles were published during the period between 2005 to 2013 in the Scopus database. We identified authors with the highest number of contributions including articles with the highest citation rate and forms of documents cited. We also divided articles by subjects, types of documents and other bibliometric indicators which characterize the publications. The use of Scopus brings the possibility of analyze with an external tool the visibility of the scientific production published in the Revista Médica del IMSS. The use of this database also contributes to identify the state of science in México, as well as in the developing countries.
Gibbons, FX; Buunk, BP
Development and validation of a measure of individual differences in social comparison orientation (the Iowa-Netherlands Comparison Orientation Measure [INCOM]) are described. Assuming that the tendency toward social comparison is universal, the scale was constructed so as to be appropriate to and
Directory of Open Access Journals (Sweden)
María Esther Quiroz
2010-12-01
Full Text Available OBJECTIVE. To estimate the annual cost of treating patients with cirrhosis at the Mexican Institute of Social Security (IMSS per its abbreviation in Spanish. MATERIAL AND METHODS. The annual cost of treating three stages of cirrhosis (Child-Pugh A, Child-Pugh B and Child-Pugh C was estimated using micro-costing techniques and medical experts. These results were compared and contrasted with prices reported by IMSS. RESULTS. The annual cost of treatment, in USA dollars, by Child-Pugh stage was: a micro-costing results: $1110.17 stage A, $549.55 stage B and $348.16 stage C; b opinion of medical experts: $1 633.64, $6564.04 and $19660.35, respectively; and c IMSS costs: $4269.00, $16949.63 and $30249.25, respectively. CONCLUSIONS. The cost of treating patients with cirrhosis is considerable, and costs increase as the disease worsens. Cost estimates vary depending on the source of information, and the methodology used. There are discrepancies between the procedures reported in medical records and treatment recommendations by IMSS liver experts.OBJETIVO. Estimar el costo anual de atención de pacientes con cirrosis hepática en el Instituto Mexicano del Seguro Social (IMSS. MATERIAL Y MÉTODOS. Se estimó el costo de atención de la cirrosis en tres estadios de la enfermedad (Child Pugh A, Child Pugh B y Child Pugh C mediante micro-costeo y consulta a expertos. Los resultados se compararon entre sí, y con los costos reportados por el IMSS. RESULTADOS. El costo anual de atención en dólares por estadio fue: a con microcosteo $1110.17 etapa A, $549.55 etapa B y $348.16 etapa C, respectivamente; b mediante consulta a expertos $1633.64, $6564.04 y $19660.35, respectivamente; y c con costos del IMSS $4269.00, $16949.63 y $30249.25, respectivamente. CONCLUSIONES. El tratamiento de cirrosis es costoso y generalmente los costos aumentan al avanzar la enfermedad. Además, los costos varían dependiendo de la fuente de información y la metodología utilizada
Social Comparison in the Classroom: A Review
Dijkstra, Pieternel; Kuyper, Hans; van der Werf, Greetje; Buunk, Abraham P.; van der Zee, Yvonne G.
2008-01-01
This article reviews research conducted on social comparison processes in the classroom since Festinger proposed his theory of social comparison. It covers the theoretical framework of social comparison theory, and it is organized around the following themes: motives for social comparison, dimensions of social comparison, direction of social…
Brain networks of social comparison.
Kedia, Gayannée; Lindner, Michael; Mussweiler, Thomas; Ihssen, Niklas; Linden, David E J
2013-03-27
Social comparison, that is, the process of comparing oneself to other people, is a ubiquitous social cognitive mechanism; however, so far its neural correlates have remained unknown. The present study tested the hypothesis that social comparisons are supported by partly dissociated networks, depending on whether the dimension under comparison concerns a physical or a psychological attribute. We measured brain activity with functional MRI, whereas participants were comparing their own height or intelligence to that of individuals they personally know. Height comparisons were associated with higher activity in a frontoparietal network involved in spatial and numerical cognition. Conversely, intelligence comparisons recruited a network of midline areas that have been previously implicated in the attribution of mental states to oneself and others (Theory of mind). These findings suggest that social comparisons rely on diverse domain-specific mechanisms rather than on one unitary process.
Social Comparison in the Classroom : A Review
Dijkstra, Pieternel; Kuyper, Hans; van der Werf, Greetje; Buunk, Abraham P.; van der Zee, Yvonne G.
2008-01-01
This article reviews research conducted on social comparison processes in the classroom since Festinger proposed his theory of social comparison. It covers the theoretical framework of social comparison theory, and it is organized around the following themes: motives for social comparison,
Buunk, Abraham P.; Van der Zee, K.I.; Van Yperen, N.W.
2001-01-01
In a study among 72 nurses, the affective consequences of social comparison were examined and related to neuroticism, (N) and to social comparison orientation (SCO). Participants were confronted with a bogus interview with an upward versus a downward comparison target. Positive affect and
Buunk, Bram P.; Van der Zee, K.I.; VanYperen, Nico W.
2001-01-01
In a study among 72 nurses, the affective consequences of social comparison were examined and related to neuroticism (N) and to social comparison orientation (SCO). Participants were confronted with a bogus interview with an upward versus a downward comparison target. Positive affect and
An experimental manipulation of social comparison in social anxiety.
Mitchell, Melissa A; Schmidt, Norman B
2014-01-01
Negative self-appraisal is thought to maintain social anxiety particularly when comparing oneself to others. Work on social comparison suggests that gender may moderate the effects of social comparison in social anxiety. Self-appraisals of the desirability of one's personality may be more important to women, whereas self-appraisal of signs of anxiety may be more important to men. Within each gender, those with high social anxiety are expected to report more negative self-appraisal when comparing themselves to someone else described as high achieving. This study is the first we are aware of that examined gender-based interactive effects after a social comparison manipulation. Participants read a bogus profile of a fellow student's adjustment to college. They were randomly assigned to read a profile suggesting that the fellow student was "high achieving" or more normative in his/her achievements. When comparing to a "high achieving" individual, men with high social anxiety reported the most negative self-appraisals of their signs of anxiety. In addition, greater social anxiety was associated with a poorer self-appraisal of personality only among men. The implications of the findings for conceptualizing the role of social comparison in social anxiety are discussed.
Directory of Open Access Journals (Sweden)
Felicia Marie Knaul
2009-01-01
Full Text Available OBJETIVO: Calcular el costo de atención de las pacientes con cáncer de mama tratadas en el Instituto Mexicano del Seguro Social. MATERIAL Y MÉTODOS: A través del Sistema de Información Médico Operativa del IMSS, se conformó una cohorte de pacientes con diagnóstico reciente en 2002 que recibió seguimiento hasta finales de 2006. Se identificó el uso de recursos y se le adjudicó el costo de atención del IMSS. RESULTADOS: Sólo 14% se diagnosticó en fase I y 48% en las fases III-IV. El costo de atención promedio por año-paciente se estimó en 110 459 pesos y para las mujeres diagnosticadas en 2002 la etapa I tuvo un costo de 74 522 pesos, comparado con 102 042 en la etapa II, 154 018 en la etapa III y 199 274 en la IV. CONCLUSIONES: El cáncer mamario representa un presupuesto significativo en el IMSS y entre más tardía es la etapa de detección, más altos resultan los costos económicos por año-paciente y más baja la probabilidad de sobrevida a cinco años.OBJECTIVE: We studied the cost of health care for women with breast cancer treated at the Mexican Social Security Institute (IMSS, per its abbreviation in Spanish. MATERIAL AND METHODS: Using the Medical and Operative Information Systems of the IMSS, we constructed a cohort of patients diagnosed in 2002 and followed these patients to the end of 2006, identifying the use of resources and imputing the IMSS-specific cost structure. RESULTS: Only 14% of women were diagnosed in stage 1 and 48% were diagnosed in stages III-IV. The average cost of their medical care per patient-year was $MX110,459. Costs for stage 1 were $MX74,522 compared to $102,042 for stage II, and were $MX154,018 for stage III and $MX199,274 for stage IV. CONCLUSIONS: Breast cancer accounts for a significant part of the IMSS health budget. Later stage at diagnosis is associated with higher economic costs per patient-year of treatment and lower probability of five-year survival.
[Demographic aging and social security. The insufficiency of old age pensions].
Ham Chande, R
1993-01-01
The demographic transition is leading to demographic aging in Mexico, as lower fertility and greater life expectancy combine to produce absolute and percentage increases in the elderly population. Concern is growing about satisfying the material needs of the elderly population. Only a few developed countries are able to furnish adequate pensions to their retired workers through social security systems. In Mexico, class inequity is a greater determinant of the level of pension coverage than is generational solidarity. Mexico's 1990 census showed that the population of 81,250,000 was comprised of 24,517,000 economically active and 56,733,000 inactive persons. Of the 24,517,000 economically active, 7,282,000 mostly lower level employees and laborers were affiliated only with the Mexican Institute of Social Security (IMSS). 2,308,000 were covered by the IMSS and one of the complementary pension systems sponsored by the largest and most organized private companies. 2,629,000 were entitled to pensions through public sector employment and 584,000 through quasipublic employment. The remaining 11,571,000 had no rights to a pension. In other words, 47% of the labor force was not covered by any retirement pension system. 375,000 of the 5,007,000 persons over age 60 in the economically inactive population had some sort of pension from the IMSS. In 1990, 92% received the minimum pension, equivalent to 70% of the minimum salary. 229,000 had an IMSS pension and a complementary private pension. 196,000 pensioners in the public sector received an average pension of 1.5 times the minimum salary. 66,000 retired workers in quasipublic enterprises received pensions with automatic adjustments for inflation that frequently equaled 20 times the minimum salary. The total number of recipients of pensions of all types was 888,000,leaving 4,119,000 persons over 60 with no pension. Because of the deficiencies of the social security system, families must continue to be the institution that aids
Pinterest or Thinterest?: Social Comparison and Body Image on Social Media
Directory of Open Access Journals (Sweden)
Jennifer Lewallen
2016-03-01
Full Text Available Social media have become increasingly popular mechanisms for communication. Past research suggests a link between using social media, upward social comparison, and negative affect. This online experiment of US women ( N = 118 takes a media psychology approach to understanding how fitness images on the social networking website Pinterest contribute to social comparison as well as intentions to engage in extreme weight-loss behaviors. Findings suggest that individuals who follow more fitness boards on Pinterest are more likely to report intentions to engage in extreme weight-loss behaviors. Additionally, endorsement of an ideal female body type was positively related to both social comparison and intentions to engage in extreme weight-loss behaviors. Findings are discussed in light of social comparison theory, and suggestions are made are made for future experimental work.
Directory of Open Access Journals (Sweden)
Carlos Manuel Guerrero-López
2012-06-01
Full Text Available OBJETIVO: Calcular los costos por ausentismo laboral atribuibles al tabaquismo en los asegurados del IMSS y población ocupada en México para el periodo 2006-2009. MATERIAL y MÉTODOS: Los costos se estimaron usando fracciones atribuibles para cáncer pulmonar, enfermedad cerebrovascular, enfermedad pulmonar obstructiva crónica e infarto agudo de miocardio, así como registros de salarios y días de incapacidad por esas enfermedades en asegurados del IMSS. Los parámetros encontrados se extrapolaron a la población ocupada. RESULTADOS: El IMSS erogó 143.9 millones de pesos a precios de 2009 atribuibles al tabaquismo como subsidio por incapacidad en el período 2006-2009. La productividad perdida atribuible al tabaquismo en asegurados del IMSS ascendió a 298.2 millones de pesos y a 437.8 millones de pesos en población ocupada del país en el mismo período. CONCLUSIONES: El tabaquismo impone costos importantes a las instituciones de seguridad en el país y causa pérdidas en la productividad. Por tanto, deben fortalecerse las políticas gubernamentales de control del tabaco incluidas en el Convenio Marco para el Control del Tabaco.OBJECTIVE: To calculate the absenteeism costs by lung cancer, cerebrovascular disease, chronic obstructive pulmonary disease and acute myocardial infarction attributable to smoking in the Mexican Social Security Institute (IMSS and the occupied population from 2006 to 2009. MATERIALS AND METHODS: Productivity loss data from selected illnesses were obtained from IMSS records. The smoking attributable fraction was used, and extrapolation to occupied population was conducted. RESULTS: IMSS paid $143.9 million pesos (2009 prices attributable to smoking between 2006 and 2009. The productivity loss was $298.2 million pesos and $437.8 million pesos in the occupied population, attributable to smoking. CONCLUSIONS: Tobacco smoking implies costs to the individual, families and society, which urge to strengthen policies
Directory of Open Access Journals (Sweden)
Manuel Ildefonso Ruiz-Medina
2016-01-01
Full Text Available The present study analyzes and discloses the impact of base salary contribution in determining the amount of pension severance at old age and disability insurance, that covers the Law of the current Social Security for each case, is studied also causes the lack of knowledge of Social Security benefits by the workers. This requires a mixed methodological approach supported in the qualitative tradition of case study aimed to particularization and not generalization, which made it possible to link the obtained data with the theory, and to describe, analyze and explain the results found with the object of study. The results emerged from the application of the survey conducted with 22 items, whose questions were closed and structured with the method of Likert that were answered by 40 workers at two companies known as SMEs in the City of Culiacan, Sinaloa, Mexico, during the month March 2014. On completion of the analysis of the data collected, the results show a severe deterioration of pensions due to low wages and lack of jobs and declining resources with the new pension system of pensions and from the workers an almost total ignorance of the benefits that the law provides motivated by the lack of diffusion by the IMSS and the lack of enterprise training.
Directory of Open Access Journals (Sweden)
Xu Gong
Full Text Available Successful navigation of our complex social world requires the capability to recognize and judge the relative status of others. Hence, social comparison processes are of great importance in our interactions, informing us of our relative standing and in turn potentially motivating our behavior. However, so far few studies have examined in detail how social comparison can influence interpersonal decision-making. One aspect of social decision-making that is of particular importance is cooperative behavior, and identifying means of maintaining and promoting cooperation in the provision of public goods is of vital interest to society. Here, we manipulated social comparison by grading performance rankings on a reaction time task, and then measured cooperative decisions via a modified Public Goods Game (PGG. Findings revealed that individuals ranked highest tended to be more cooperative as compared to those who placed in the bottom rank. Interestingly, this effect was regardless of whether the comparison group members were the subsequent players in the PGG or not, and this effect was stronger in those with higher social orientation. In summary, the present research shows how different social comparison processes (assessed via social rankings can operate in our daily interaction with others, demonstrating an important effect on cooperative behavior.
Wang, Jin-Liang; Wang, Hai-Zhen; Gaskin, James; Hawk, Skyler
2017-01-01
The increased pervasiveness of social media use has raised questions about potential effects on users' subjective well-being, with studies reaching contrasting conclusions. To reconcile these discrepancies and shed new light on this phenomenon, the current study examined: (1) whether upward social comparison and self-esteem mediate the association between social networking site (SNS) usage and users' subjective well-being, and (2) whether the association between SNS usage and upward social comparison is moderated by users' social comparison orientation. Data from 696 participants were collected. Structural equation modeling revealed that upward social comparison and self-esteem mediated the relationship between SNS usage and users' subjective well-being. We found that social comparison orientation moderated the association between passive SNS usage and users' upward social comparison. Specifically, social comparison orientation strengthened the association between passive SNS usage and upward social comparison. The results might suggest a process through which passive SNS usage is related to subjective well-being, and identify a context under which these associations may differ.
What Is Social Comparison and How Should We Study It?
Wood, Joanne V.
1996-01-01
Examines frequently used measures and procedures in social comparison research. The question of whether a method truly captures social comparison requires a clear understanding of what social comparison is; hence a definition of social comparison is proposed, multiple ancillary processes in social comparison are identified, and definitional…
Directory of Open Access Journals (Sweden)
Jin-Liang Wang
2017-05-01
Full Text Available The increased pervasiveness of social media use has raised questions about potential effects on users’ subjective well-being, with studies reaching contrasting conclusions. To reconcile these discrepancies and shed new light on this phenomenon, the current study examined: (1 whether upward social comparison and self-esteem mediate the association between social networking site (SNS usage and users’ subjective well-being, and (2 whether the association between SNS usage and upward social comparison is moderated by users’ social comparison orientation. Data from 696 participants were collected. Structural equation modeling revealed that upward social comparison and self-esteem mediated the relationship between SNS usage and users’ subjective well-being. We found that social comparison orientation moderated the association between passive SNS usage and users’ upward social comparison. Specifically, social comparison orientation strengthened the association between passive SNS usage and upward social comparison. The results might suggest a process through which passive SNS usage is related to subjective well-being, and identify a context under which these associations may differ.
Wang, Jin-Liang; Wang, Hai-Zhen; Gaskin, James; Hawk, Skyler
2017-01-01
The increased pervasiveness of social media use has raised questions about potential effects on users’ subjective well-being, with studies reaching contrasting conclusions. To reconcile these discrepancies and shed new light on this phenomenon, the current study examined: (1) whether upward social comparison and self-esteem mediate the association between social networking site (SNS) usage and users’ subjective well-being, and (2) whether the association between SNS usage and upward social comparison is moderated by users’ social comparison orientation. Data from 696 participants were collected. Structural equation modeling revealed that upward social comparison and self-esteem mediated the relationship between SNS usage and users’ subjective well-being. We found that social comparison orientation moderated the association between passive SNS usage and users’ upward social comparison. Specifically, social comparison orientation strengthened the association between passive SNS usage and upward social comparison. The results might suggest a process through which passive SNS usage is related to subjective well-being, and identify a context under which these associations may differ. PMID:28553256
SOCIAL SUPPORT AND STRESS - THE ROLE OF SOCIAL-COMPARISON AND SOCIAL-EXCHANGE PROCESSES
BUUNK, BP; HOORENS, [No Value
1992-01-01
This paper first presents four different conceptualizations of social support: social integration, satisfying relationships, perceived helpfulness and enacted support. Then, classic and contemporary social comparison theory and social exchange theory are analysed as they are two theoretical
Selective Self-Presentation and Social Comparison Through Photographs on Social Networking Sites.
Fox, Jesse; Vendemia, Megan A
2016-10-01
Through social media and camera phones, users enact selective self-presentation as they choose, edit, and post photographs of themselves (such as selfies) to social networking sites for an imagined audience. Photos typically focus on users' physical appearance, which may compound existing sociocultural pressures about body image. We identified users of social networking sites among a nationally representative U.S. sample (N = 1,686) and examined women's and men's photo-related behavior, including posting photos, editing photos, and feelings after engaging in upward and downward social comparison with others' photos on social networking sites. We identified some sex differences: women edited photos more frequently and felt worse after upward social comparison than men. Body image and body comparison tendency mediated these effects.
Health Care in Mexico: Is U.S. Partnership/Intervention an Advisable Course of Action?
2011-10-26
July 15, 2011, http:// www.imss.gob.mx/ en /institute. html (accessed 4 September 2011). 4 Instituto de Seguridad y Servicios Sociales de los...www.usatoday.com/news/world/2009-08-31- mexico -health-care_N.htm (accessed 4 September 2011). Instituto de Seguridad y Servicios Sociales de los Trabajadores...Seguro Social , Last modified on July 15, 2011, http://www.imss.gob.mx/ en /institute. html (accessed 4 September 2011). 3 access.2 The IMSS, by its
Buunk, A.P.; Bennenbroek, F.T.C.; Stiegelis, H.E.; Bergh, A.C.M. van den; Sanderman, R.; Hagedoorn, M.
2012-01-01
Objective: To examine how social comparison orientation (SCO) moderates the effects of three types of social comparison information on the global quality of life of cancer patients 2 weeks and 3 months later. Design: Cancer patients (n = 226) were provided with social comparison information just
Buunk, Abraham P.; Bennenbroek, Femke T. C.; Stiegelis, Heidi E.; van den Bergh, Alfons C. M.; Sanderman, Robbert; Hagedoorn, Mariet
2012-01-01
Objective: To examine how social comparison orientation (SCO) moderates the effects of three types of social comparison information on the global quality of life of cancer patients 2 weeks and 3 months later. Design: Cancer patients (n=226) were provided with social comparison information just prior
Immediacy bias in social-emotional comparisons.
White, Katherine; Van Boven, Leaf
2012-08-01
In seven studies of naturally occurring, "real-world" emotional events, people demonstrated an immediacy bias in social-emotional comparisons, perceiving their own current or recent emotional reactions as more intense compared with others' emotional reactions to the same events. The events examined include crossing a scary bridge (study 1a), a national tragedy (study 1b), terrorist attacks (studies 2a and 3b), a natural disaster (study 2b), and a presidential election (study 3b). These perceived differences between one's own and others' emotions declined over time, as relatively immediate and recent emotions subsided, a pattern that people were not intuitively aware of (study 2c). This immediacy bias in social-emotional comparisons emerged for both explicit comparisons (studies 1a, 1b, and 3b), and for absolute judgments of emotional intensity (studies 2a, 2b, and 3a). Finally, the immediacy bias in social-emotional comparisons was reduced when people were reminded that emotional display norms might lead others' appearances to understate emotional intensity (studies 3a and 3b). Implications of these findings for social-emotional phenomena are discussed.
Shipley, Andrew
2008-04-01
Social Identity Theory and the concept of social comparison have inspired research on individuals, addressing effects of personal and environmental factors in directing social attention. The theory's conceptual origins, however, suggest that social comparison may have behavioral implications as well. Such behaviors may include attempts by an individual to enhance the relative status of his ingroup on a salient dimension of comparison. Such behavior is referred to as "social competition." In two studies, the effects of social comparison and social competition were measured in the real-world environment of community food drives. Participants were aggregated by household; 600 households in upper middle-class neighborhoods in Eugene and Salem, Oregon, were contacted. In Study 1 of 300 households, it was hypothesized that inclusion of a social competition cue in requests for donation would significantly increase the likelihood of donation. This hypothesis was supported. Study 2 was done to clarify the possible role in a social comparison of perceived ingroup inferiority in the prior observed increase in donations. The inclusion of a social comparison cue in the donation request significantly increased donations in households of the second study. The findings suggest that researchers should expand study of the theory's behavioral implications, including the role of social comparison in prosocial behavior.
Learning in clinical practice: Stimulating and discouraging response to social comparison.
Raat, Janet; Kuks, Jan; Cohen-Schotanus, Janke
2010-01-01
Social comparison theory is relevant for learning in general. In a clinical context, we examined four hypotheses concerning: preferred other to compare with, preferred direction of comparison, response to social comparison and influence of personal social comparison orientation (SCO). To investigate the relevance of social comparison for clinical workplace learning. Students (n = 437) from nine different hospitals completed two questionnaires measuring their SCO and the direction of and response to their comparisons. t-tests were used to analyse the data. Students substantially did compare. They preferred to compare with peer students more than with residents or staff, and with peers doing better more than with peers doing worse. Their response to social comparison was more often stimulating for learning than discouraging. Students high in SCO reported a stronger stimulating and discouraging response to their comparisons than students low in SCO. Social comparison does play a role in clinical workplace learning. The mainly stimulating response to social comparison indicates a positive learning influence. The preferred comparison with peers emphasizes the role of peers in the learning process. Further research should focus on student comparison behaviour and on situations that strengthen the positive effects of social comparison and reduce the negative or obstructing ones.
Inferior or superior : socials comparison in Dutch and Spanish organizations
Carmona Rodriguez, Carmen
2006-01-01
SUMMARY Social comparison is an automatic and daily process through which individuals acquire information about themselves. Since Festinger (1954) postulated his assumptions on social comparison, extensive research has focused on understanding and explaining the social comparison process. In
Yang, Chia-Chen; Holden, Sean M; Carter, Mollie D K
2018-01-11
Social comparison on social media has received increasing attention, but most research has focused on one type of social comparison and its psycho-emotional implications. Little is known about how different types of social comparison influence youth's identity development. Drawing on the theories of identity processing styles and social comparison, we examined how two different forms of social comparison on social media related to three identity processing styles, which in turn predicted youth's global self-esteem and identity clarity. We surveyed 219 college freshmen (M age = 18.29; 74% female) once in the Fall and once in the Spring. Social comparison of ability on social media was related to concurrent diffuse-avoidant identity processing style, which predicted lower identity clarity months later. In contrast, social comparison of opinion on social media did not influence college freshmen's global self-esteem and identity clarity through identity processing styles. The findings clarified the implications of online social comparison for youth's identity development.
Assertiveness, submissive behaviour and social comparison.
Gilbert, P; Allan, S
1994-09-01
This paper explores the relationship between a new assertiveness measure (the Scale for Interpersonal Behaviour--SIB), social comparison and submissive behaviour. The paper investigates these measures in relation to the personality traits of neuroticism and introversion. Findings suggest: (a) that social comparison may be an important variable in assertiveness and submissive behaviour and shows a strong relationship to neuroticism and introversion; (b) that submissive behaviour is not the mirror opposite of assertive behaviour; and (c) submissive behaviour seems more strongly associated with introversion and neuroticism than assertive performance.
New directions in social comparison research
Buunk, Abraham (Bram); Mussweiler, T
2001-01-01
This article notices that social comparison theory has developed from being a focused theoretical statement on the use of others for self-evaluation into a lively and varied area of research encompassing many different paradigms, approaches and applications. A recent 'renaissance' in social
Buunk, Bram P.
1995-01-01
Illuminates the nature and direction of social comparison research using a sample of 168 Dutch individuals. Some of the findings revealed uncertainty and frustration related to a need for social comparison, a desire more for information than affiliation about similar others, and the influence of health problems in evaluating one's situation. (RJM)
Shifting social identities as a strategy for deflecting threatening social comparisons.
Mussweiler, T; Gabriel, S; Bodenhausen, G V
2000-09-01
Results of three studies suggest that the multifaceted nature of identity provides a strategic basis for reducing the threat involved in upward social comparisons. After performing worse than a comparison standard, people may strategically emphasize aspects of their identity that differentiate them from the standard, thereby making the standard less relevant for self-evaluation. On the basis of previous research showing that persons low in self-esteem are less likely to make effective use of self-protection strategies, we hypothesized that this strategy of deflecting the threat involved in upward comparison (i.e., decreasing perceived comparability by emphasizing an unshared social identity) would be used primarily by persons who are characteristically high in self-esteem. This pattern was confirmed in three studies. Moreover, use of the strategy was associated with relatively more positive affect following threatening upward comparisons.
Cost of the Cervical Cancer Screening Program at the Mexican Social Security Institute
Directory of Open Access Journals (Sweden)
Víctor Granados-García
2014-09-01
Full Text Available Objective. To estimate the annual cost of the National Cervical Cancer Screening Program (CCSP of the Mexican Institute of Social Security (IMSS. Materials and methods. This cost analysis examined regional coverage rates reported by IMSS. We estimated the number of cytology, colposcopy, biopsy and pathology evaluations, as well as the diagnostic test and treatment costs for cervical intraepithelial neoplasia grade II and III (CIN 2/3 and cervical cancer. Diagnostic test costs were estimated using a micro-costing technique. Sensitivity analyses were performed. Results. The cost to perform 2.7 million cytology tests was nearly 38 million dollars, which represents 26.1% of the total program cost (145.4 million. False negatives account for nearly 43% of the program costs. Conclusion. The low sensitivity of the cytology test generates high rates of false negatives, which results in high institutional costs from the treatment of undetected cervical cancer cases.
Differential Social Comparison Processes in Women with and without Eating Disorder Symptoms
Corning, Alexandra F.; Krumm, Angela J.; Smitham, Lora A.
2006-01-01
On the basis of predictions from social comparison theory (L. Festinger, 1954) and informed by findings from the social comparison and eating disorder literatures, hypotheses were tested regarding the social comparison behaviors of women with eating disorder symptoms and their asymptomatic peers. Results indicated differentiating social-cognitive…
Loss aversion, social comparison and physical abilities at younge age
Nakamoto, Yasuhiro; Sato, Masayuki
2011-01-01
We examine the relationship between competitive behavior and social comparison where in this paper competitive behavior is measured by physical ability performance. In particular, by incorporating social comparison into prospect theory, we directly estimate the degree of loss aversion with social comparison, a concept we term `ALJ' (Avoiding Loss relative to the Joneses). Our main findings are as follows: (i) the estimated value function is refracted at another's gain and the average estimate...
Motives for Social Comparison.
Helgeson, Vicki S.; Mickelson, Kristin D.
1995-01-01
A set of motive statements for social comparison was elicited from one group of subjects and then rated in terms of usefulness by a second group of subjects. Analysis of these statements revealed six motives in response to two different hypothetical scenarios: self-evaluation, common bond, self-improvement, self-enhancement, altruism, and…
Self-schema and social comparison explanations of body dissatisfaction: a laboratory investigation.
van den Berg, Patricia; Thompson, J Kevin
2007-03-01
The current study was an investigation of the self-schema and social comparison theories of body dissatisfaction. The social comparison manipulation consisted of exposure to one of three levels of comparison figure: upward, downward, or no comparison. Two different imagery exercises served to prime either a participants' appearance self-schema, or a non-appearance schema. Participants completed state measures of body image and mood at pre- and posttest. Results indicated no significant interaction between priming and social comparison and no significant main effect for priming. However, there was a significant effect of social comparison, such that those in the downward comparison condition showed an increase in body satisfaction and positive mood. Results are discussed in the context of self-schema theory and social comparison, and suggestions are given for future research that might further shed light on these theoretical approaches for understanding body dissatisfaction.
Social comparisons and quality of life following a prostate cancer diagnosis.
Umstead, Kendall L; Kalia, Sarah S; Madeo, Anne C; Erby, Lori H; Blank, Thomas O; Visvanathan, Kala; Roter, Debra L
2018-02-09
The objective was to explore the relationships among cognitive appraisals of prostate cancer (challenge, threat, and harm/loss), social comparisons, and quality of life in men previously diagnosed. Design, Sample, & Methods: Men who had participated in prostate cancer support groups completed a cross-sectional questionnaire (N = 189). Multivariable linear regression was used to evaluate social comparisons as mediators of quality of life while controlling for uncertainty and optimism. Positive and negative social comparisons were parallel mediators of the relationships between challenge or threat appraisals and quality of life, while only negative social comparisons mediated the relationship between harm/loss appraisals and quality of life. These findings demonstrate the importance of social comparisons in accounting for the effect of cognitive appraisals of prostate cancer on quality of life among men in support groups. Implications for Psychosocial Providers: Interventions to improve quality of life could address reduction of maladaptive comparisons, a strategy that could be tailored based on the patient's appraisal of prostate cancer.
Buunk, AP; Belmonte, J; Peiro, JM; Zurriaga, R; Gibbons, FX
2005-01-01
This paper describes the development and the properties of the INCOM-E, the Spanish language version of the INCOM, a measure to assess individual differences in social comparison orientation that was originally developed simultaneously in English and in Dutch. In both Study 1 (including 212
The relationship between social comparison processes and personality
VanderZee, K; Buunk, B; Sanderman, R
The relationship between social comparison processes and personality was examined in a sample of cancer patients (Study 1) and in a random population sample (Study 2). Previous studies showed that the need for comparison, its affective consequences and the tendency to make self-enhancing comparisons
Knobloch-Westerwick, Silvia
2015-01-01
Much research has demonstrated negative impacts of idealized-body imagery exposure on body satisfaction. Yet, paradoxically, media with such imagery attract mass audiences. Few studies showed women's body satisfaction increased due to thin-ideal exposure. The kind of social comparison women engage in (self-evaluation vs. self-improvement) may explain these inconsistent findings and the paradoxical attraction to thin-ideal messages. Across 5 days, thin-ideal messages were presented to 51 women; self-evaluation and self-improvement social comparisons as well as body satisfaction were measured each day. A linear positive change in body satisfaction emerged. Greater self-improvement social comparisons increased this change, whereas greater self-evaluation social comparisons reduced it. Extent of both social comparison types changed during the prolonged exposure. A greater tendency to compare one's body with others' improved body satisfaction through self-improvement social comparisons and fostered weight-loss behaviors through self-evaluation social comparisons.
Brain mechanisms of social comparison and their influence on the reward system.
Kedia, Gayannée; Mussweiler, Thomas; Linden, David E J
2014-11-12
Whenever we interact with others, we judge them and whenever we make such judgments, we compare them with ourselves, other people, or internalized standards. Countless social psychological experiments have shown that comparative thinking plays a ubiquitous role in person perception and social cognition as a whole. The topic of social comparison has recently aroused the interest of social neuroscientists, who have begun to investigate its neural underpinnings. The present article provides an overview of these neuroimaging and electrophysiological studies. We discuss recent findings on the consequences of social comparison on the brain processing of outcomes and highlight the role of the brain's reward system. Moreover, we analyze the relationship between the brain networks involved in social comparisons and those active during other forms of cognitive and perceptual comparison. Finally, we discuss potential future questions that research on the neural correlates of social comparison could address.
The role of social comparison in social judgments of dental appearance: An experimental study.
Al-Kharboush, Ghada H; Asimakopoulou, Koula; AlJabaa, AlJazi H; Newton, J Tim
2017-06-01
The objective of this study was to examine the influence of social comparison on social judgments of dental malalignment in a sample of females. In a Repeated measures design, N=218 female participants of which N=128 were orthodontic patients (mean age 31.4) and N=90 controls (mean age 26.1) rated their satisfaction with their facial appearance after viewing stereotypically beautiful images of faces (experimental condition) or houses (neutral condition). After 4-6 weeks participants returned to view an image of a female with severe crowding and were asked to make judgments of social competence (SC), intellectual ability (IA), psychological adjustment (PA) and attractiveness (A). The comparison of social judgments between high comparers (High SocComp) and low comparers (Low SocComp) was not statistically significant; (SC (t (204)=0.30, p=0.76), IA (t (204)=0.14, p=0.89) PA (t (204)=0.004, p=0.996), A (t(204)=1.26, (p=0.209). However, dentally induced social judgments (DISJ) was statistically significant in the clinical sample than the non-clinical sample SC (t (204)=0.784, p=0.434), IA (t (204)=0.2.15, p=0.033) PA (t (204)=-0.003, p=0.997) A (t (204)=1.58, p=0.116). Social comparison has little impact on DISJ. However, there are differences in DISJs between individuals who seek treatment for their malocclusion versus the nonclinical population; the reason for this is unclear but does not appear to be the result of adoption of societal standards of beauty and instead suggests individual ranking of important 'beauty areas' may play a role. This paper uses social comparison theory to investigate the basis of judgments in regards to dental appearance. The findings of this research may help to identify individuals who are more susceptible to societal pressures towards non-ideal dentitions. This will help clinicians become more aware of the patient's comparison orientation, which seems to have an impact on satisfaction with treatment outcomes. This study may form the
Social comparison processes and catastrophising in fibromyalgia: A path analysis.
Cabrera-Perona, V; Buunk, A P; Terol-Cantero, M C; Quiles-Marcos, Y; Martín-Aragón, M
2017-06-01
In addition to coping strategies, social comparison may play a role in illness adjustment. However, little is known about the role of contrast and identification in social comparison in adaptation to fibromyalgia. To evaluate through a path analysis in a sample of fibromyalgia patients, the association between identification and contrast in social comparison, catastrophising and specific health outcomes (fibromyalgia illness impact and psychological distress). 131 Spanish fibromyalgia outpatients (mean age: 50.15, SD = 11.1) filled out a questionnaire. We present a model that explained 33% of the variance in catastrophising by direct effects of more use of upward contrast and downward identification. In addition, 35% of fibromyalgia illness impact variance was explained by less upward identification, more upward contrast and more catastrophising and 42% of the variance in psychological distress by a direct effect of more use of upward contrast together with higher fibromyalgia illness impact. We suggest that intervention programmes with chronic pain and fibromyalgia patients should focus on enhancing the use of upward identification in social comparison, and on minimising the use of upward contrast and downward identification in social comparison.
Armaou, M; Schumacher, L; Grunfeld, E A
2017-10-04
Purpose Returning to work is a process that is intertwined with the social aspects of one's life, which can influence the way in which that person manages their return to work and also determines the support available to them. This study aimed to explore cancer patients' perceptions of the role of their social context in relation to returning to work following treatment. Methods Twenty-three patients who had received a diagnosis of either urological, breast, gynaecological, or bowel cancer participated in semi-structured interviews examining general perceptions of cancer, work values and perceptions of the potential impact of their cancer diagnosis and treatment on work. Interviews were analysed using the iterative process of Framework Analysis. Results Two superordinate themes emerged as influential in the return to work process: Social support as a facilitator of return to work (e.g. co-workers' support and support outside of the workplace) and Social comparison as an appraisal of readiness to return to work (e.g. comparisons with other cancer patients, colleagues, and employees in other organisations or professions). Conclusions Two functions of the social context of returning to work after cancer were apparent in the participants' narrative: the importance of social support as a facilitator of returning to work and the utilisation of social comparison information in order to appraise one's readiness to return to work. The role of social context in returning to work has largely been absent from the research literature to date. The findings of this study suggest that social support and social comparison mechanisms may have a significant impact on an individual's successful return to the workplace.
Saliency of social comparison dimensions
Kuyper, H.
2007-01-01
The present article discusses a theory of the saliency of social comparison dimensions and presents the results of an experiment about the effects of two different experimental situations on the saliency of exterior, task-related and socio-emotional dimensions. Saliency was operationalized with a
Social comparison as a predictor of body dissatisfaction: A meta-analytic review.
Myers, Taryn A; Crowther, Janis H
2009-11-01
The relationship between social comparison and body dissatisfaction was examined using meta-analysis. Several demographic and methodological variables were examined as potential moderators. Data from 156 studies (189 effect sizes) showed that social comparison was related to higher levels of body dissatisfaction. The effect for social comparison and body dissatisfaction was stronger for women than men and inversely related to age. This effect was stronger when social comparison was directly measured rather than inferred. No differences emerged for the presence of eating psychopathology, study design, or object of comparison. Results confirm theory and research suggesting that comparing oneself unfavorably to another on the basis of appearance may lead to dissatisfaction with one's own appearance. Moderator variables refine our understanding of the social comparison-body dissatisfaction relationship. These constructs and their relationship should be explored further in future studies. PsycINFO Database Record 2009 APA, all rights reserved.
Engaging energy saving through motivation-specific social comparison
Petkov, Petromil;Köbler, Felix;Foth, Marcus;Medland, Richard C.;Krcmar, Helmut
2014-01-01
Comparison is widely used in research projects and commercial products whose goal is to motivate energy saving at home. This research builds on fundamental theories from social psychology in an attempt to shed light on how to motivate consumers to conserve energy by providing relevant people for social comparison depending on consumer?s motivation to compare. To support the research process, the mobile application EnergyWiz was developed through a theory-driven design approach. Along with oth...
Social Comparison: The End of a Theory and the Emergence of a Field
Buunk, Abraham P.; Gibbons, Frederick X.
2007-01-01
The past and current states of research on social comparison are reviewed with regard to a series of major theoretical developments that have occurred in the past 5 decades. These are, in chronological order: (1) classic social comparison theory, (2) fear-affiliation theory, (3) downward comparison theory, (4) social comparison as social…
Affect and identification in social comparison after loss of work
Ybema, J.F.; Buunk, Abraham (Bram); Heesink, J.A.M.
This study examined the effects of social comparison among 172 individuals who had recently lost their jobs in a collective dismissal of employees. A part of a fictitious interview with another fired person was presented to the participants. This interview contained social comparison information on
For whom does social comparison induce risk-taking?
Dijk, O.
2017-01-01
A ‘bonus culture’ among financial traders has been blamed for the excessive risk-taking in the run-up to the latest financial crisis. I show that when individuals are more social gain seeking than social loss averse (i.e. gloating is stronger than envy), social comparison predicts more risk-taking
Tabaquismo en profesionales de la salud del Instituto Mexicano del Seguro Social, Morelos
Directory of Open Access Journals (Sweden)
Jorge Salmerón-Castro
2002-01-01
Full Text Available Objetivo. Determinar la prevalencia de hábito tabáquico por categoría laboral en trabajadores de la salud del Instituto Mexicano del Seguro Social (IMSS, en el estado de Morelos, México. Material y métodos. Se realizó un estudio transversal en 3 133 empleados de los servicios médicos de las 23 unidades médicas con que cuenta la delegación Morelos del IMSS, durante el periodo de octubre de 1998 a marzo de 2000. Mediante un cuestionario autoaplicable se recolectó información sobre patrones de consumo de tabaco en distintas etapas de la vida, así como algunas características demográficas y categoría laboral. Se estimaron prevalencias e intervalos de confianza al 95% por grupos de edad y sexo para distintas categorías laborales. Resultados. De los 3 133 empleados participantes, 53.4% (IC 95% 50.8-56.8 de los hombres y 27.4% (IC 95% 25.4-29.3 de las mujeres contaban con historia de tabaquismo en algún momento de la vida. La prevalencia de tabaquismo activo fue de 28.3 % (IC 95% 25.6-31.0 y 14.4% (IC 95% 12.8-15.9 en hombres y mujeres, respectivamente. Entre los hombres, los médicos presentan una prevalencia de tabaquismo activo menor (20.9% que la observada entre trabajadores de otras áreas: personal administrativo (33.0% y personal técnico de distintas categorías (26.6%. Las mujeres muestran en general una prevalencia menor que los hombres en todas las categorías, y las enfermeras presentan una prevalencia discretamente menor (12.5% que las médicas (16.0%. Conclusiones. El patrón del consumo de tabaco observado en profesionales de la salud del IMSS Morelos muestra una prevalencia menor a la observada en población general. Sin embargo, es necesario continuar con programas para desalentar el consumo del tabaco entre profesionales de la salud, y tratar de hacerlos concientes acerca de la influencia positiva que pueden y deben ejercer en la sociedad para impulsar programas integrados contra el consumo del tabaco y la adicción a
Student distress in clinical workplace learning: differences in social comparison behaviours.
Janet Raat, A N; Schönrock-Adema, Johanna; van Hell, E Ally; Kuks, Jan B M; Cohen-Schotanus, Janke
2015-03-01
In medical education, student distress is known to hamper learning and professional development. To address this problem, recent studies aimed at helping students cope with stressful situations. Undergraduate students in clinical practice frequently use experiences of surrounding peers to estimate their abilities to master such challenging situations. This use of the experiences of others, known as social comparison, may affect student distress both positively and negatively. To find characteristics of a beneficial use of social comparison, we examined differences in comparison behaviours between students expressing low and high levels of distress. The participants in our study, response rate 93% (N = 301/321), were all medical students in their first year in clinical practice. They completed the General Health Questionnaire (GHQ-12) to measure distress, and three separate questionnaires to measure: (1) orientation to comparison, (2) motive for comparison, and (3) interpretation of comparison. Differences were analysed using multivariate analysis of variance. Although all students were oriented towards social comparison, the analyses showed that this orientation was less apparent among low-distress students. Besides, the low-distress students were less inclined to use motives indicative for comparisons with peers perceived as performing worse and were less negative in the interpretations of their comparisons. As social comparison is frequently used among all students, we recommend to make them aware of their comparison behaviours and inform them about the pros and cons of the distinguished aspects of the comparison process.
[Rapid Response obstetrics Team at Instituto Mexicano del Seguro Social,enabling factors].
Dávila-Torres, Javier; González-Izquierdo, José de Jesús; Ruíz-Rosas, Roberto Aguli; Cruz-Cruz, Polita Del Rocío; Hernández-Valencia, Marcelino
2015-01-01
There are barriers and enablers for the implementation of Rapid Response Teams in obstetric hospitals. The enabling factors were determined at Instituto Mexicano del Seguro Social (IMSS) MATERIAL AND METHODS: An observational, retrospective study was conducted by analysing the emergency obstetric reports sent by mobile technology and e-mail to the Medical Care Unit of the IMSS in 2013. Frequency and mean was obtained using the Excel 2010 program for descriptive statistics. A total of 164,250 emergency obstetric cases were reported, and there was a mean of 425 messages per day, of which 32.2% were true obstetric emergencies and required the Rapid Response team. By e-mail, there were 73,452 life threatening cases (a mean of 6 cases per day). A monthly simulation was performed in hospitals (480 in total). Enabling factors were messagés synchronisation among the participating personnel,the accurate record of the obstetrics, as well as the simulations performed by the operational staff. The most common emergency was pre-eclampsia-eclampsia with 3,351 reports, followed by obstetric haemorrhage with 2,982 cases. The enabling factors for the implementation of a rapid response team at IMSS were properly timed communication between the central delegation teams, as they allowed faster medical and administrative management and participation of hospital medical teams in the process. Mobile technology has increased the speed of medical and administrative management in emergency obstetric care. However, comparative studies are needed to determine the statistical significance. Published by Masson Doyma México S.A.
Facebook and self-perception: individual susceptibility to negative social comparison on Facebook
de Vries, D.A.; Kühne, R.
2015-01-01
Social network sites such as Facebook give off the impression that others are doing better than we are. As a result, the use of these sites may lead to negative social comparison (i.e., feeling like others are doing better than oneself). According to social comparison theory, such negative social
Psychometric properties of the Social Comparison Motives Scale.
Tigges, Beth Baldwin
2009-01-01
This article describes the 19-item Social Comparison Motive Scale [SCMS], a measure of adolescents' motives for social comparison related to pregnancy. Dimensions and items were developed based on adolescent focus groups. The instrument was reviewed for content validity, pilot tested, and administered to 431 adolescents aged 14-18 years. Principal axis factor analysis with oblique rotation supported five dimensions. Convergent and discriminant validity were demonstrated by moderate correlations (r = .50) between the SCMS and the Iowa-Netherlands Comparison Orientation Measure and low correlations (r = .15) between the SCMS and the Rosenberg Self-Esteem Scale. Cronbach's alphas were .91 overall and .71 to .85 for the subscales. The SCMS demonstrated reliability and validity as a measure of adolescents' motives for comparing themselves with others about pregnancy.
Social Comparison of Pay and Inequity Theory.
Judd, Ben
Inequity theory differs from social exchange theory in its analysis of a worker's reaction to pay by asserting that effects on work performance caused by high or low pay are due to social comparison of fairness rather than principles of direct exchange, such as reciprocity and power. The present experiment held piece-rate pay constant at two…
Immediate relativity: EEG reveals early engagement of comparison in social information processing.
Ohmann, Katharina; Stahl, Jutta; Mussweiler, Thomas; Kedia, Gayannée
2016-11-01
A wide array of social decisions relies on social comparisons. As such, these decisions require fast access to relative information. Therefore, we expect that signatures of the comparative process should be observable in electrophysiological components at an early stage of information processing. However, to date, little is known about the neural time course of social target comparisons. Therefore, we tested this hypothesis in 2 electroencephalography (EEG) studies using a social distance effect paradigm. The distance effect capitalizes on the fact that stimuli close on a certain dimension take longer to compare than stimuli clearly differing on this dimension. Here, we manipulated the distance of face characteristics regarding their levels of attractiveness (Study 1) and trustworthiness (Study 2), 2 essential social dimensions. In both studies, size comparisons served as a nonsocial control condition. In Study 1, distance related effects were apparent 170 ms (vertex positive potential, VPP) and 200 ms (N2) after stimulus onset for attractiveness comparisons. In Study 2, trustworthiness comparisons took effect already after 100 ms (N1) and likewise carried over to an event-related N2. Remarkably, we observed a similar temporal pattern for social (attractiveness, trustworthiness) and nonsocial (size) dimensions. These results speak in favor of an early encoding of comparative information and emphasize the primary role of comparison in social information processing. (PsycINFO Database Record (c) 2016 APA, all rights reserved).
An Investigation of Referral- and Comparison-based Social Influence on Social Networking Sites
DEFF Research Database (Denmark)
Tussyadiah, Iis; Kausar, Devi; Soesilo, Primidya K. M.
between SNS engagement and both referral-based and comparison-based social influence for restaurant selection. Further, it was also identified that the relationships between SNS engagement and social influence are moderated by the different dimensions of consumers’ susceptibility to global influence......This study explored social influence resulting from two distinct social reference processes on social networking sites (SNS). A web-based survey was conducted among consumers in the USA and Indonesia using restaurant consumption as a research context. The study identified the positive relationships...
Directory of Open Access Journals (Sweden)
Juana Inés de la Cruz Morales-García
2002-04-01
Full Text Available Objetivo. Medir la prevalencia de consumo riesgoso y dañino de alcohol en la población amparada por el Instituto Mexicano del Seguro Social (IMSS. Material y métodos. En un estudio transversal se entrevistaron 45 117 derechohabientes del IMSS, en las 36 delegaciones del país. Se aplicó un cuestionario estructurado y autoaplicable a cada sujeto usando el instrumento de tamizaje AUDIT (Alcohol Use Disorder Identification Test, el cual consta de 10 preguntas. Las tres primeras se relacionan con la cantidad y frecuencia del consumo de alcohol, las tres siguientes evalúan la dependencia y las cuatro últimas se refieren a problemas causados por el alcohol. Cada pregunta consta de tres a cinco opciones, a las que se les asignan valores progresivos de cero a cuatro. Se estimó la prevalencia de consumo, con intervalos de confianza al 95% (IC 95%. Resultados. La prevalencia de consumo problema de alcohol (riesgoso y dañino fue de 12.8% (IC 95% 12.5-13.2. El consumo fue mayor en hombres (22.2%; IC 95% 21.7-22.8 que en mujeres (3.4%; IC 95% 3.1-3.6. En los hombres se observó un efecto de edad, mientras que en las mujeres el consumo por edad fue más homogéneo. En ambos grupos el consumo fue más importante en la edad productiva. Conclusiones. La prevalencia de consumo de alcohol que constituye un problema para la salud, es elevada en la población derechohabiente del IMSS. Es necesario desarrollar políticas y programas de salud específicos, para disminuir este grave problema.Objective. To estimate the prevalence of hazardous and harmful alcohol consumption among the insured population of Instituto Mexicano del Seguro Social (Mexican Social Security Institute, IMSS. Material and Methods. A cross-sectional survey was conducted in 45,117 insured subjects from Mexico's 36 political districts; study subjects were interviewed using a structured and self-applied questionnaire on alcohol consumption, using the ten-item screening instrument AUDIT
Fardouly, Jasmine; Magson, Natasha R; Johnco, Carly J; Oar, Ella L; Rapee, Ronald M
2018-07-01
Time spent on social media and making online comparisons with others may influence users' mental health. This study examined links between parental control over the time their child spends on social media, preadolescents' time spent browsing social media, preadolescents' appearance comparisons on social media, and preadolescents' appearance satisfaction, depressive symptoms, and life satisfaction. Preadolescent social media users (N = 284, 49.1% female; aged 10-12) and one of their parents completed online surveys. Preadolescents, whose parents reported greater control over their child's time on social media, reported better mental health. This relationship was mediated by preadolescents spending less time browsing and making fewer appearance comparisons on social media. Parental control over time spent on social media may be associated with benefits for mental health among preadolescents.
Why and how people engage in social comparison while learning social skills in groups.
Buunk, Abraham (Bram); Cohen-Schotanus, J; Nek, R.H.
This study was conducted among 269 medical students who participated in educational training groups. Self-evaluation was the most important motive to engage in social comparison with other group members, followed by, respectively, self-enhancement and self-improvement. Upward comparisons (i.e., with
Glancing up or down: Mood management and selective social comparisons on social networking sites.
Johnson, B.K.; Knobloch-Westerwick, S.
2014-01-01
Social networking sites (SNS) provide opportunities for mood management through selective exposure. This study tested the prediction that negative mood fosters self-enhancing social comparisons to SNS profiles. Participants were induced into positive or negative moods and then browsed manipulated
Oral health status in older adults with social security in Mexico City: Latent class analysis.
Sánchez-García, Sergio; Heredia-Ponce, Erika; Cruz-Hervert, Pablo; Juárez-Cedillo, Teresa; Cárdenas-Bahena, Angel; García-Peña, Carmen
2014-02-01
To explore the oral health status through a latent class analysis in elderly social security beneficiaries from Southwest Mexico City. Cross-sectional study of beneficiaries of the State Employee Social Security and Social Services Institute (ISSSTE, in Spanish) and the Mexican Institute of Social Security (IMSS, in Spanish) aged 60 years or older. Oral health conditions such as edentulism, coronal and root caries (DMFT and DFT ≥ 75 percentile), clinical attachment loss (≥ 4 mm), and healthy teeth (≤ 25 percentile) were determined. A latent class analysis (LCA) was performed to classify the oral health status of dentate patients. In total, 336 patients were included (47.9% from the ISSSTE and 52.1% from the IMSS), with an average age of 74.4 (SD = 7.1) years. The 75th percentile of the DMFT = 23 and of the DFT = 2. Of the patients, 77.9% had periodontal disease. The 25th percentile of healthy teeth = 4. A three class model is adequate, with a high classification quality (Entropy = 0.915). The patients were classified as "Edentulous" (15.2%), "Class 1 = Unfavorable" (13.7%), "Class 2 = Somewhat favorable" (10.4%), and "Class 3 = Favorable" (60.7%). Using "Class 3 = Favorable" as a reference, there was an association (OR = 3.4; 95% CI = 1.8-6.4) between being edentulous and being 75 years of age and over, compared with the 60- to 74-year age group. The oral health in elderly social security beneficiaries is not optimal. The probability of becoming edentulous increases with age. A three-class model appropriately classifies the oral health dimensions in the elderly population. Key words:Elderly, Latent class analysis (LCA), oral health, social security, Mexico.
Social Comparison and Body Image in Adolescence: A Grounded Theory Approach
Krayer, A.; Ingledew, D. K.; Iphofen, R.
2008-01-01
This study explored the use of social comparison appraisals in adolescents' lives with particular reference to enhancement appraisals which can be used to counter threats to the self. Social comparison theory has been increasingly used in quantitative research to understand the processes through which societal messages about appearance influence…
Children's body image and social comparisons with peers and the media.
Tatangelo, Gemma L; Ricciardelli, Lina A
2017-05-01
Social comparisons are related to the development of body dissatisfaction among adolescents and adults, yet this relationship remains relatively unexamined among children. This study examines children's peer and media-related social comparisons, and how this impacts on their body image. Children aged 8-10 years completed interviews (17 girls and 19 boys in individual interviews, and 16 girls and 16 boys in focus groups). Analyses revealed that appearance-related comparisons were more common among girls, whereas sports/ability-related comparisons were more common for boys. In addition, boys viewed media comparisons as inspiring, whereas girls reported negative emotions. Implications for future research and prevention programmes are discussed.
Directory of Open Access Journals (Sweden)
Shirley S. Ho
2016-08-01
Full Text Available This study applies the social comparison theory to examine the effects of adolescents’ engagement in comparison with friends and celebrities on social network sites (SNSs on (a their body image dissatisfaction (BID and (b their drive to be thin (DT or muscular (DM. The study also examines celebrity involvement as an antecedent of the outcome variables. Data were collected through a survey of 1,059 adolescents in Singapore. Regression analyses indicate that SNSs use was related to adolescents’ BID. Specifically, social comparison with friends on SNSs was significantly associated with adolescents’ BID, DT, and DM. Gender differences were also observed—social comparison with celebrities was significantly associated with BID and DT among female adolescents. Celebrity involvement was significantly associated with male BID. Theoretical and practical implications were discussed.
Carmona, Carmen; Buunk, Abraham P.; Dijkstra, Arie; Peiro, Jose M.
2008-01-01
The present study examined whether social comparison responses (identification and contrast in social comparison) mediated the relationship between goal orientation (promotion and prevention) and self-efficacy, and whether self-efficacy was subsequently related with a better performance. As
Evidence of Social Comparison in Mastery Goals in Natural Academic Settings
Regner, Isabelle; Escribe, Christian; Dupeyrat, Caroline
2007-01-01
Proponents of achievement goal theory typically posit social comparison to be associated with performance goals but not with mastery goals (C. Ames, 1992). Contrary to this postulate, there is some evidence that individuals who are experimentally induced to adopt mastery goals may also use social comparison (e.g., R. Butler, 1992). However, such…
Social comparison, personal relative deprivation, and materialism.
Kim, Hyunji; Callan, Mitchell J; Gheorghiu, Ana I; Matthews, William J
2017-06-01
Across five studies, we found consistent evidence for the idea that personal relative deprivation (PRD), which refers to resentment stemming from the belief that one is deprived of deserved outcomes compared to others, uniquely contributes to materialism. In Study 1, self-reports of PRD positively predicted materialistic values over and above socioeconomic status, personal power, self-esteem, and emotional uncertainty. The experience of PRD starts with social comparison, and Studies 2 and 3 found that PRD mediated the positive relation between a tendency to make social comparisons of abilities and materialism. In Study 4, participants who learned that they had less (vs. similar) discretionary income than people like them reported a stronger desire for more money relative to donating more to charity. In Study 5, during a windfall-spending task, participants higher in PRD spent more on things they wanted relative to other spending categories (e.g., paying off debts). © 2016 The Authors. British Journal of Social Psychology published by John Wiley & Sons Ltd on behalf of British Psychological Society.
Social comparison : The end of a theory and the emergence of a field
Buunk, Abraham P.; Gibbons, Frederick X.
The past and current states of research on social comparison are reviewed with regard to a series of major theoretical developments that have occurred in the past 5 decades. These are, in chronological order: (1) classic social comparison theory, (2) fear-affiliation theory, (3) downward comparison
The Influence of Social Comparison and Peer Group Size on Risky Decision-Making.
Wang, Dawei; Zhu, Liping; Maguire, Phil; Liu, Yixin; Pang, Kaiyuan; Li, Zhenying; Hu, Yixin
2016-01-01
This study explores the influence of different social reference points and different comparison group sizes on risky decision-making. Participants were presented with a scenario describing an exam, and presented with the opportunity of making a risky decision in the context of different information provided about the performance of their peers. We found that behavior was influenced, not only by comparison with peers, but also by the size of the comparison group. Specifically, the larger the reference group, the more polarized the behavior it prompted. In situations describing social loss, participants were led to make riskier decisions after comparing themselves against larger groups, while in situations describing social gain, they become more risk averse. These results indicate that decision making is influenced both by social comparison and the number of people making up the social reference group.
Zhen, Shanshan; Yu, Rongjun
2016-01-01
Social comparison is a prerequisite for processing fairness, although the two types of cognition may be associated with different emotions. Whereas social comparison may induce envy, the perception of unfairness may elicit anger. Yet, it remains unclear whether people who tend to have a strong sense of fairness also tend to compare themselves more with others. Here, Study 1 used a modified ultimatum game (UG) and a social comparison game (SCG) to examine the relationship between justice sensitivity and social comparison sensitivity in 51 young adults. Study 2 examined self-reported social comparison and justice sensitivity in 142 young adults. Both studies showed a positive correlation between social comparison sensitivity and justice sensitivity. We reason that social comparison and justice sensitivity have an important positive correlation in human decision-making. The rejection of self-disadvantageous inequality offers may be due to the social comparison effect, which suggests that the tendency to compare oneself with others may contribute to having a strong sense of justice. Our findings suggest that the predictions of game theory may vary depending on the social culture context and incorporating notions of fairness and social comparison tendency may be essential to better predict the actual behavior of players in social interactive situations.
Directory of Open Access Journals (Sweden)
Shanshan Zhen
Full Text Available Social comparison is a prerequisite for processing fairness, although the two types of cognition may be associated with different emotions. Whereas social comparison may induce envy, the perception of unfairness may elicit anger. Yet, it remains unclear whether people who tend to have a strong sense of fairness also tend to compare themselves more with others. Here, Study 1 used a modified ultimatum game (UG and a social comparison game (SCG to examine the relationship between justice sensitivity and social comparison sensitivity in 51 young adults. Study 2 examined self-reported social comparison and justice sensitivity in 142 young adults. Both studies showed a positive correlation between social comparison sensitivity and justice sensitivity. We reason that social comparison and justice sensitivity have an important positive correlation in human decision-making. The rejection of self-disadvantageous inequality offers may be due to the social comparison effect, which suggests that the tendency to compare oneself with others may contribute to having a strong sense of justice. Our findings suggest that the predictions of game theory may vary depending on the social culture context and incorporating notions of fairness and social comparison tendency may be essential to better predict the actual behavior of players in social interactive situations.
Li, Jia; Liu, Xuan; Ma, Ling; Zhang, Weiqiang
2018-03-05
The key step in changing health behavior is understanding why users continue to use fitness apps. Therefore, we intend to investigate the users' intention to continue using social fitness-tracking apps. We identify two major forces driving continuous behavior. Expectation confirmation is the internal driving force and social comparison is the external driving force. A survey was conducted to test this proposed research model. We obtained 211 valid questionnaires. Our results indicate that activity amount ranking (p fitness-tracking apps. In addition, the impact of activity amount ranking and activity frequency ranking on continuous intention is moderated by expectation confirmation. Meanwhile, as the upward comparison tendency increases, the positive effect of confirmation on continuous intention decreases (p Social rank expectation and confirmation are the primary driving forces of continuous intention in individuals using fitness-tracking apps. Social rank is a meaningful and straightforward measurement individuals can use to evaluate their activity performance. An upward comparison tendency weakens the effect of confirmation on continuous intention.
Social comparison, self-stereotyping, and gender differences in self-construals.
Guimond, Serge; Chatard, Armand; Martinot, Delphine; Crisp, Richard J; Redersdorff, Sandrine
2006-02-01
Four studies examined gender differences in self-construals and the role of social comparison in generating these differences. Consistent with previous research, Study 1 (N=461) showed that women define themselves as higher in relational interdependence than men, and men define themselves as higher in independence/agency than women. Study 2 (N=301) showed that within-gender social comparison decreases gender differences in self-construals relative to a control condition, whereas between-genders comparison increases gender differences on both relational interdependence and independence/agency. Studies 3 (N=169) and 4 (N=278) confirmed these findings and showed that changing self-construal changes gender differences in social dominance orientation. Across the 4 studies, strong evidence for the role of in-group stereotyping as mediator of the effect of gender on self-construal was observed on the relational dimension but not on the agentic dimension. Copyright 2006 APA, all rights reserved.
Generation Validation: The Role of Social Comparison in Use of Instagram Among Emerging Adults.
Stapleton, Peta; Luiz, Gabriella; Chatwin, Hannah
2017-03-01
Social networking sites (SNSs) provide emerging adults with extreme and unprecedented transparency, exposing them to a plethora of opportunities for social comparison. In light of the growing use of the popular SNS, Instagram, among emerging adults, the purpose of this study was to examine the impact of exposure to social media-based social comparison information on self-esteem. The study recruited 237 participants through social media. The sample was narrowed to young adults aged 18-29 years. The study used a correlational nonexperimental approach to investigate two mediation models proposed in the literature. First, the study investigated the mediating role of social comparison on Instagram in the relationship between intensity of Instagram use and self-esteem. Second, the study examined the mediating role of social comparison in the relationship between self-worth contingent on approval from others and self-esteem. Although the first model was found to be nonsignificant, results observed a significant indirect pathway that confirmed the second model. Thus, social comparison on Instagram mediated the relationship between contingent self-worth and self-esteem. Furthermore, moderation analyses found that self-worth contingent on approval from others moderated the relationship between intensity of Instagram use and social comparison on Instagram. Thus, although Instagram did not directly affect self-esteem, the significant moderation suggested that intensity of Instagram use is influential when the young person's self-worth is contingent on approval from others. Overall, the findings are consistent with previous research and enhance our understanding of the mechanisms that link SNS use to low self-esteem.
What's that you're eating? Social comparison and eating behavior.
Polivy, Janet
2017-01-01
People seem to have a basic drive to assess the correctness of their opinions, abilities, and emotions. Without absolute indicators of these qualities, people rely on a comparison of themselves with others. Social comparison theory can be applied to eating behavior. For example, restrained eaters presented with a standard slice of pizza ate more of a subsequent food if they thought that they had gotten a bigger slice of pizza than others (i.e., had broken their diets), whereas unrestrained eaters ate less. Social influences on eating such as modeling and impression formation also rely on comparison of one's own eating to others. Comparing one's food to others' meals generally influences eating, affect, and satisfaction.
Phantom Behavioral Assimilation Effects : Systematic Biases in Social Comparison Choice Studies
Marsh, Herbert W.; Seaton, Marjorie; Kuyper, Hans; Dumas, Florence; Huguet, Pascal; Regner, Isabelle; Buunk, Abraham P.; Monteil, Jean-Marc; Gibbons, Frederick X.
Consistent with social comparison theory (SCT), Blanton, Buunk, Gibbons, and Kuyper (1999) and Huguet, Dumas, Monteil, and Genestoux (2001) found that students tended to choose comparison targets who slightly outperformed them (i.e., upward comparison choices), and this had a beneficial effect on
Better than my loved ones: Social comparison tendencies among narcissists
Krizan, Z.; Bushman, B.J.
2011-01-01
Narcissists pursue superiority and status at frequent costs to their relationships, and social comparisons seem central to these pursuits. Critically, these comparison tendencies should distinguish narcissism from healthy self-esteem. We tested this hypothesis in a study examining individual
Directory of Open Access Journals (Sweden)
Luz Myriam Reynales-Shigematsu
2006-01-01
Full Text Available OBJETIVO: Cuantificar el efecto de las enfermedades atribuibles al consumo de tabaco, en términos epidemiológicos (morbilidad y económicos (costos de atención médica, en el Instituto Mexicano del Seguro Social (IMSS a escala nacional. MATERIAL Y MÉTODOS: Los costos de la atención médica se estimaron desde la perspectiva del proveedor y se empleó la metodología del costeo de enfermedad. A partir de una muestra de pacientes (n= 1 596 atendidos en las unidades médicas se estableció la frecuencia de utilización de servicios en los tres niveles de atención. Para cada enfermedad se consideraron costos promedio por paciente y costos totales de enfermedad, los cuales se mensuraron en pesos mexicanos de 2004. Se calculó la fracción atribuible al consumo de tabaco para cada enfermedad, misma que se usó para atribuir los costos al tabaco. RESULTADOS: Los costos totales anuales de atención médica nacional corresponden a 7 114 millones para el infarto agudo del miocardio, 3 424 millones para la enfermedad vascular cerebral, 1 469 millones para la enfermedad pulmonar obstructiva crónica y 102 millones para el cáncer pulmonar. El costo total anual para el IMSS por estas cuatro enfermedades asciende a 12 100 millones de pesos. Los costos atribuibles al consumo de tabaco corresponden a 7 100 millones de pesos, lo cual equivale a 4.3% del gasto de operación de la institución en el año 2004. CONCLUSIONES: Estos resultados confirman el elevado costo de la atención médica de las enfermedades atribuibles al consumo de tabaco en el IMSS y generan información de primera mano necesaria para impulsar las medidas de prevención en esa institución y reforzar las políticas de control del tabaquismo ya aplicadas en México.OBJECTIVE: To estimate the cost of medical care for the major diseases attributable to tobacco consumption at the IMSS. MATERIAL AND METODS: A cost of illness (COI analysis was carried out from the perspective of the health
Schneider, Catharina; Agthe, Maria; Yanagida, Takuya; Voracek, Martin; Hennig-Fast, Kristina
2017-06-15
Muscle dysmorphia (MD) is a relatively young diagnosis referring to the desire for a high degree in lean muscle mass, while simultaneously believing that one is insufficiently muscular, mostly found in men. It goes along with a risk for social withdrawal to maintain rigid exercise and dietary regimen. The aim of the current study was thus, to explore differences in men with and without a risk for muscle dysmorphia regarding their desire for social interaction. Furthermore, we investigated potential effects of individual social comparison tendencies (the tendency to compare oneself with persons who are perceived to be superior or inferior to oneself on a certain dimension) and of one's own body schema on the desire for social interaction. One hundred physically active, college aged Austrian men were recruited via social media and flyers at fitness centers and the sports department of the University of Vienna. Participants were randomly assigned to a priming condition evoking their own body schema or a control condition and had to state their desire for social interaction with male or female stimulus persons of high or average attractiveness. We conducted a 2 (group of participant; men with vs. without a risk for MD) × 2 (priming condition; priming vs. non-priming) × 2 (attractiveness of stimulus person; highly attractive vs. less attractive) experimental design with different social comparison tendencies as covariates. Men with a risk for muscle dysmorphia showed lesser desire for social interaction than men without this risk, which can be seen as a risk factor for psychopathological outcomes. Generally, men with and without a risk for muscle dysmorphia did not differ with regard to their preferences for attractive stimulus persons as subjects for social interaction. We confirmed the notion that a tendency for downward social comparisons goes along with a diminished desire for social interaction. This study showed that men with a risk for muscle dysmorphia
Salas-Zapata, Leonardo; Palacio-Mejía, Lina Sofía; Aracena-Genao, Belkis; Hernández-Ávila, Juan Eugenio; Nieto-López, Emmanuel Salvador
To estimate the direct costs related to hospitalizations for diabetes mellitus and its complications in the Mexican Institute of Social Security METHODS: The hospital care costs of patients with diabetes mellitus using diagnosis-related groups in the IMSS (Mexican Institute of Social Security) and the hospital discharges from the corresponding E10-E14 codes for diabetes mellitus were estimated between 2008-2013. Costs were grouped according to demographic characteristics and main condition, and were estimated in US dollars in 2013. 411,302 diabetes mellitus discharges were recorded, representing a cost of $1,563 million. 52.44% of hospital discharges were men and 77.26% were for type 2 diabetes mellitus. The biggest cost was attributed to peripheral circulatory complications (34.84%) and people from 45-64 years of age (47.1%). Discharges decreased by 3.84% and total costs by 1.75% in the period analysed. The complications that caused the biggest cost variations were ketoacidosis (50.7%), ophthalmic (22.6%) and circulatory (18.81%). Hospital care for diabetes mellitus represents an important financial challenge for the IMSS. The increase in the frequency of hospitalisations in the productive age group, which affects society as a whole, is an even bigger challenge, and suggests the need to strengthen monitoring of diabetics in order to prevent complications that require hospital care. Copyright © 2016 SESPAS. Publicado por Elsevier España, S.L.U. All rights reserved.
Pavlova, Maria K; Lechner, Clemens M; Silbereisen, Rainer K
2018-04-01
Taking into account the regional context, we investigated whether social comparison in coping with occupational uncertainty served self-improvement (i.e., adaptive coping) or self-enhancement (i.e., subjective well-being). Respondents were 620 German adults aged 16 to 43, 59% female, who participated in three yearly follow-ups of a larger survey. The number of observations was 1,309 for contemporaneous and 1,079 for longitudinal analyses. Participants reported on perceived occupational uncertainty (e.g., risk of losing a job and difficulties with career planning), strategies for coping with it, and whether, and in which direction, they made social comparisons in coping with occupational uncertainty. Making social comparisons (vs. not) was associated with higher goal engagement and lower goal disengagement. Upward (as opposed to downward) comparison prospectively predicted higher goal engagement. Under high regional unemployment, upward comparison prospectively predicted lower goal disengagement, whereas making social comparisons was contemporaneously associated with higher subjective well-being. Higher regional unemployment rates predicted more frequent comparison, whereas comparison direction was predicted only by situational variables, especially personal control over the outcomes. When operationalized as a conscious mental action and put in the context of coping with occupational uncertainty, social comparison serves primarily self-improvement. © 2017 Wiley Periodicals, Inc.
Social comparison 2.0: examining the effects of online profiles on social-networking sites.
Haferkamp, Nina; Krämer, Nicole C
2011-05-01
Through their features--such as profile photographs or the personal vita--online profiles on social-networking sites offer a perfect basis for social comparison processes. By looking at the profile photograph, the user gains an impression of a person's physical attractiveness, and the user's vita shows which career path the person is pursuing. Against the background of Festinger's Social Comparison Theory, the focus of this research is on the effects of online profiles on their recipients. Therefore, qualitative interviews (N = 12) and two online experiments were conducted in which virtual online profiles of either physically attractive or unattractive persons (N = 93) and profiles of users with either high or low occupational attainment (N = 103) were presented to the participants. Although qualitative interviews did not initially give reason to expect online profiles to constitute a basis for comparison processes, results of the experiments proved otherwise. The first study indicates that recipients have a more negative body image after looking at beautiful users than persons who were shown the less attractive profile pictures. Male participants of the second study, who were confronted with profiles of successful males, showed a higher perceived discrepancy between their current career status and an ideal vita than male participants who looked at profiles of less successful persons.
Lup, Katerina; Trub, Leora; Rosenthal, Lisa
2015-05-01
As the use and influence of social networking continues to grow, researchers have begun to explore its consequences for psychological well-being. Some research suggests that Facebook use can have negative consequences for well-being. Instagram, a photo-sharing social network created in 2010, has particular characteristics that may make users susceptible to negative consequences. This study tested a theoretically grounded moderated meditation model of the association between Instagram use and depressive symptoms through the mechanism of negative social comparison, and moderation by amount of strangers one follows. One hundred and seventeen 18-29 year olds completed online questionnaires containing demographics, frequency of Instagram use, amount of strangers followed on Instagram, the Center for Epidemiological Resources Scale for Depression, and the Social Comparison Rating Scale. Instagram use was marginally positively associated with depressive symptoms, and positive social comparison was significantly negatively associated with depressive symptoms. Amount of strangers followed moderated the associations of Instagram use with social comparison (significantly) and depressive symptoms (marginally), and further significantly moderated the indirect association of Instagram use with depressive symptoms through social comparison. Findings generally suggest that more frequent Instagram use has negative associations for people who follow more strangers, but positive associations for people who follow fewer strangers, with social comparison and depressive symptoms. Implications of negative associations of social networking for people who follow strangers and the need for more research on Instagram use given its increasing popularity are explored.
Time Perspective, Life Satisfaction and Social Comparison Orientation in University Students
Nazmiye ÇİVİTCİ; Hülya ŞAHİN BALTACI
2018-01-01
The aim of this study was to examine the predictive power of time perspective for the life satisfaction and social comparison in university students. The participants (n= 441; 321 female and 120 male) are undergraduate students at a state university. The data of the study were collected through the Zimbardo Time Perspective Inventory, The Satisfaction with Life Scale and IOWA-Netherlands Social Comparison Orientation Measure. In order to determine the prediction power of the time ...
Gerson, J.; Plagnol, A.; Corr, P. J.
2016-01-01
The purpose of the study was to explore whether personality traits moderate the association between social comparison on Facebook and subjective well-being, measured as both life satisfaction and eudaimonic well-being. Data were collected via an online questionnaire which measured Facebook use, social comparison behavior and personality traits for 337 respondents. The results showed positive associations between Facebook intensity and both measures of subjective well-being, and negative assoc...
Social comparison with friends versus non-friends
Lubbers, M.J.; Kuyper, H.; Van der Werf, M.P.C.
This paper investigates whether several aspects of social comparison it? school classes differ as a function of the type of relation between the student and his or her tat-get. Participants were 9612 students in the first grade of secondary education in the Netherlands (equivalent to Grade 7 in the
Schmitt, MT; Branscombe, NR; Silvia, PJ; Garcia, DM; Spears, R
2006-01-01
Two experiments examined how people respond to upward social comparisons in terms of the extent to which they categorize the self and the source of comparison within the same social group. Self-evaluation maintenance theory (SEM) suggests that upward ingroup comparisons can lead to the rejection of
Roberto Castro; Gregorio Agustín Ruiz; María de la Luz Arenas Monreal; Sergio Juárez Márquez; Nora Barrios Martínez Rojas
2002-01-01
Se presentan los resultados de una encuesta entre 446 mujeres usuarias de los servicios de salud del Instituto Mexicano del Seguro Social (IMSS) en Morelos, que se encontraban en su tercer trimestre de embarazo. El objetivo era indagar si la violencia contra mujeres se incrementa durante el embarazo o si, por el contrario, disminuye. Se encontró que la prevalencia no varió en ambos periodos (aproximadamente 15 por ciento, en general). En cambio, la severidad de l...
Upward and Downward: Social Comparison Processing of Thin Idealized Media Images
Tiggemann, Marika; Polivy, Janet
2010-01-01
The present study aimed to investigate the role of social comparison processing in women's responses to thin idealized images. In particular, it was predicted that comparison with the images on the basis of appearance would lead to more negative outcomes than comparison on the basis of intelligence. A sample of 114 women viewed fashion magazine…
DEFF Research Database (Denmark)
Baumann, Oliver; Eggers, JP; Stieglitz, Nils
2018-01-01
Intra-organizational comparisons—managers and units benchmarking their performance against each other—can turn colleagues into competitors. To better understand when organizations should allow or even encourage internal social comparisons, we study their implications for organizational adaptation....... We highlight empirical implications and discuss theoretical links to work on intra-organizational competition, social comparisons and aspiration-driven search, diversification and performance, and the adaptation of multi-business firms....
Influences of Math Tracking on Seventh-Grade Students' Self-Beliefs and Social Comparisons
Chiu, Donna; Beru, Yodit; Watley, Erin; Wubu, Selam; Simson, Emma; Kessinger, Robin; Rivera, Anahi; Schmidlein, Patrick; Wigfield, Allan
2008-01-01
The authors examined how math track placement and gender affected 7th-grade students' self-esteem, self-concepts, and social comparisons. Participants were 170 students who completed surveys that assessed their self-esteem, academic self-concepts of ability, and the kinds of social comparisons they make. Results showed that higher track students…
Cruz-Vega, Felipe; Loría-Castellanos, Jorge; Hernández-Olivas, Irma Patricia; Franco-Bey, Rubén; Ochoa-Avila, César; Sánchez-Badillo, Victoria
2016-01-01
There has been interest in the Division of Special Projects in Health to offer the Instituto Mexicano del Seguro Social personnel resources for training and quality thereby respond to potential contingencies. Presented here is their experience in this field. To describe and analyse the productivity in different training programs in emergencies and disasters developed by the Division of Special Projects in Health, Mexican Social Security Institute (IMSS). Observational study in which different training activities conducted by the Division of Special Projects in Health between 1989 and 2014 are described. Descriptive statistics were used. In these 25 years have trained 20,674 participants; 19.451 IMSS and 1,223 other health institutions. The most productive courses were life support (BLS/ACLS) (47.17%), distance courses "Hospital medical evacuation plans and units" (14.17%), the workshop-run "Evacuation of hospital units with an emphasis on critical areas" (5.93%) and course "Programme Evaluators of Hospital Insurance" (8.43%). Although the Special Projects Division Health has primarily operational functions, it nevertheless has neglected its responsibility to maintain constantly trained and updated institute staff that every day is in a position to face any type of emergency and disaster. This increases the chance that the answer to any contingency is more organised and of higher quality, always to the benefit of the population. Copyright © 2015 Academia Mexicana de Cirugía A.C. Published by Masson Doyma México S.A. All rights reserved.
Márquez-González, Horacio; Yáñez-Gutiérrez, Lucelli; Rivera-May, Jimena Lucely; López-Gallegos, Diana; Almeida-Gutiérrez, Eduardo
2017-11-07
Congenital heart disease (CHD) has an incidence of 8-10 cases per 1000 live births. In Mexico, there are 18,000-20,000 new cases per year. Most tertiary care centers for CHD attend only pediatric population; the Mexican Institute of Social Security (IMSS) has a clinic that attends pediatric and adult population. To analyze the demographic aspects of the CHD clinic of IMSS. From 2011 to 2016 a cross-sectional study of the CC clinic of a third level hospital of the IMSS, including all patients with confirmed structural heart disease of recent diagnosis was carried out. The sex, age, reference entity, antecedent of pregnancy and treatment were registered. The population was divided into age ranges (17.1 years). Descriptive statistics and χ 2 test were used in qualitative variables. 3,483 patients with CHD (male:female ratio, 0.8:1.2) were included. Increased pulmonary flow acyanogenic cardiopathies were the most frequent CHD group (47.2%), with atrial septal defect being the most frequent diagnosis overall; 25.6% were adults and 35% of women with a history of pregnancy. Chiapas was Federal entity with greater proportion of patients diagnosed in the adult stage (33.82%); 7% were not candidates for any treatment for complications of the disease. CHD is a late diagnosis; it is necessary to create a national register to promote new health policies and a rational distribution of resources for these patients. Copyright © 2017 Instituto Nacional de Cardiología Ignacio Chávez. Publicado por Masson Doyma México S.A. All rights reserved.
Directory of Open Access Journals (Sweden)
JORGE SALMERÓN-CASTRO
1997-07-01
Full Text Available Objetivo. Describir el comportamiento de la mortalidad global por cáncer, así como la mortalidad específica para las principales neoplasias malignas en población adulta derechohabiente (DH del Instituto Mexicano del Seguro Social (IMSS. Material y métodos. A partir de los registros oficiales de defunción y de la información sobre la población para los años 1991-1995, se estimaron las tasas anuales de mortalidad global y específica para las 10 principales neoplasias malignas por sexo, en mayores de 20 años. Asimismo, se estimaron las tendencias nacionales y estatales para las principales neoplasias malignas para cada sexo por medio de regresión de Poisson. Se calcularon las diferencias de tasas de mortalidad específica para las dos principales neoplasias por sexo restando las tasas estatales a su respectiva tasa nacional en 1995. Resultados. La mortalidad global por cáncer en los hombres se incrementó de 76.2 en 1991, a 94.8 por 100 000 DH en 1995; entre las mujeres, ésta se incrementó de 85.6 a 105.8 por 100 000 DH, representando un incremento de 24.4 y de 24% en hombres y mujeres, respectivamente, durante el periodo de estudio. Entre los hombres las neoplasias de riñón, leucemia, páncreas, próstata y pulmón; y entre mujeres las de colon, mama, páncreas, leucemias e hígado, mostraron los incrementos más significativos. Conclusiones. En el IMSS es impostergable la conformación de un registro poblacional de cáncer que permita una mejor vigilancia epidemiológica de las neoplasias y una evaluación permanente del impacto de programas específicos para la prevención y control de este padecimiento en las instituciones.Objective. This paper describes the global cancer mortality and the specific mortality patterns for the main neoplasms among adult members of the Mexican Institute of Social Security (IMSS. Material and methods. Using official death certificates and information about the population of the IMSS members during
A social comparison theory meta-analysis 60+ years on.
Gerber, J P; Wheeler, Ladd; Suls, Jerry
2018-02-01
These meta-analyses of 60+ years of social comparison research focused on 2 issues: the choice of a comparison target (selection) and the effects of comparisons on self-evaluations, affect, and so forth (reaction). Selection studies offering 2 options (up or down) showed a strong preference (and no evidence of publication bias) for upward choices when there was no threat; there was no evidence for downward comparison as a dominant choice even when threatened. Selections became less differentiable when a lateral choice was also provided. For reaction studies, contrast was, by far, the dominant response to social comparison, with ability estimates most strongly affected. Moderator analyses, tests and adjustments for publication bias showed that contrast is stronger when the comparison involves varying participants' standing for ability (effect estimates, -0.75 to -0.65) and affect (-0.83 to -0.65). Novel personal attributes were subject to strong contrast for ability (-0.5 to -0.6) and affect (-0.6 to -0.7). Dissimilarity priming was associated with contrast (-0.44 to -0.27; no publication bias), consistent with Mussweiler (2003). Similarity priming provided modest support for Collins (1996) and Mussweiler (2003), with very weak assimilation effects, depending on the publication bias estimator. Studies including control groups indicated effects in response to upward and downward targets were comparable in size and contrastive. Limitations of the literature (e.g., small number of studies including no-comparison control conditions), unresolved issues, and why people choose to compare upward when the most likely result is self-deflating contrast are discussed. (PsycINFO Database Record (c) 2018 APA, all rights reserved).
Wehrens, M.J.P.W.; Buunk, Abraham (Bram); Lubbers, M.J.; Dijkstra, Pieternel; Kuyper, H.; Van der Werf, M.P.C.
The goal of the present study was to study the relationship between affective responses to social comparison and test scores among high school students Our analyses showed that three types of responses to social comparison could be distinguished: an empathic, constructive, and destructive response.
Perceived stigma, self-esteem and social comparison of people with intellectual disability
Stanković Ivana; Milačić-Vidojević Ivona
2014-01-01
The aim of this study was to determine the relationship between self-esteem, perceived stigma and social comparison of persons with intellectual disabilities. The sample consisted of 100 persons with mild and moderate intellectual disability, aged 18 years and older, of different sexes, with or without stigmatized characteristics, who lived in an institution or in a family. We used questionnaires of Perceived stigma, Adapted Scale of Social Comparison and Adapted Rosenberg Self-Esteem Scale. ...
When misery avoids company : Selective social comparisons to photographic online profiles
Johnson, Benjamin K.; Knobloch-Westerwick, Silvia
2017-01-01
Social networking site usage may affect subjective well-being. Two experiments examined how selective exposure to profiles of other users facilitated mood management via self-enhancing social comparisons. In Study 1, when given detailed impression management cues, such as photographs and status
Energy Technology Data Exchange (ETDEWEB)
Herrera, A. [Universidad Nacional Autonoma de Mexico (Mexico); Islas, J [Universidad Nacional Autonoma de Mexico, Mexico, D.F. (Mexico); Arriola, A. [Instituto de Investigaciones Electricas, Cuernavaca, Morelos (Mexico)
2001-07-01
The hospitals are important consumers of energy. At the General Hospital of Zone (HGZ) N of the IMSS in Aguscalientes (HGZ N . IMSS Ags.), the diesel oil is the main fuel that is used to satisfy the requirements of thermal energy of the hospital. According to the data collected by this author, this fuel represented in 2001, 75% of its total energy consumption and the 67.9% of its total costs in energy that ascended to $396.131 (December 2001 Dollars) Since this last amount represents an important percentage of the total expenses of the hospital (29.367 million dollars) it is important to determine the technical-economic possibilities of thermal energy saving of the hospital. The HGZ N 1 IMSS Ags. is located in a ampler conglomerate where the IMSS units are located, such as, the regional laundry, the sport unit, the center of social security, the familiar medicine unit N 1 and the hospital. Nevertheless departing from the installation of the electrical systems and the provision of steam and hot water to the hospital, the electrical and thermal fluids of all this facilities are distributed. Due to this situation, in this work we will refer to the global consumption of the IMSS of Aguascalientes development where the hospital is the main consumer of thermal energy. In the present work we will calculate the technical-economic potential of thermal energy saving in the development of the IMSS through the thermodynamic technique of folding point or pinch technique. [Spanish] Los hospitales son importantes consumidores de energia. En el Hospital General de Zona N del IMSS en Aguscalientes (HGZ N - IMSS Ags.), el diesel es el principal combustible que se usa para satisfacer los requerimientos de energia termica del hospital. Segun los datos obtenidos por el autor anterior, este combustible represento en 2001 el 75% de su consumo total energetico y el 67.9% de sus costos totales en energeticos que ascendieron a $396,131 (dolares de diciembre de 2001). Dado que esta ultima
Culture, gender, and the self: variations and impact of social comparison processes.
Guimond, Serge; Branscombe, Nyla R; Brunot, Sophie; Buunk, Abraham P; Chatard, Armand; Désert, Michel; Garcia, Donna M; Haque, Shamsul; Martinot, Delphine; Yzerbyt, Vincent
2007-06-01
Psychological differences between women and men, far from being invariant as a biological explanation would suggest, fluctuate in magnitude across cultures. Moreover, contrary to the implications of some theoretical perspectives, gender differences in personality, values, and emotions are not smaller, but larger, in American and European cultures, in which greater progress has been made toward gender equality. This research on gender differences in self-construals involving 950 participants from 5 nations/cultures (France, Belgium, the Netherlands, the United States, and Malaysia) illustrates how variations in social comparison processes across cultures can explain why gender differences are stronger in Western cultures. Gender differences in the self are a product of self-stereotyping, which occurs when between-gender social comparisons are made. These social comparisons are more likely, and exert a greater impact, in Western nations. Both correlational and experimental evidence supports this explanation. (c) 2007 APA, all rights reserved.
Leahey, Tricia M; Crowther, Janis H
2008-09-01
This research examined whether comparison target moderates the effects of naturally occurring appearance-focused social comparisons on women's affect, appearance esteem, and dieting thoughts. During daily activities, body-satisfied (BS) women and body-dissatisfied (BD) women recorded their comparison targets and reactions to comparison information. For BS women, upward comparisons with peers were associated with more positive affect (PA) and appearance esteem and less guilt than upward comparisons with media images and downward comparisons with peers were associated with less PA than downward comparisons with media images. For BD women, upward comparisons with peers were associated with more appearance esteem and diet thoughts than upward comparisons with media images and downward comparisons with peers were associated with less PA, appearance esteem, and diet thoughts and more guilt than downward comparisons with media images.
Nesi, Jacqueline; Prinstein, Mitchell J
2015-11-01
This study examined specific technology-based behaviors (social comparison and interpersonal feedback-seeking) that may interact with offline individual characteristics to predict concurrent depressive symptoms among adolescents. A total of 619 students (57 % female; mean age 14.6) completed self-report questionnaires at 2 time points. Adolescents reported on levels of depressive symptoms at baseline, and 1 year later on depressive symptoms, frequency of technology use (cell phones, Facebook, and Instagram), excessive reassurance-seeking, and technology-based social comparison and feedback-seeking. Adolescents also completed sociometric nominations of popularity. Consistent with hypotheses, technology-based social comparison and feedback-seeking were associated with depressive symptoms. Popularity and gender served as moderators of this effect, such that the association was particularly strong among females and adolescents low in popularity. Associations were found above and beyond the effects of overall frequency of technology use, offline excessive reassurance-seeking, and prior depressive symptoms. Findings highlight the utility of examining the psychological implications of adolescents' technology use within the framework of existing interpersonal models of adolescent depression and suggest the importance of more nuanced approaches to the study of adolescents' media use.
Meisel, C. Julius; Blumberg, Carol Joyce
1990-01-01
Two studies involving 63 second through fourth graders and 43 ninth graders investigated the influence of gender, race, and friendship on social comparison choices. Implications of the results for social comparison theory and social policy and education practice are discussed. (TJH)
Parents' Social Comparisons of Siblings and Youth Problem Behavior: A Moderated Mediation Model.
Jensen, Alexander C; McHale, Susan M; Pond, Amanda M
2018-06-18
Parents compare their children to one another; those comparisons may have implications for the way mothers and fathers treat their children, as well as their children's behavior. Data were collected annually for three years with parents, firstborns, and secondborns from 385 families (Time 1 age: firstborns, 15.71, SD = 1.07, 52% female; secondborns, 13.18, SD = 1.29, 50% female). Parents' beliefs that one child was better behaved predicted differences in siblings' reports of parent-child conflict. Additionally, for siblings close in age, mothers' comparisons at Time 1 predicted youth's problem behavior at Time 3 through siblings' differential conflict with mothers. The results support and extend tenets from Social Comparison and Expectancy Value theories in regards to social comparison within families.
Directory of Open Access Journals (Sweden)
Morales-García Juana Inés de la Cruz
2002-01-01
Full Text Available Objetivo. Medir la prevalencia de consumo riesgoso y dañino de alcohol en la población amparada por el Instituto Mexicano del Seguro Social (IMSS. Material y métodos. En un estudio transversal se entrevistaron 45 117 derechohabientes del IMSS, en las 36 delegaciones del país. Se aplicó un cuestionario estructurado y autoaplicable a cada sujeto usando el instrumento de tamizaje AUDIT (Alcohol Use Disorder Identification Test, el cual consta de 10 preguntas. Las tres primeras se relacionan con la cantidad y frecuencia del consumo de alcohol, las tres siguientes evalúan la dependencia y las cuatro últimas se refieren a problemas causados por el alcohol. Cada pregunta consta de tres a cinco opciones, a las que se les asignan valores progresivos de cero a cuatro. Se estimó la prevalencia de consumo, con intervalos de confianza al 95% (IC 95%. Resultados. La prevalencia de consumo problema de alcohol (riesgoso y dañino fue de 12.8% (IC 95% 12.5-13.2. El consumo fue mayor en hombres (22.2%; IC 95% 21.7-22.8 que en mujeres (3.4%; IC 95% 3.1-3.6. En los hombres se observó un efecto de edad, mientras que en las mujeres el consumo por edad fue más homogéneo. En ambos grupos el consumo fue más importante en la edad productiva. Conclusiones. La prevalencia de consumo de alcohol que constituye un problema para la salud, es elevada en la población derechohabiente del IMSS. Es necesario desarrollar políticas y programas de salud específicos, para disminuir este grave problema.
van der Zee, KI; Buunk, BP; Sanderman, R; Botke, G; van den Bergh, F
1999-01-01
The present study examined the relationship between social comparison processes and the Big Five personality factors. In a sample of 112 patients with various forms of cancer it was found that Neuroticism was associated with a tendency to focus on the negative interpretation of social comparison
Doubova, Svetlana V; Borja-Aburto, Víctor Hugo; Guerra-Y-Guerra, Germán; Salgado-de-Snyder, V Nelly; González-Block, Miguel Ángel
2018-05-01
The Mexican Institute of Social Security (IMSS) provides a package of health, economic and social benefits to workers employed in private firms within the formal labour market and to their economic dependants. Affiliates have a right to these benefits only while they remain contracted, thus posing a risk for the continuity of healthcare. This study evaluates the association between the time (in days) without the right to healthcare due to job loss in the formal labour market and the quality of healthcare and clinical outcomes among IMSS affiliates with Type 2 diabetes mellitus (T2DM). Retrospective cohort study 2013-2015. Six IMSS family medicine clinics (FMC) in Mexico City. T2DM patients (n = 27 217) affiliated with job-related health insurance and at least one consultation with a family doctor during 2013. IMSS affiliation department database and electronic health records and clinical laboratory databases. Quality of the processes (eight indicators) and outcomes (three indicators) of healthcare. The results indicated that losing IMSS right to healthcare is frequent, occurring to one-third of T2DM patients during the follow-up period. The time without the right to healthcare in the observed period was of 120 days on average and was associated with a 43.2% loss of quality of care and a 19.2% reduction in clinical outcomes of T2DM. Policies aimed at ensuring access and continuity of care, regardless of job status, are critical for improving the quality of processes and outcomes of healthcare for diabetic patients.
Social comparison as a mediator between health problems and subjective health evaluations.
Van der Zee, K.I.; Buunk, Abraham (Bram); Sanderman, R.
The role of social comparison in mediating the relation between 'objective' health status and subjective health evaluations was examined. In a random population sample (N = 361) it was shown that health problems were related to psychological distress, which in turn induced a downward comparison
Directory of Open Access Journals (Sweden)
Elsy del Carmen Quevedo-Tejero
2011-09-01
Full Text Available Objetivos. Determinar la prevalencia y costos directos de atención de fractura de cadera en adultos mayores derechohabientes usuarios de los hospitales de referencia del Instituto Mexicano del Seguro Social (IMSS y de Petróleos Mexicanos (PEMEX en Villahermosa, Tabasco, México, en el año 2009. Materiales y métodos. Estudio transversal. La información se basó en los registros de intervenciones quirúrgicas e informes institucionales de adultos mayores hospitalizados con registro de su atención.Se realizó análisis estadístico descriptivo considerando las variables: edad, sexo,tipo de fractura de cadera, mes de ocurrencia y costo directo de atención. Resultados.De 10765 registros de adultos mayores hospitalizados se encontró 57 casos de fractura de cadera (33 en el IMSS y 24 en PEMEX. La prevalencia de fractura de cadera fue 0,5% (IMSS 1,1% y PEMEX 0,3%, siendo más frecuente en mujeres y en mayores de 69 años de edad. El tipo de fractura más frecuente fue en el cuello del fémur (78,9% del total. El costo estimado de atención médica hospitalaria por paciente fue de USD 5 803 en el IMSS y USD 11 800 en PEMEX. Conclusiones. La prevalencia de fractura de cadera fue mayor en los usuarios del IMSS. Los costos estimados de atención por paciente fueron mayores a los reportados en otras instituciones del sistema nacional de salud mexicano.Objectives. To determine hip fracture prevalence and direct healthcare costs in elderly users of the reference hospitals of the Mexican Institute of Social Insurance (IMSS by spanish initials and Mexican Oils (PEMEX by spanish initials, from Villahermosa, Tabasco, Mexico, during 2009. Materials and methods. This is a cross-sectional study. The information was based on the registers of surgical interventions and institutional reports of the elderly inpatients who had a registered attention in their institution. Descriptive statistical analysis was performed considering the following variables: age
We can do it: the interplay of construal orientation and social comparisons under threat.
Marx, David M; Stapel, Diederik A; Muller, Dominique
2005-03-01
The authors investigated how a collective self-construal orientation in combination with positive social comparisons "turns off" the negative effects of stereotype threat. Specifically, Experiment 1 demonstrated that stereotype threat led to increased accessibility of participants' collective self ("we"). Experiment 2 showed that this feeling of "we-ness" in the stereotype threat condition centered on the participants' stereotyped group membership and not on other important social groups (e.g., students). Experiment 3 indicated that in threat situations, when participants' collective self is accessible, positive social comparison information led to improved math test performance and less concern, whereas in nonthreat situations, when the collective self is less accessible, positive comparison information led to worse test performance and more concern. Our final experiment revealed that under stereotype threat, only those comparison targets who are competent in the relevant domain (math), rather than in domains unrelated to math (athletics), enhanced participants' math test performance. ((c) 2005 APA, all rights reserved).
Vázquez-Cruz, Irene; Juanico-Morales, Guillermina; Sánchez-Ramos, Apolinar; Morales-Sánchez, Ofelia de Jesúis
2018-01-01
Chikungunya fever (CHIK) generally causes temporary sick leave, affecting groups of productive age, which represents a significant economic impact from the labor point of view. The objective was to estimate costs of disability due to chikungunya in the Instituto Mexicano del Seguro Social (IMSS) in Guerrero, Mexico. Cost assessment of working population from IMSS in Guerrero who met the definition of case for CHIK and took sick leave, which was registered in the Original Disability Certificates (OCI, according to its initials in Spanish) processed from January to April, 2015. Paid sick days were multiplied by the current minimum wage of the municipality of Acapulco (geographical area A, general = $ 70.10: seventy pesos with 10 cents per day]). Of all the OCIs, 31.5% (38 271/12 062) met the criteria for CHIK with a total of 41 197 prescribed days and 14 941 paid sick days with an estimated cost of 2 397 393.40 pesos (two million, three hundred and ninety seven thousand, three hundred and ninety three dollars and forty cents). Sick leaves increase the costs in health systems. These costs increase as increases the number of days granted. The average number of days granted is consistent with the information published in different articles.
Zhen, Shanshan; Yu, Rongjun
2016-01-01
Social comparison is a prerequisite for processing fairness, although the two types of cognition may be associated with different emotions. Whereas social comparison may induce envy, the perception of unfairness may elicit anger. Yet, it remains unclear whether people who tend to have a strong sense of fairness also tend to compare themselves more with others. Here, Study 1 used a modified ultimatum game (UG) and a social comparison game (SCG) to examine the relationship between justice sensi...
Halliwell, Emma; Dittmar, Helga
2005-09-01
This study investigates the effect of social comparisons with media models on women's body image based on either self-evaluation or self-improvement motives. Ninety-eight women, for whom appearance was a relevant comparison dimension, viewed advertisements that did, or did not, feature idealised models, after being prompted to engage in self-evaluation or self-improvement comparisons. The results indicate that, when focusing on self-evaluation, comparisons with thin models are associated with higher body-focused anxiety than viewing no model advertisements. In contrast, when focusing on self-improvement, comparisons with thin models are not associated with higher body-focused anxiety than viewing no models. Furthermore, women's general tendency to engage in social comparisons moderated the effects of self-evaluative comparisons with models, so that women who did not habitually engage in social comparisons were most strongly affected. It is suggested that motive for social comparison may explain previous inconsistencies in the experimental exposure literature and warrants more careful attention in future research.
Neuroticism and responses to social comparison among cancer patients
Buunk, A.P.; Brakel, T.M.; Bennenbroek, F.T.C.; Stiegelis, H.E.; Sanderman, R.; Bergh, A.C.M. van den; Hagedoorn, M.
2009-01-01
The present study examined how the effects of three audiotapes containing different types of social comparison information on the mood of cancer patients depended on the level of neuroticism. On the procedural tape, a man and woman discussed the process of radiation therapy, on the emotion tape,
Dibb, Bridget; Yardley, Lucy
2006-09-01
Despite the growing popularity of self-help groups for people with chronic illness, there has been surprisingly little research into how these may support adjustment to illness. This study investigated the role that social comparison, occurring within a self-help group, may play in adjustment to chronic illness. A model of adjustment based on control process theory and response shift theory was tested to determine whether social comparisons predicted adjustment after controlling for the catalyst for adjustment (disease severity) and antecedents (demographic and psychological factors). A sample of 301 people with Ménière's disease who were members of the Ménière's Society UK completed questionnaires at baseline and 10-month follow-up assessing adjustment, defined for this study as functional and goal-oriented quality of life. At baseline, they also completed measures of the predictor variables i.e. the antecedents (age, sex, living circumstances, duration of self-help group membership, self-esteem, optimism and perceived control over illness), the catalyst (severity of vertigo, tinnitus, hearing loss and fullness in the ear) and mechanisms of social comparison within the self-help group. The social comparison variables included the extent to which self-help group resources were used, and whether reading about other members' experiences induced positive or negative feelings. Cross-sectional results showed that positive social comparison was indeed associated with better adjustment after controlling for all the other baseline variables, while negative social comparison was associated with worse adjustment. However, greater levels of social comparison at baseline were associated with a deteriorating quality of life over the 10-month follow-up period. Alternative explanations for these findings are discussed.
Teacher Job Satisfaction and Burnout Viewed through Social Comparisons
Kitchel, Tracy; Smith, Amy R.; Henry, Anna L.; Robinson, J. Shane; Lawver, Rebecca G.; Park, Travis D.; Schell, Ashley
2012-01-01
Understanding job satisfaction, stress, and burnout within agricultural education has the potential to impact the profession's future. Studying these factors through the theoretical lens of social comparison takes a cultural approach by investigating how agriculture teachers interact with and compare themselves to others. The purpose of this study…
Tian, Lili; Yu, Tingting; Huebner, E. Scott
2017-01-01
The purpose of this study was to examine the multiple mediational roles of academic social comparison directions (upward academic social comparison and downward academic social comparison) on the relationships between achievement goal orientations (i.e., mastery goals, performance-approach goals, and performance-avoidance goals) and subjective well-being (SWB) in school (school satisfaction, school affect) in adolescent students in China. A total of 883 Chinese adolescent students (430 males;...
Class and comparison: subjective social location and lay experiences of constraint and mobility.
Irwin, Sarah
2015-06-01
Lay perceptions and experiences of social location have been commonly framed with reference to social class. However, complex responses to, and ambivalence over, class categories have raised interesting analytic questions relating to how sociological concepts are operationalized in empirical research. For example, prior researchers have argued that processes of class dis-identification signify moral unease with the nature of classed inequalities, yet dis-identification may also in part reflect a poor fit between 'social class' as a category and the ways in which people accord meaning to, and evaluate, their related experiences of socio-economic inequality. Differently framed questions about social comparison, aligned more closely with people's own terms of reference, offer an interesting alternative avenue for exploring subjective experiences of inequality. This paper explores some of these questions through an analysis of new empirical data, generated in the context of recession. In the analysis reported here, class identification was common. Nevertheless, whether or not people self identified in class terms, class relevant issues were perceived and described in highly diverse ways, and lay views on class revealed it to be a very aggregated as well as multifaceted construct. It is argued that it enables a particular, not general, perspective on social comparison. The paper therefore goes on to examine how study participants compared themselves with familiar others, identified by themselves. The evidence illuminates social positioning in terms of constraint, agency and (for some) movement, and offers insight into very diverse experiences of inequality, through the comparisons that people made. Their comparisons are situated, and pragmatic, accounts of the material contexts in which people live their lives. Linked evaluations are circumscribed and strongly tied to these proximate material contexts.The paper draws out implications for theorizing lay perspectives on
Whitaker, Roger M.; Colombo, Gualtiero B.; Allen, Stuart M.; Dunbar, Robin I. M.
2016-08-01
Cooperation is a fundamental human trait but our understanding of how it functions remains incomplete. Indirect reciprocity is a particular case in point, where one-shot donations are made to unrelated beneficiaries without any guarantee of payback. Existing insights are largely from two independent perspectives: i) individual-level cognitive behaviour in decision making, and ii) identification of conditions that favour evolution of cooperation. We identify a fundamental connection between these two areas by examining social comparison as a means through which indirect reciprocity can evolve. Social comparison is well established as an inherent human disposition through which humans navigate the social world by self-referential evaluation of others. Donating to those that are at least as reputable as oneself emerges as a dominant heuristic, which represents aspirational homophily. This heuristic is found to be implicitly present in the current knowledge of conditions that favour indirect reciprocity. The effective social norms for updating reputation are also observed to support this heuristic. We hypothesise that the cognitive challenge associated with social comparison has contributed to cerebral expansion and the disproportionate human brain size, consistent with the social complexity hypothesis. The findings have relevance for the evolution of autonomous systems that are characterised by one-shot interactions.
Bury, Belinda; Tiggemann, Marika; Slater, Amy
2016-06-01
The current study aimed to investigate the effect of digital alteration disclaimer labels appended to fashion magazine advertisements, as well as instructional condition, on women's social comparison and body dissatisfaction. Participants were 378 female undergraduate students who viewed 11 thin ideal advertisements with either no disclaimer, a generic disclaimer, or a more detailed specific disclaimer. There were three instructional conditions: neutral, distractor, and social comparison. Disclaimer labels did not affect appearance comparison or body dissatisfaction, but instructional condition did, with the social comparison instructions producing the highest appearance comparison and body dissatisfaction. In addition, there was a three-way interaction with trait appearance comparison, such that women high on trait appearance comparison who saw specifically worded disclaimers in the distractor instructional condition experienced increased body dissatisfaction, whereas women low on this trait experienced decreased body dissatisfaction. It seems that both instructions and individual differences may influence responses to disclaimer labels. Copyright © 2016 Elsevier Ltd. All rights reserved.
Is Comparison the Thief of Joy? Sexual Narcissism and Social Comparisons in the Domain of Sexuality.
Day, Lisa C; Muise, Amy; Impett, Emily A
2017-02-01
Are people who are high in sexual narcissism more sensitive to information comparing their sex lives with the sex lives of others? Does this sensitivity explain narcissists' lower sexual and relationship satisfaction? We conducted three studies to address this question. Participants completed the Sexual Narcissism Scale (Widman & McNulty, 2010), and then either recalled (Study 1), imagined (Study 2), or actually made (Study 3) a sexual comparison. We found that people high in sexual narcissism (compared with those lower in sexual narcissism) were more bothered when comparing themselves with someone with a higher sexual frequency and felt better about a comparison with someone with a lower sexual frequency. In turn, narcissists' greater sensitivity to upward social comparisons predicted lower sexual and relationship satisfaction. These results suggest that those high in sexual narcissism may use downward sexual comparisons to maintain their grandiose self-views and be particularly sensitive to upward sexual comparisons.
[Hip fracture in older adults: prevalence and costs in two hospitals. Tabasco, Mexico, 2009].
Quevedo-Tejero, Elsy del Carmen; Zavala-González, Marco Antonio; Hernández-Gamas, Arianna del Carmen; Hernández-Ortega, Hilda María
2011-01-01
To determine hip fracture prevalence and direct healthcare costs in elderly users of the reference hospitals of the Mexican Institute of Social Insurance (IMSS by spanish initials) and Mexican Oils (PEMEX by spanish initials), from Villahermosa, Tabasco, Mexico, during 2009. This is a cross-sectional study. The information was based on the registers of surgical interventions and institutional reports of the elderly inpatients who had a registered attention in their institution. Descriptive statistical analysis was performed considering the following variables: age, gender, hip fracture type, occurrence month, direct healthcare cost. Out of 10,765 records of hospitalized elderly, 57 hip fracture cases were found (33 in the IMSS and 24 in PEMEX). Hip fracture prevalence was 0.5%, (IMSS 1.1% and PEMEX 0.3%), being more frequent in women and older than 69. The most frequent fracture type was the femur neck one (78.9%). The estimated cost of healthcare in the hospital per patient was USD 5,803 in the IMSS and USD 11,800 in PEMEX. The hip fracture prevalence was higher in the IMSS users. Estimated healthcare costs per patient were higher than the reported in other institutions of the of the mexican health national system.
Rantapelkonen Ahlberg, Jaana
2010-01-01
Rantapelkonen Ahlberg, Jaana. 2010. Social Media Marketing. Case: Comparison of Social Media Marketing Approaches of B2C Companies for Company X. Master’s Thesis. Kemi-Tornio University of Applied Sciences. Business and Culture. Pages 42 (74). The objective of this thesis is to provide insights on how Company X can use Social Media as a marketing and branding tool in consumer marketing in the Swedish market. More specifically, this study attempts to define what kinds of social media are u...
Yang, Chia-Chen
2016-12-01
Ever since the emergence of social networking sites (SNSs), it has remained a question without a conclusive answer whether SNSs make people more or less lonely. To achieve a better understanding, researchers need to move beyond studying overall SNS usage. In addition, it is necessary to attend to personal attributes as potential moderators. Given that SNSs provide rich opportunities for social comparison, one highly relevant personality trait would be social comparison orientation (SCO), and yet this personal attribute has been understudied in social media research. Drawing on literature of psychosocial implications of social media use and SCO, this study explored associations between loneliness and various Instagram activities and the role of SCO in this context. A total of 208 undergraduate students attending a U.S. mid-southern university completed a self-report survey (M age = 19.43, SD = 1.35; 78 percent female; 57 percent White). Findings showed that Instagram interaction and Instagram browsing were both related to lower loneliness, whereas Instagram broadcasting was associated with higher loneliness. SCO moderated the relationship between Instagram use and loneliness such that Instagram interaction was related to lower loneliness only for low SCO users. The results revealed implications for healthy SNS use and the importance of including personality traits and specific SNS use patterns to disentangle the role of SNS use in psychological well-being.
Wu, Y.; Zhou, Y.; van Dijk, E.; Leliveld, M.C.; Zhou, X.
2011-01-01
Previous studies have shown that social comparison influences individual's fairness consideration and other-regarding behavior. However, it is not clear how social comparison affects the brain activity in evaluating fairness during asset distribution. In this study, participants, acting as
Correlation of preferences for social comparison goals and certain personality traits
Directory of Open Access Journals (Sweden)
E S Samoylenko
2010-12-01
Full Text Available The results of investigation of differences in preference of certain goals of social comparison in individuals with opposite personality traits evaluated with the Big Five test are presented.
BURNOUT, UNCERTAINTY, AND THE DESIRE FOR SOCIAL-COMPARISON AMONG NURSES
BUUNK, BP; SCHAUFELI, WB; YBEMA, JF
1994-01-01
A study was conducted among 295 nurses to examine the interest in social comparison information, that is, the desire to learn more about the feelings and responses of others facing a similar situation. Occupational burnout, in particular emotional exhaustion, reduced personal accomplishment and
Burnout and reactions to social comparison information among volunteer caregivers
Van der Zee, K.I.; Bakker, A.B.; Buunk, Abraham (Bram)
2001-01-01
The present study focused on social comparison processes among volunteer caregivers of terminally ill patients in relation to burnout. First, caregivers' (N = 80) affective reactions to a bogus interview with fellow volunteer workers who were either coping better or worse were considered. Upward
Carmack Taylor, Cindy L; Kulik, James; Badr, Hoda; Smith, Murray; Basen-Engquist, Karen; Penedo, Frank; Gritz, Ellen R
2007-07-01
Group-based psychosocial programs provide an effective forum for improving mood and social support for cancer patients. Because some studies show more benefit for patients with initially high psychosocial distress, and little or no benefit for patients with initially low distress, support programs may better address patient needs by only including distressed patients. However, distressed patients may benefit particularly from the presence of nondistressed patients who model effective coping, an idea many researchers and extensions of social comparison theory support. We present a theoretical analysis, based on a social comparison perspective, of how group composition (heterogeneous group of distressed and nondistressed patients versus homogeneous group of distressed patients) may affect the efficacy of cancer support programs. We propose that a heterogeneous group allows distressed patients maximal opportunity for the various social comparison activities they are likely to prefer; a homogeneous group does not. Though the presence of nondistressed patients in a heterogeneous group potentially benefits distressed patients, the benefits for nondistressed patients are unclear. For nondistressed patients, heterogeneous groups may provide limited opportunities for preferred social comparison activity and may create the possibility for no benefit or even negative effects on quality of life. We also discuss ethical issues with enrolling nondistressed patients whose presence may help others, but whose likelihood of personal benefit is questionable.
Jensen, Alexander C; Pond, Amanda M; Padilla-Walker, Laura M
2015-11-01
Siblings play an important role in relational and individual development throughout adolescence and beyond through several mechanisms. Central to this role and the mechanisms of sibling influence is the notion that siblings provide a constant and meaningful frame of reference for social comparison. This study examined the role of sibling social comparison orientation, or the tendency of siblings to compare themselves to one another, on youths' depressive symptoms and family relationships, both directly and by moderating links with parental differential treatment. Participants included 338 youth (M age = 18.34, SD = 1.03; 52 % female). Using hierarchical ordinary least squares regression, we found that a higher sibling social comparison orientation was linked with more depressive symptoms, warmer sibling relationships, and more sibling conflict. Additionally, sibling social comparison orientation moderated links of parental differential treatment with depressive symptoms and prosocial behavior toward family members such that effects were more salient for those with a high comparison orientation. The discussion focuses on the role of sibling comparison in the ways that siblings influence one another's development.
Stewart, Tara L; Chipperfield, Judith G; Ruthig, Joelle C; Heckhausen, Jutta
2013-01-01
Drawing from Heckhausen and Schulz's Motivational Theory of Life-span Development, this study examined perceived control as a moderator of the protective relationship between downward social comparison and subjective well-being among older adults. Community-dwelling older adults (N = 97, 63% female, ages 79-97) were interviewed in their own homes at three time-points over a nine-year period. Interviews assessed older adults' perceived control over daily tasks, their use of downward social comparison in response to task restriction, and their subjective well-being. Regression analyses yielded a significant interaction between downward social comparison and perceived control for three subjective well-being outcomes: life satisfaction, perceived stress, and depressive symptoms. Follow-up analyses revealed that downward social comparison was associated with greater subjective well-being at low levels of perceived control; but was unrelated to subjective well-being at high levels of perceived control. These findings corroborate Heckhausen and Schulz's theorized goal-opportunity congruence premise and have implications for quality-of-life interventions to assist community-dwelling older adults.
Comparison of choose-a-movie and approach–avoidance paradigms to measure social motivation
Dubey, I.; Ropar, D.; Hamilton, A.
2017-01-01
Social motivation is a subjective state which is rather difficult to quantify. It has sometimes been conceptualised as “behavioural effort” to seek social contact. Two paradigms: approach–avoidance (AA) and choose a movie (CAM), based on the same conceptualisation, have been used to measure social motivation in people with and without autism. However, in absence of a direct comparison, it is hard to know which of these paradigms has higher sensitivity in estimating preference for social over ...
Patrick, Heather; Neighbors, Clayton; Knee, C Raymond
2004-04-01
Two studies examined contingent self-esteem (CSE) and responses to appearance-related social comparisons. Study 1 was an experimental study in which women rated a series of advertisements from popular women's magazines. Study 2 employed an event-contingent diary recording procedure. In Study 1, women who were higher in CSE and lower in self-perceptions of attractiveness (SPA) experienced greater decreases in positive affect and greater increases in negative affect following the ad-rating task. Study 2 results supported a mediation model in which women who were higher in CSE felt worse after social comparisons because they made primarily upward comparisons. Overall, results suggest that appearance-related comparisons are more distressing for those who base their self-worth on contingencies and have lower self-perceived attractiveness.
Strang, Louise; And Others
1978-01-01
Predictions from social comparison theory and group reference theory were tested in two experiments assessing the impact of half-day mainstreaming upon the self-concepts of academically handicapped children. The results supported the theoretical viability of social comparison theory and group reference theory in educational settings. (Author/BH)
Exercise self-identity: interactions with social comparison and exercise behaviour
Verkooijen, K.T.; de Bruijn, G.J.
2013-01-01
Possible interactions among exercise self-identity, social comparison and exercise behaviour were explored in a sample of 417 undergraduate students (Mean age = 21.5, SD = 3.0; 73% female). Two models were examined using self-report data; (1) a mediation model which proposed an association between
Exercise self-identity: interactions with social comparison and exercise behaviour
Verkooijen, K.T.; Bruijn, de G.J.
2013-01-01
Possible interactions among exercise self-identity, social comparison and exercise behaviour were explored in a sample of 417 undergraduate students (Mean age¿=¿21.5, SD¿=¿3.0; 73% female). Two models were examined using self-report data; (1) a mediation model which proposed an association between
Vidyarthi, Prajya R.; Liden, Robert C.; Anand, Smriti; Erdogan, Berrin; Ghosh, Samiran
2010-01-01
Taking an approach integrating principles of leader-member exchange (LMX) differentiation with social comparison theory, we contend that subjective ratings by individuals of their LMX compared to the LMXs of coworkers (labeled LMX social comparison, or LMXSC) explain unique and meaningful variance in outcomes beyond LMX and the actual standing of…
Comparison of dogs and humans in visual scanning of social interaction
Törnqvist, Heini; Somppi, Sanni; Koskela, Aija; Krause, Christina M.; Vainio, Outi; Kujala, Miiamaaria V.
2015-01-01
Previous studies have demonstrated similarities in gazing behaviour of dogs and humans, but comparisons under similar conditions are rare, and little is known about dogs' visual attention to social scenes. Here, we recorded the eye gaze of dogs while they viewed images containing two humans or dogs either interacting socially or facing away: the results were compared with equivalent data measured from humans. Furthermore, we compared the gazing behaviour of two dog and two human populations w...
Tian, Lili; Yu, Tingting; Huebner, E Scott
2017-01-01
The purpose of this study was to examine the multiple mediational roles of academic social comparison directions (upward academic social comparison and downward academic social comparison) on the relationships between achievement goal orientations (i.e., mastery goals, performance-approach goals, and performance-avoidance goals) and subjective well-being (SWB) in school (school satisfaction, school affect) in adolescent students in China. A total of 883 Chinese adolescent students (430 males; Mean age = 12.99) completed a multi-measure questionnaire. Structural equation modeling was used to examine the hypotheses. Results indicated that (1) mastery goal orientations and performance-approach goal orientations both showed a statistically significant, positive correlation with SWB in school whereas performance-avoidance goal orientations showed a statistically significant, negative correlation with SWB in school among adolescents; (2) upward academic social comparisons mediated the relation between the three types of achievement goal orientations (i.e., mastery goals, performance-approach goals, and performance-avoidance goals) and SWB in school; (3) downward academic social comparisons mediated the relation between mastery goal orientations and SWB in school as well as the relation between performance-avoidance goal orientations and SWB in school. The findings suggest possible important cultural differences in the antecedents of SWB in school in adolescent students in China compared to adolescent students in Western nations.
Kramer, Sam L; Rodriguez, Benjamin F
2018-07-01
Evidence suggests that the behavior inhibition system (BIS) and fight-flight-freeze system play a role in the individual differences seen in social anxiety disorder; however, findings concerning the role of the behavior approach system (BAS) have been mixed. To date, the role of revised reinforcement sensitivity theory (RST) subsystems underlying social anxiety has been measured with scales designed for the original RST. This study examined how the BIS, BAS, and fight, flight, freeze components of the fight-flight-freeze system uniquely relate to social interaction anxiety and social observation anxiety using both a measure specifically designed for the revised RST and a commonly used original RST measure. Comparison of regression analyses with the Jackson-5 and the commonly used BIS/BAS Scales revealed important differences in the relationships between RST subsystems and social anxiety depending on how RST was assessed. Limitations and future directions for revised RST measurement are discussed.
Rodgers, Rachel F; McLean, Siân A; Paxton, Susan J
2015-05-01
Sociocultural theory of body dissatisfaction posits that internalization of the media ideal and appearance comparison are predictors of body dissatisfaction, a key risk factor for eating disorders. However, no data exist regarding the longitudinal relationships between these variables. The aim of this study was to explore longitudinal relationships among internalization of the media-ideal, social appearance comparison, and body dissatisfaction. A sample of 277 Grade 7 school girls (M age = 12.77 years, SD = 0.44) completed measures of internalization of the media ideal, social appearance comparison, and body dissatisfaction at baseline, 8 months, and 14 months. Path analyses indicated that baseline internalization of the media ideal predicted social appearance comparison and body dissatisfaction at 8 months, and social appearance comparison at 8 months predicted body dissatisfaction at 14 months. A reciprocal effect emerged with body dissatisfaction at 8 months predicting internalization of the media ideal at 14 months. The findings inform sociocultural theory of body dissatisfaction, suggesting that internalization of the media ideal precedes and predicts appearance comparison and that body image interventions that target internalization of the media ideal, and social appearance comparison as well as body dissatisfaction are likely to be effective. (c) 2015 APA, all rights reserved).
Social Comparison of Wages: Impact on Satisfaction and Fairness Judgments.
Testa, Maria; Major, Brenda
Although women are consistently underpaid relative to men working in comparable jobs, women generally do not consider themselves unfairly paid. Recent work on social comparison of pay outcomes has shown that people prefer to compare themselves with others who are similar to themselves on dimensions such as job and sex. Equity theory would suggest…
AIMING AT THE TOP - UPWARD SOCIAL-COMPARISON OF ABILITIES AFTER FAILURE
YBEMA, JF; BUUNK, BP
1993-01-01
This study examined the effects of feedback on a task on information seeking and partner preferences as forms of social comparison. It was predicted that subjects who experienced failure and perceived control over future performance would, for reasons of self-improvement, choose more strongly upward
Tian, Lili; Yu, Tingting; Huebner, E. Scott
2017-01-01
The purpose of this study was to examine the multiple mediational roles of academic social comparison directions (upward academic social comparison and downward academic social comparison) on the relationships between achievement goal orientations (i.e., mastery goals, performance-approach goals, and performance-avoidance goals) and subjective well-being (SWB) in school (school satisfaction, school affect) in adolescent students in China. A total of 883 Chinese adolescent students (430 males; Mean age = 12.99) completed a multi-measure questionnaire. Structural equation modeling was used to examine the hypotheses. Results indicated that (1) mastery goal orientations and performance-approach goal orientations both showed a statistically significant, positive correlation with SWB in school whereas performance-avoidance goal orientations showed a statistically significant, negative correlation with SWB in school among adolescents; (2) upward academic social comparisons mediated the relation between the three types of achievement goal orientations (i.e., mastery goals, performance-approach goals, and performance-avoidance goals) and SWB in school; (3) downward academic social comparisons mediated the relation between mastery goal orientations and SWB in school as well as the relation between performance-avoidance goal orientations and SWB in school. The findings suggest possible important cultural differences in the antecedents of SWB in school in adolescent students in China compared to adolescent students in Western nations. PMID:28197109
DEFF Research Database (Denmark)
Mehlsen, Mimi Yung; Mikkelsen, Mai Bjørnskov
This study examined whether social comparison affected life satisfaction in younger and older adults. In an experimental setting 204 younger and older adults were shown positive and negative documentaries with same-age characters. Life satisfaction increased after downward comparisons in both age...
Comparison of dogs and humans in visual scanning of social interaction.
Törnqvist, Heini; Somppi, Sanni; Koskela, Aija; Krause, Christina M; Vainio, Outi; Kujala, Miiamaaria V
2015-09-01
Previous studies have demonstrated similarities in gazing behaviour of dogs and humans, but comparisons under similar conditions are rare, and little is known about dogs' visual attention to social scenes. Here, we recorded the eye gaze of dogs while they viewed images containing two humans or dogs either interacting socially or facing away: the results were compared with equivalent data measured from humans. Furthermore, we compared the gazing behaviour of two dog and two human populations with different social experiences: family and kennel dogs; dog experts and non-experts. Dogs' gazing behaviour was similar to humans: both species gazed longer at the actors in social interaction than in non-social images. However, humans gazed longer at the actors in dog than human social interaction images, whereas dogs gazed longer at the actors in human than dog social interaction images. Both species also made more saccades between actors in images representing non-conspecifics, which could indicate that processing social interaction of non-conspecifics may be more demanding. Dog experts and non-experts viewed the images very similarly. Kennel dogs viewed images less than family dogs, but otherwise their gazing behaviour did not differ, indicating that the basic processing of social stimuli remains similar regardless of social experiences.
Bury, B.; Tiggemann, M.; Slater, A.
2016-01-01
The current study aimed to investigate the effect of digital alteration disclaimer labels appended to fashion magazine advertisements, as well as instructional condition, on women’s social comparison and body dissatisfaction. Participants were 378 female undergraduate students who viewed 11 thin ideal advertisements with either no disclaimer, a generic disclaimer, or a more detailed specific disclaimer. There were three instructional conditions: neutral, distractor, and social comparison. Dis...
Fardouly, Jasmine; Pinkus, Rebecca T; Vartanian, Lenny R
2017-03-01
Appearance comparisons are an important sociocultural factor influencing women's body image. These comparisons can occur in different contexts (e.g., through magazines, social media, in person). However, little is known about the frequency and outcome of appearance comparisons made in different contexts in women's everyday lives. Using Ecological Momentary Assessment methods, female undergraduate students (n=146) completed a brief online survey at random times every day for 5 days. They reported the frequency, direction (upward, lateral, downward), and context of appearance comparisons, and also reported their appearance satisfaction, mood, and diet and exercise thoughts and behaviors. Upward appearance comparisons were the most common across all contexts. Upward comparisons through social media were associated with more negative outcomes on all measures (except diet and exercise behavior) than comparisons made in person, and with more negative mood than comparisons in any other context. These findings highlight the importance of the appearance comparison context. Copyright © 2016 Elsevier Ltd. All rights reserved.
Liu, Y-L; Keng, Ching-Jui
2014-01-01
In this research we explored consumers' intentions to provide untruthful or negative truthful electronic word-of-mouth (eWOM) messages when undergoing conflicting cognitive dissonance and after experiencing social comparison. We recruited 480 Taiwanese Internet users to participate in a scenario-based experiment. The findings show that after making downward comparisons on the Internet, consumers with high cognitive dissonance were more inclined to disseminate negative truthful eWOM messages c...
Bamford, Bryony; Halliwell, Emma
2009-01-01
The present study aimed to integrate attachment theory and sociocultural theory as predictors of disordered eating, thereby combining two previously distinct literatures in order to provide a more comprehensive model of eating disorder development. It was specifically proposed that women's attachment style may influence their tendency to socially compare themselves to idealized others. Participants (N = 213) were non-clinical female undergraduates. Sociocultural attitudes to appearance, social comparison, attachment and eating disorder symptomatology were assessed using self-report questionnaires. Consistent with the hypothesis, social comparison was found to mediate the relationship between attachment anxiety and disordered eating. In addition, attachment avoidance, was not significantly associated with either internalisation of cultural ideals or social comparison but was significantly related to eating psychopathology. The findings suggest that attachment anxiety and avoidance influence disordered eating via different pathways, with attachment anxiety specifically being implicated in sociocultural models of disordered eating.
Peer influence on students' estimates of performance : social comparison in clinical rotations
Raat, A. N. (Janet); Kuks, Jan B. M.; van Hell, E. Ally; Cohen-Schotanus, Janke
Context During clinical rotations, students move from one clinical situation to another. Questions exist about students strategies for coping with these transitions. These strategies may include a process of social comparison because in this context it offers the student an opportunity to estimate
Targeting cancer patients' quality of life through social comparison : A randomised trial
Brakel, Thecla M.; Dijkstra, Arie; Buunk, Abraham P.
2014-01-01
Objective: Former cancer patients' quality of life can be improved by offering social comparison information. Whether patients, however, benefit from the information may depend on how negative they perceive their present and their future. Design: We conducted a randomised experimental field study
Krones, Pamela G; Stice, Eric; Batres, Carla; Orjada, Kendra
2005-09-01
Although social comparison with media-portrayed thin-ideal images has been found to increase body dissatisfaction and negative affect, research has not yet tested whether social comparison with attractive peers in the real world produces similar effects. We randomly assigned 119 young women to interact either with a confederate who conformed to the thin ideal or one who conformed to the average body dimensions of women, within the context of an ostensive dating study. Exposure to the thin-ideal confederate resulted in an increase in body dissatisfaction but not negative affect or heart rate. Initial thin-ideal internalization, perceived sociocultural pressure, self-esteem, and observer-rated attractiveness did not moderate these effects. Results suggest that social comparative pressure to be thin fosters body dissatisfaction but may not promote negative affect. 2005 by Wiley Periodicals, Inc.
Mahler, Heike I M
2018-02-01
This experiment examined the cognitive and emotional impact of two social comparison-based sun protection interventions in a sample of Southern California college students (N = 223). One of the interventions employed comparison UV photos of peers who had either much more (downward social comparison) or much less (upward social comparison) skin damage than did participants themselves. The second intervention consisted of descriptive norms information suggesting that a large majority of the participants' peer group regularly protect their skin from the sun. Participants were randomly assigned to one of eight conditions in a 4 (Social Comparison Information: no photo vs. no comparison photos vs. upward comparison photos vs. downward comparison photos) × 2 (Descriptive Norms Information: Received vs. not received) design. Emotional reactions (e.g. worry, embarrassment, relief) and sun-related cognitive reactions (perceived susceptibility, sun protection intentions) were assessed immediately. Sun protection behaviours were assessed in a surprise telephone follow-up five weeks following the intervention. The results demonstrated that the combination of seeing photos of peers who had very little sun damage and learning that a majority of one's peers engage in regular sun protection resulted in reliably greater subsequent sun protection than all other conditions. Further, there was relatively direct evidence that both negative emotional reactions and sun protection intentions mediated this effect. These findings add to the growing literature suggesting the importance of thoroughly examining the role of emotions in health behaviour decisions. Both theory and intervention efficacy would benefit from a better understanding of the relative role of cognitions and emotions in behaviour change.
Monteón, Francisco J; Gómez, Benjamin; Valdespino, Carlos; Chávez, Salvador; Sandoval, Mario; Flores, Antonio; Herrera, Roberto; Ramos, Francisco; Hernandez, Alfonso; Camarena, José L; Páez, Hugo; Ramírez, José; Nieves, Juan J; Bassols, Angel; Rosales, Guillermo; Romero, Omar; Paredes, Graciela; Andrade, Jorge; Ruelas, Sara; Contreras, Ana M
2003-01-01
A total of 1,356 kidney transplants has been performed in the Hospital de Especialidades del Centro Médico Nacional de Occidente, IMSS, in Guadalajara Mexico, including 935 in the past 8 years. This represents an important increase of this activity in our country. Of the total transplants, 1,218 (90%) were from living donors and only 138 (10%) were from cadaveric donors, a number that we hope to increase. Most recipients were young adults, with an average age of 31 years old. The overall one-year graft and patient survival rates for living-donor kidney recipients were 90% and 82%, and for cadaveric kidney recipients they were 80% and 70%, respectively. Acute rejections occurred in 17% and chronic allograft nephropathy was diagnosed in 7% of our kidney transplant recipients. The main cause of patient death was infection, frequently invasive CMV. Cardiovascular complications were a relatively infrequent cause of death as has been seen in other international series. Hepatitis B and C have been widley studied. Hepatitis C is the most prevalent viral infection in our population. Both living and cadaveric donors in our series were young, which may explain the good results. We have had very few complications among living donors and no mortality. Two donors developed chronic renal insufficiency after the kidney donation (0.001%). This excellent safety record reflects the experience of our team. We hope to increase the number of cadaveric transplant donors with the renewed interest in enlarging the transplantation programs in Mexico while maintaining our high percentage of living donors in order to benefit more patients.
Mollee, Julia S.; Klein, Michel C.A.
2017-01-01
It has been established that social processes play an important role in achieving and maintaining a healthy lifestyle, but there are still gaps in the knowledge on how to apply such processes in behavior change interventions. One of these mechanisms is social comparison, i.e. the tendency to
Skurka, Chris
2017-11-28
With certain populations in the United States at higher risk for obesity than other populations, public health advocates have attempted to draw attention to these inequalities to galvanize support for obesity-mitigation policies. Yet research comparing different messages about social inequalities indicates that not all social comparisons are persuasive. Drawing on Weiner's (1986) theory of perceived responsibility and social motivation, I experimentally tested promising message frames about obesity disparities. Participants (N = 653) read one of six messages following a 3 (social comparison frame: geographic vs. racial vs. no-comparison) × 2 (age frame: child vs. adult) between-subjects design. Unexpectedly, geographic frames (rural/urban) indirectly decreased policy support relative to the control frame by way of increased counterarguing. Compared to adult frames about obesity inequalities, childhood frames evoked more sympathy and less internal attribution, which in turn positively predicted support for obesity-prevention policies. Practical and theoretical implications of these findings are discussed.
Positive interaction of social comparison and personal responsibility for outcomes.
Grygolec, Jaroslaw; Coricelli, Giorgio; Rustichini, Aldo
2012-01-01
We formulate and test a model that allows sharp separation between two different ways in which environment affects evaluation of outcomes, by comparing social vs. private and personal responsibility vs. chance. In the experiment, subjects chose between two lotteries, one low-risk and one high-risk. They could then observe the outcomes. By varying the environment between private (they could observe the outcome of the chosen lottery and the outcome of the lottery they had not chosen) and social (they could observe the outcome of the lottery chosen by another subject) we can differentiate the response and brain activity following the feedback in social and private settings. The evidence suggests that envy and pride are significant motives driving decisions and outcomes evaluation, stronger than private emotions like regret and rejoice, with ventral striatum playing a key role. When we focus on the outcome evaluation stage we demonstrate that BOLD signal in ventral striatum is increasing in the difference between obtained and counterfactual payoffs. For a given difference in payoffs, striatal responses are more pronounced in social than in private environment. Moreover, a positive interaction (complementarity) between social comparison and personal responsibility is reflected in the pattern of activity in the ventral striatum. At decision stage we observe getting ahead of the Joneses effect in ventral striatum with subjective value of risk larger in social than in private environment.
Comparative inter-institutional study of stress among dentists.
Pozos-Radillo, Blanca E; Galván-Ramírez, Ma Luz; Pando, Manuel; Carrión, Ma De los Angeles; González, Guillermo J
2010-01-01
Dentistry is considered to be a stressful profession due to different factors caused by work, representing a threat to dentists'health. The objectives of this work were to identify and compare chronic stress in dentists among the different health institutions and the association of stress with risk factors. The study in question is observational, transversal and comparative; 256 dentists were included, distributed among five public health institutions in the city of Guadalajara, Jalisco, Mexico, namely: the Mexican Institute of Social Security (IMSS), the Ministry of Health (SS), the Integral Development of the Family (DIF), the Social Security Services Institute for the Workers (ISSSTE) and the University of Guadalajara (U. de G) Data were obtained by means of the census technique. Stress was identified using the Stress Symptoms Inventory and the statistical analysis was performed using the Odds Ratio (O.R.) and the chi-square statistic. From the total population studied, 219 subjects presented high levels of chronic stress and 37, low levels. In the results of comparative analysis, significant differences were found between IMSS and U. de G and likewise between IMSS and SS. However, in the analysis of association, only U. de G was found to be associated with the high level of chronic stress.
Müller-Kalthoff, Hanno; Helm, Friederike; Möller, Jens
2017-01-01
Students evaluate their domain-specific abilities by comparing their own achievement in one domain to that of others (social comparison), to their own previous achievement (temporal comparison), as well as their own achievement in another domain (dimensional comparison). The theories underlying these three comparison processes each assume an…
Stigma, Social Comparison and Self-Esteem in Adults with an Intellectual Disability
Paterson, Lucy; McKenzie, Karen; Lindsay, Bill
2012-01-01
Background: The paper examines the perception of stigma in 43 adults with an intellectual disability, the relationship this has with their psychological well-being and whether the process of social comparison has a moderating effect on this relationship. Materials and Methods: A questionnaire-based, within-participant design was used. Participants…
Erhardt, Drew; Hinshaw, Stephen P
1994-08-01
This study systematically compared the influence of naturalistic social behaviors and nonbehavioral variables on the development of peer status in 49 previously unfamiliar boys, aged 6-12 years, who attended a summer research program. Twenty-five boys with attention-deficit hyperactivity disorder (ADHD) and 24 comparison boys participated. Physical attractiveness, motor competence, intelligence, and academic achievement constituted the nonbehavioral variables; social behaviors included noncompliance, aggression, prosocial actions, and isolation, measured by live observations of classroom and playground interactions. As early as the first day of interaction, ADHD and comparison boys displayed clear differences in social behaviors, and the ADHD youngsters were overwhelmingly rejected. Whereas prosocial behavior independently predicted friendship ratings during the first week, the magnitude of prediction was small. In contrast, the boys' aggression (or noncompliance) strongly predicted negative nominations, even with nonbehavioral factors, group status (ADHD versus comparison), and other social behaviors controlled statistically. Implications for understanding and remediating negative peer reputations are discussed.
Calderón-Garcidueñas, Ana Laura; Martínez-Salazar, Griselda; Fernández-Díaz, Héctor; Cerda-Flores, Ricardo M
2002-02-01
The aim was to study the causes of maternal mortality (MM) and the percent of concordance between the clinical diagnosis and the autopsy findings. The autopsies of maternal death (1980-1999) from the Hospital de Especialidades, Centro Médico del Noreste, IMSS in Monterrey, México, were analyzed. The cases were classified in directly obstetric maternal mortality (DOM) and indirectly obstetric maternal mortality (IOM), the causes were studied and the percent of concordance between pre- and post-mortem diagnosis was determined. There were 124 deaths. Autopsy was performed in 61 (49.1%) women. In 55 cases the clinical file and the autopsy protocol were available. This was our sample for study. Sixty percent of the cases were DO. Causes of DOM were: specific hypertensive pregnancy disease (SHPD) (51.6%), sepsis (35.5%), hypovolemic shock (9.7%), anesthetic accidents (3%); causes of IOM were: sepsis (41.7%), malignancies (16.7%), hematological diseases (12.5%), cardiopathy and systemic arterial hypertension (12.5%), hepatic disorders (12.5%), and Superior Longitudinal Sinus thrombosis (4%). A 100% clinical-pathological concordance was observed in DOM cases, while only a 41.6% was found in IOM cases. In those cases of sepsis (IOM), the etiologic agents were identified only in 20% before death. The early detection and treatment of SHPD and the prevention of sepsis should decrease the MM. This study showed some weakness in the Health Services that should be improved.
The impact of forced social comparison on adolescents’ self-esteem and appearance satisfaction
Directory of Open Access Journals (Sweden)
Purić Danka
2011-01-01
Full Text Available The impact of forced social comparison on adolescents’ self-esteem and appearance satisfaction research, conducted on a sample of 133 high school seniors, consisted of two phases. In phase one, participants were given the Rosenberg Self-Esteem Inventory, Appearance Satisfaction Scale and Appearance Relevance Scale, and in phase two, one month later, they were exposed to photographs of attractive and unattractive individuals. Two groups of boys and girls each assessed attractive or unattractive individuals of their own gender, while two control groups (of both genders were not exposed to any photographs. Immediately after assessing the photographs, the participants were again given the Rosenberg Self-Esteem Inventory and Appearance Satisfaction Scale. We found that forced social comparison had an impact on self-esteem and a marginally significant effect on appearance satisfaction in the group of participants (of both genders assessing the photographs of unattractive individuals, while no effects were found in the either the control group or the group assessing the photographs of attractive individuals. We also examined the impact of self-esteem, appearance satisfaction and appearance relevance as moderating variables on the effect size of social comparison and showed that higher pretest self-esteem and appearance relevance and lower appearance satisfaction predict higher posttest self-esteem scores, regardless of the participants’ group membership. The group of participants exposed to photographs of unattractive people, however, showed the opposite pattern - those participants who had initially lower self-esteem have increased it more as a result of the experimental exposure.
Kesici, Sahin; Erdogan, Ahmet
2010-01-01
The purpose of this study is to clarify whether middle school students' mathematics anxiety differentiates or not, according to their low and high achievement motivation and their level of self-esteem stemming from social comparison. This study also aims to clarify the effects of these two variables on mathematics anxiety. The study groups were…
Harming High Performers : A Social Comparison Perspective on Interpersonal Harming in Work Teams
Lam, Catherine K.; Van der Vegt, Gerben S.; Walter, Frank; Huang, Xu; Huang, Xin
This study developed a multilevel model of the interpersonal harming behavior associated with social comparison processes in work teams. We tested this model using temporally lagged data from a sample of student teams (Study 1) and cross-sectional data from a sample of work teams in a
We can do it : The interplay of construal orientation and social comparisons under threat
Marx, David M; Stapel, Diederik A; Muller, Dominique
The authors investigated how a collective self-construal orientation in combination with positive social comparisons "turns off" the negative effects of stereotype threat. Specifically, Experiment 1 demonstrated that stereotype threat led to increased accessibility of participants' collective self
Bride, Brian E.; Kintzle, Sara; Abraham, Amanda J.; Roman, Paul M.
2012-01-01
The purpose of this study was to examine factors that may be associated with variation in social workers' perceptions of effectiveness, perceptions of acceptability, and use of psychosocial evidence-based practices (EBPs) for the treatment of substance use disorders (SUD) in comparison to other SUD counselors who are non-social workers. A national…
Relative state, social comparison reactions, and the behavioral constellation of deprivation.
Novakowski, Dallas; Mishra, Sandeep
2017-01-01
Pepper & Nettle compellingly synthesize evidence indicating that temporal discounting is a functional, adaptive response to deprivation. In this commentary, we underscore the importance of the psychology of relative state, which is an index of relative competitive (dis)advantage. We then highlight two proximate emotional social comparison reactions linked with relative state - personal relative deprivation and envy - that may play an important role in the deprivation-discounting link.
Hanna, Emily; Ward, L Monique; Seabrook, Rita C; Jerald, Morgan; Reed, Lauren; Giaccardi, Soraya; Lippman, Julia R
2017-03-01
Although Facebook was created to help people feel connected with each other, data indicate that regular usage has both negative and positive connections to well-being. To explore these mixed results, we tested the role of social comparison and self-objectification as possible mediators of the link between Facebook use and three facets of psychological well-being: self-esteem, mental health, and body shame. Participants were 1,104 undergraduate women and men who completed surveys assessing their Facebook usage (minutes, passive use, and active use), social comparison, self-objectification, and well-being. Data were analyzed using structural equation modeling, testing separate models for women and men. Models for each gender fit the data well. For women and men, Facebook use was associated with greater social comparison and greater self-objectification, which, in turn, was each related to lower self-esteem, poorer mental health, and greater body shame. Mediated models provided better fits to the data than models testing direct pathways to the mediators and well-being variables. Implications are discussed for young people's social media use, and future directions are provided.
Aspinwall, L G; Taylor, S E
1993-05-01
Two studies explored the conditions under which social comparisons are used to manage negative affect and naturalistic threats. Study 1 examined induced mood and dispositional self-esteem as determinants of affective responses to upward and downward comparisons. Consistent with a mood repair prediction, only low-self-esteem Ss in whom a negative mood had been induced reported improved mood after exposure to downward comparison information. Study 2 examined the impact of naturalistic threats on responses to comparison information. Relative to a no-comparison baseline, low-self-esteem Ss who had experienced a recent academic setback reported more favorable self-evaluations and greater expectations of future success in college after exposure to downward comparison information. These results remained significant after controlling statistically for general distress. Implications for downward comparison theory are discussed.
Johnson, Camille S.; Stapel, Diederik A.
2011-01-01
People in a positive mood process information in ways that reinforce and maintain this positive mood. The current studies examine how positive mood influences responses to social comparisons and demonstrates that people in a positive mood interpret ambiguous information about comparison others in self-benefitting ways. Specifically, four experiments demonstrate that compared to negative mood or neutral mood participants, participants in a positive mood engage in effortful re-interpretations o...
Morrison, Todd G.; Kalin, Rudolf; Morrison, Melanie A.
2004-01-01
Sociocultural theory and social comparison theory were used to account for variations in body-image evaluation and body-image investment among male and female adolescents (N = 1,543). Exposure to magazines and television programs containing idealistic body imagery as well as frequency of self-comparison to universalistic targets (e.g., fashion…
Boissicat, Natacha; Pansu, Pascal; Bouffard, Therese; Cottin, Fanny
2012-01-01
According to the literature, among social comparison mechanisms, identification with an upward target would be the most frequent mechanism that students report to use. However, it remains unclear how the identification and the contrast mechanisms contribute to the construction of pupils' scholastic perceived competence. The aim of this study was…
Locock, Louise; Brown, Janice B
2010-10-01
This paper explores attitudes to peer support among people with Motor Neurone Disease (MND) and their family carers. It reports findings from a secondary analysis of data from two UK interview studies conducted by the authors. The process of secondary analysis is reported in detail. 48 people with MND and 22 carers were interviewed in 2005-2007. The authors identified narrative extracts on peer support from their own datasets and exchanged them for independent thematic analysis. Subsequent discussion, drawing on literature on support groups and social comparison, led to an exploration of two overarching themes: valuing camaraderie and comparison, and choosing isolation. Findings suggest that social comparison theory is a useful framework for analysing attitudes to MND support groups, but that on its own it is insufficient. 'Valuing camaraderie and comparison' explains how support groups offer practical and social support, as well as beneficial opportunities for social comparison. Seeing others coping well with the condition can provide hope, while downward comparison with those worse off can also make people feel better about their own situation. However, most people are also shocked and saddened by seeing others with the condition. Tension of identity can occur when group membership starts to define the individual as 'a person with MND, rather than the person I am that happens to have MND'. Choosing isolation can be a deliberate defensive strategy, to protect oneself from witnessing one's possible future. Levels of involvement may change over time as people struggle with their changing needs and fears. Copyright © 2010 Elsevier Ltd. All rights reserved.
Can the Media Affect Us? Social Comparison, Self-Discrepancy, and the Thin Ideal
Bessenoff, Gayle R.
2006-01-01
The current study explored body image self-discrepancy as moderator and social comparison as mediator in the effects on women from thin-ideal images in the media. Female undergraduates (N = 112) with high and low body image self-discrepancy were exposed to advertisements either with thin women (thin ideal) or without thin women…
Social cognition in schizophrenia in comparison to bipolar disorder: A meta-analysis.
Bora, Emre; Pantelis, Christos
2016-08-01
Cognitive dysfunction is a common characteristic of both schizophrenia and bipolar disorder (BP). While these deficits are more severe in schizophrenia, there is a significant overlap between conditions. However, it was hypothesized that social cognitive deficits might be more specific to schizophrenia. We conducted a meta-analysis of studies comparing facial emotion recognition and theory of mind (ToM) abilities in schizophrenia and BP. 26 studies comparing 1301 patients with schizophrenia and 1075 with BP were included. Schizophrenia patients significantly underperformed compared with BP patients in both facial emotion recognition (d=0.39) and ToM (d=0.57). Neurocognitive deficits significantly contributed to schizophrenia-BP group differences for ToM. However, between-group differences for social cognition were not statistically more severe than neurocognition. Social cognitive impairment is more severe in schizophrenia in comparison to BP. However, between-group differences are modest and are comparable to other neurocognitive differences between schizophrenia and BP. There is significant overlap in social cognitive performance deficits observed in both schizophrenia and BP. Copyright © 2016 Elsevier B.V. All rights reserved.
Causse, Elsa; Félonneau, Marie-Line
2014-01-01
Research on uniqueness is widely focused on cross-cultural comparisons and tends to postulate a certain form of within-culture homogeneity. Taking the opposite course of this classic posture, we aimed at testing an integrative approach enabling the study of within-culture variations of uniqueness. This approach considered different sources of variation: social status, gender, life contexts, and interpersonal comparison. Four hundred seventy-nine participants completed a measure based on descriptions of "self" and "other." Results showed important variations of uniqueness. An interaction between social status and life contexts revealed the expression of uniqueness in the low-status group. This study highlights the complexity of uniqueness that appears to be related to both cultural ideology and social hierarchy.
International Nuclear Information System (INIS)
Juárez-Ocaña, Servando; González-Miranda, Guadalupe; Mejía-Aranguré, Juan Manuel; Rendón-Macías, Mario Enrique; Martínez-García, María del Carmen; Fajardo-Gutiérrez, Arturo
2004-01-01
The objective of this article is to present the frequency of cancer in Mexican children who were treated in the hospitals of the Instituto Mexicano del Seguro Social in Mexico City (IMSS-MC) in the period 1996–2001. The Registry of Cancer in Children, started in 1996 in the IMSS-MC, is an on-going, prospective register. The data from 1996 through 2001 were analyzed and the different types of cancer were grouped according to the International Classification for Cancer in Children (ICCC). From this analysis, the general and specific frequencies by age and by sex were obtained for the different groups of neoplasms. Also, the frequency of the stage of the disease that had been diagnosed in cases of children with solid tumors was obtained. A total of 1,702 new cases of children with cancer were registered, with the male/female ratio at 1.1/1. Leukemias had the highest frequency with 784 cases (46.1%) and, of these, acute lymphoblastic leukemias were the most prevalent with 614 cases (78.3%). Thereafter, in descending order of frequency, were tumors of the central nervous system (CNST) with 197 cases (11.6%), lymphomas with 194 cases (11.4%), germinal cell tumors with 110 cases (6.5%), and bone tumors with 97 cases (5.7%). The highest frequency of cancer was found in the group of one to four year-olds that had 627 cases (36.8%). In all the age groups, leukemias were the most frequent. In the present work, the frequency of Hodgkin's disease (~4%) was found to be lower than that (~10%) in previous studies and the frequency of tumors of the sympathetic nervous system was low (2.3%). Of those cases of solid tumors for which the stage of the disease had been determined, 66.9% were diagnosed as being Stage III or IV. The principal cancers in the children treated in the IMSS-MC were leukemias, CNST, and lymphomas, consistent with those reported by developed countries. A 2.5-fold reduction in the frequency of Hodgkin's disease was found. Of the children, the stage of
Social comparison framing in health news and its effect on perceptions of group risk.
Bigman, Cabral A
2014-01-01
News about health disparities often compares health risks faced by different demographic groups. Does this social comparison produce a contrast effect? It was hypothesized that when two racial groups are compared, people would perceive the relatively more at-risk group to be more, and the less at-risk group to be less, at-risk than if the same risk information was presented without the comparative reference group. Three experiments with Black and White respondents tested effects of intergroup social comparison framing (SCF) on perceptions of risk for sexually transmitted infections and skin cancer. SCF (including one White and two Black disparity frames) did not raise respondents' perceived risk regarding the more at-risk racial group, but consistently lowered respondents' risk ratings for the less at-risk racial group. The finding that the same statistic was perceived differently in comparative and noncomparative contexts underscores the importance of considering effects of communication about disparities.
Peer influence on students' estimates of performance: social comparison in clinical rotations.
Raat, A N Janet; Kuks, Jan B M; van Hell, E Ally; Cohen-Schotanus, Janke
2013-02-01
During clinical rotations, students move from one clinical situation to another. Questions exist about students' strategies for coping with these transitions. These strategies may include a process of social comparison because in this context it offers the student an opportunity to estimate his or her abilities to master a novel rotation. These estimates are relevant for learning and performance because they are related to self-efficacy. We investigated whether student estimates of their own future performance are influenced by the performance level and gender of the peer with whom the student compares him- or herself. We designed an experimental study in which participating students (n = 321) were divided into groups assigned to 12 different conditions. Each condition entailed a written comparison situation in which a peer student had completed the rotation the participant was required to undertake next. Differences between conditions were determined by the performance level (worse, similar or better) and gender of the comparison peer. The overall grade achieved by the comparison peer remained the same in all conditions. We asked participants to estimate their own future performance in that novel rotation. Differences between their estimates were analysed using analysis of variance (ANOVA). Students' estimates of their future performance were highest when the comparison peer was presented as performing less well and lowest when the comparison peer was presented as performing better (p influences students' estimates of their future performance in a novel rotation. The effect depends on the performance level and gender of the comparison peer. This indicates that comparisons against particular peers may strengthen or diminish a student's self-efficacy, which, in turn, may ease or hamper the student's learning during clinical rotations. The study is limited by its experimental design. Future research should focus on students' comparison behaviour in real transitions
[Historical exploration of Acapulco hospitals, Guerrero, Mexico].
Fajardo-Ortiz, Guillermo; Salcedo-Alvarez, Rey Arturo
2006-01-01
This study attempts to recount the history of the main hospitals of the port of Acapulco from colonial times until the end of the 20th century. The Augustine friars began hospital care at the end of the first part of the 16th century. Later, Bernardino Alvarez (1514?-1584), with the support of the Spanish crown, founded the first formal hospital in Acapulco called Hospital de Nuestra Señora de la Consolación (Our Lady of Consolation Hospital). During the 16th and 17th centuries, the sick were attended by friars, and by the end of the 19th century there were physicians and surgeons. From the end of the Independence War until the end of the 19th century, the port did not have any true hospital. The first degreed physicians and surgeons arrived and resided in Acapulco in 1920. In 1938, the Hospital Civil Morelos (Morelos Civil Hospital) began providing services. It was replaced by the Hospital General de Acapulco (General Hospital of Acapulco). At the fourth decade of the past century the Cruz Roja (Red Cross) was created. In 1957 the hospital services of the Instituto Mexicano del Seguro Social (IMSS, Mexican Institute of Social Security), which was founded in 1963, was inaugurated with the Unidad Medico/Social (Medical and Social Unit) of the IMSS in Acapulco. This began the journey of modernity in Acapulco. In 1992, Hospital Regional Vicente Guerrero (Regional Hospital Vicente Guerrero) of the IMSS, initiated its services. In 1960, medical services for civil workers and their families were housed in the Hospital Civil Morelos (Morelos Civil Hospital). Shortly afterwards, the Instituto de Seguridad y Servicios Sociales para los Trabajadores del Estado (ISSSTE, Security and Social Services Institute for State Employees) had their own hospital. During the 20th century, Acapulco has added other hospital services to care for members of the navy and armed forces, as well as for those persons with financial resources for private care.
See No Evil, Hear No Evil: Senior Leaders' Social Comparisons, and the Low Salience of Racial Issues
National Research Council Canada - National Science Library
Nacoste, Rupert
1998-01-01
.... Working from an informational interdependence perspective, it is argued that by virtue of their demographic and hierarchical isolation, senior military leaders rely on social comparison to make...
Dimensional comparison theory.
Möller, Jens; Marsh, Herb W
2013-07-01
Although social comparison (Festinger, 1954) and temporal comparison (Albert, 1977) theories are well established, dimensional comparison is a largely neglected yet influential process in self-evaluation. Dimensional comparison entails a single individual comparing his or her ability in a (target) domain with his or her ability in a standard domain (e.g., "How good am I in math compared with English?"). This article reviews empirical findings from introspective, path-analytic, and experimental studies on dimensional comparisons, categorized into 3 groups according to whether they address the "why," "with what," or "with what effect" question. As the corresponding research shows, dimensional comparisons are made in everyday life situations. They impact on domain-specific self-evaluations of abilities in both domains: Dimensional comparisons reduce self-concept in the worse off domain and increase self-concept in the better off domain. The motivational basis for dimensional comparisons, their integration with recent social cognitive approaches, and the interdependence of dimensional, temporal, and social comparisons are discussed. PsycINFO Database Record (c) 2013 APA, all rights reserved.
Barnes, Jemima S.; Spray, Christopher M.
2013-01-01
Drawing from theory and research into social comparison processes, the present study sought to determine children's motives for comparison in addition to the coexistence of class and individual comparisons in school physical education. The main and interactive effects of these types of comparisons were examined in relation to pupils'…
Effects of the source of social comparison information on former cancer patients' quality of life.
Brakel, Thecla M; Dijkstra, Arie; Buunk, Abraham P
2012-11-01
Life, following curative treatment, can be a struggle for former cancer patients. In this phase of their illness, social comparison information may help to improve a patient's quality of life (QOL). The objective of this study was to determine whether the effects of this information depend on the following two variables: (1) the individual's physical health and (2) the individual's sensitivity to social comparison. In the current study, the effects on a patient's QOL were tested that occur when they are listening to a psychological oncological expert talking about cancer patients' experiences. Three different recorded interviews with experts were compared (on negative emotions, effective coping, or both), and individual differences were tested as moderators. In addition, the expert source conditions were compared with a condition in which the source was not an expert but a former patient. In a randomized field experiment, 154 Dutch former cancer patients (M(age) = 55 years; 68% women) were assigned to one of the four conditions (three expert source and one former patient source condition). QOL was assessed after 2 months. The effects of the expert source conditions on QOL depended on the participants' physical health (good vs. poor) and on the participants' sensitivity to social comparison (whether the recipient reacts with contrast or identification), as indicated by significant three-way interactions (p source conditions was at least as effective as the former patient source condition. The results show that desired and undesired effects are found when individual differences relevant to the processing of intervention information are examined. ©2012 The British Psychological Society.
Genes underlying reproductive division of labor in termites, with comparisons to social Hymenoptera
Directory of Open Access Journals (Sweden)
Judith eKorb
2016-04-01
Full Text Available All social insects are characterized by a reproductive division of labor. Within a colony only a few individuals reproduce (queens and in termites, also a king while the large majority (workers and soldiers forgo reproduction, at least temporarily. The evolution of such reproductive altruism can ultimately be explained by inclusive fitness theory. Here, I will review the proximate genetic mechanisms underlying this altruism in termites. As social cockroaches they evolved eusociality independently from the social Hymenoptera, which makes them interesting test cases to look for common underlying mechanisms of eusociality and lineage specific idiosyncrasies. First, I will provide a summary of the genes and their function that have been identified to underlie reproductive division of labor - so called 'queen genes,' - in the drywood termite Cryptotermes secundus, an emerging model to study termite social evolution. Second, I outline how widespread these queen genes are across the termite phylogeny, using also evidence from recent genome analyses. I will provide hypotheses about the evolutionary origin of these queen genes, aiming to link proximate mechanisms with ultimate functions. Finally, I will draw comparisons to social Hymenoptera to indicate potential common underpinnings that warrant further testing.
Directory of Open Access Journals (Sweden)
Fabio de Nardis
2014-11-01
Full Text Available All political sciences share the same logic and methods as the empirical social sciences and therefore produce perceptive knowledge. Empirical knowledge is based on a specific kind of observation driven by a set of theoretically developed concepts related to clearly observable social phenomena. Not all the concepts, however, are readily amenable to observational terms. We usually need to proceed to their operationalization. The formulation and the operational definition of the empirical concepts does not exhaust the analytic process. It is also necessary to observe how the phenomenon occurs in the reality, proceeding to classification or typological constructions and, sometimes, to the production of multi-dimensional models. Only after this process will the formulation of hypotheses be possible. They will later be verified through the use of methods of empirical control. The most frequently used activity in political sociology is comparison, which is the main method of any social science according to most scholars. Comparison can be carried out both among a certain number of cases or within a single case by comparing it in its historical development. The temporal dimension becomes crucial when one wishes to produce historically rooted generalizations and theories, therefore confined to a spatial and temporal dimension. Before proceeding with the comparison we must make sure that the cases selected are actually comparable and that they possess at least one property in common. The objective of this paper is therefore to describe forms and styles of comparison within the logic of social and political sciences
Effects of the source of social comparison information on former cancer patients' quality of life
Brakel, T.M.; Dijkstra, A.; Buunk, Abraham (Bram)
2012-01-01
Objective. Life, following curative treatment, can be a struggle for former cancer patients. In this phase of their illness, social comparison information may help to improve a patient's quality of life (QOL). The objective of this study was to determine whether the effects of this information
Negative social comparisons and psychosis proneness in a healthy adolescent population.
Cotier, F A; Toulopoulou, T
2017-10-01
There is growing evidence of an association between negative social comparisons (NSC) and both psychosis, and psychosis proneness. The majority of the work thus far, however, has focused largely on one type of NSC, namely, social rank. Whilst social rank is clearly an important factor, an individual's perception of belonging is likely also of importance; particularly, when considering individuals from collectivistic cultures such as China, where greater emphasis is placed on fitting into the group. There is also limited research investigating what factors may contribute towards the relationship between NSC and psychosis proneness, and to what extent this relationship may be due to common familial factors. To address these issues, we examined whether (1) Social rank and perceived belonging predict negative, positive and depressive psychotic experiences in a Chinese, adolescent, twin and sibling population, (2) coping styles moderate the impact of these relationships and (3), there is a familial association between NSC and psychosis proneness. Both social rank and perceived belonging were found to predict the negative and depressive dimensions of psychosis. These relationships were moderated by problem-focused coping styles. Interestingly, the association between perception of belonging, and negative psychotic experiences was familial-and stronger in Monozygotic twins-indicating perhaps shared aetiology due to common genes. Our findings highlight NSC as potential vulnerability markers for negative and depressive psychotic experiences, and suggest potentially different aetiological pathways amongst different NSC and different psychotic experiences. On a clinical level, our findings emphasize the need to consider coping styles when treating at-risk individuals. Copyright © 2017 Elsevier Masson SAS. All rights reserved.
Toro, Paul A.; And Others
1990-01-01
A comparison of 86 learning-disabled children, aged 7-11, and 86 age-matched controls found that subjects were able to generate fewer alternatives for solving social problems, showed less adaptive assertiveness and tolerance for frustration, exhibited more classroom behavior problems, displayed less personal and social competence, and had more…
Mumford, Michael D.
1983-01-01
Reviewed characteristics of peer evaluations and notes their striking industrial validity. A review of the conditions under which peer evaluations yield strong validity coefficients as well as certain factor analytic and experimental studies indicated that social comparison theory might be useful for elucidating the nature of peer evaluation…
Directory of Open Access Journals (Sweden)
Paul H Davis
Full Text Available The protozoan intestinal parasite Entamoeba histolytica infects millions of people worldwide and is capable of causing amebic dysentery and amebic liver abscess. The closely related species Entamoeba dispar colonizes many more individuals, but this organism does not induce disease. To identify molecular differences between these two organisms that may account for their differential ability to cause disease in humans, we used two-dimensional gel-based (DIGE proteomic analysis to compare whole cell lysates of E. histolytica and E. dispar. We observed 141 spots expressed at a substantially (>5-fold higher level in E. histolytica HM-1:IMSS than E. dispar and 189 spots showing the opposite pattern. Strikingly, 3 of 4 proteins consistently identified as different at a greater than 5-fold level between E. histolytica HM-1:IMSS and E. dispar were identical to proteins recently identified as differentially expressed between E. histolytica HM-1:IMSS and the reduced virulence strain E. histolytica Rahman. One of these was E. histolytica alcohol dehydrogenase 3 (EhADH3. We found that E. histolytica possesses a higher level of NADP-dependent alcohol dehydrogenase activity than E. dispar and that some EhADH3 can be localized to the surface of E. histolytica. Episomal overexpression of EhADH3 in E. histolytica trophozoites resulted in only subtle phenotypic differences in E. histolytica virulence in animal models of amebic colitis and amebic liver abscess, making it difficult to directly link EhADH3 levels to virulence differences between E. histolytica and less-pathogenic Entamoeba.
Social mechanisms and social causation
Friedel Weinert
2014-01-01
The aim of this paper is to examine the notion of social mechanisms by comparison with the notions of evolutionary and physical mechanisms. It is argued that social mechanisms are based on trends, and not lawlike regularities, so that social mechanisms are different from mechanisms in the natural sciences. Taking as an example of social causation the abolition of the slave trade, this paper argues that social mechanisms should be incorporated in Weber’s wider ...
Marsh, Herbert W.; Trautwein, Ulrich; Ludtke, Oliver; Koller, Olaf
2008-01-01
Two studies integrate the big-fish-little-pond effect (BFLPE; negative effects of class-average achievement on academic self-concept, ASC), which is based upon educational psychological research, with related social psychological research that is based on social comparison theory. Critical distinctions are the nature of the social comparison…
Bosch, A. Zwenneke; Buunk, Abraham P.; Siero, Frans W.; Park, Justin H.
As the tendency to compare oneself with others may be associated with the tendency to focus on similarities, we hypothesized that individual differences in social comparison orientation (SCO) may moderate the consequences of upward and downward comparisons. In Study 1, high comparers were found to
Vidyarthi, Prajya R; Liden, Robert C; Anand, Smriti; Erdogan, Berrin; Ghosh, Samiran
2010-09-01
Taking an approach integrating principles of leader-member exchange (LMX) differentiation with social comparison theory, we contend that subjective ratings by individuals of their LMX compared to the LMXs of coworkers (labeled LMX social comparison, or LMXSC) explain unique and meaningful variance in outcomes beyond LMX and the actual standing of those individuals in the LMX distribution, referred to as relative LMX, or RLMX. Our findings demonstrate that employees' perceptions of LMXSC are positively related beyond the effects of LMX and RLMX to job performance and citizenship behaviors. Further, we argue that LMXSC mediates the RLMX→outcomes relationships. Analyses showed that, in a sample of 254 employees nested in 50 work groups, a significant part of the effects of RLMX on job performance and citizenship behaviors was mediated through LMXSC after controlling for LMX. Copyright 2010 APA, all rights reserved
[Coverage for birth care in Mexico and its interpretation within the context of maternal mortality].
Lazcano-Ponce, Eduardo; Schiavon, Raffaela; Uribe-Zúñiga, Patricia; Walker, Dilys; Suárez-López, Leticia; Luna-Gordillo, Rufino; Ulloa-Aguirre, Alfredo
2013-01-01
To evaluate health coverage for birth care in Mexico within the frame of maternal mortality reduction. Two information sources were used: 1) The comparison between the results yield by the Mexican National Health and Nutrition Surveys 2006 and 2012 (ENSANUT 2006 and 2012), and 2) the databases monitoring maternal deaths during 2012 (up to December 26), and live births (LB) in Mexico as estimated by the Mexican National Population Council (Conapo). The national coverage for birth care by medical units is nearly 94.4% at the national level, but in some federal entities such as Chiapas (60.5%), Nayarit (87.8%), Guerrero (91.2%), Durango (92.5%), Oaxaca (92.6%), and Puebla (93.4%), coverage remains below the national average. In women belonging to any social security system (eg. IMSS, IMSS Oportunidades, ISSSTE), coverage is almost 99%, whereas in those affiliated to the Mexican Popular Health Insurance (which depends directly from the Federal Ministry of Health), coverage reached 92.9%. In terms of Maternal Mortality Ratio (MMR), there are still large disparities among federal states in Mexico, with a national average of 47.0 per 100 000 LB (preliminary data for 2012, up to December 26). The MMR estimation has been updated using the most recent population projections. There is no correlation between the level of institutional birth care and the MMR in Mexico. It is thus necessary not only to guarantee universal birth care by health professionals, but also to provide obstetric care by qualified personnel in functional health services networks, to strengthen the quality of obstetric care, family planning programs, and to promote the implementation of new and innovative health policies that include intersectoral actions and human rights-based approaches targeted to reduce the enormous social inequity still prevailing in Mexico.
Directory of Open Access Journals (Sweden)
Navarrete-Espinosa Joel
2000-01-01
Full Text Available OBJETIVO: Establecer la relación entre el nivel de plomo sanguíneo materno (PSM y el de sangre en cordón umbilical (PSC al momento del parto, así como determinar los principales predictores del PSM en derechohabientes del Instituto Mexicano del Seguro Social (IMSS, en el Distrito Federal (D.F.. MATERIAL Y MÉTODOS: Se realizó un estudio transversal en el que se reclutaron voluntarias con embarazo normoevolutivo y se les tomaron muestras de sangre al momento del parto, en cuatro hospitales del IMSS en el D.F., de 1991 a 1993. Se tomó, además, muestra de sangre de cordón umbilical. Los datos fueron analizados mediante regresión lineal simple y múltiple. RESULTADOS: Se estudiaron un total de 1 404 binomios madre-hijo; el promedio de edad de las madres fue de 25 años. La media de PSM fue 10.7 ± 6.5 µg/dl; no se encontraron variaciones significativas por hospital, edad o estado civil. Para el PSC la media fue de 10.4 ± 6.2 µg/dl. Por cada aumento en una unidad logarítmica de PSM, el PSC aumenta 0.62 (p<0.01 unidades logarítmicas. La correlación entre ambos fue de 0.61 (p<0.01. Los principales predictores de PSM fueron el uso de loza vidriada, el consumo de leche y jugo de naranja, estos últimos se asociaron inversamente con el PSM. Un 47% de las madres y 50% de los niños tuvieron valores superiores a 10 µg/dl. En 578 recién nacidos se registraron niveles de plomo superiores a los de la madre. CONCLUSIONES: Se sugiere continuar la línea de investigación para proponer tipos de intervención.
A Diary Study of Self-Compassion, Upward Social Comparisons, and Body Image-Related Outcomes.
Thøgersen-Ntoumani, Cecilie; Dodos, Louisa; Chatzisarantis, Nikos; Ntoumanis, Nikos
2017-07-01
Self-compassion may protect individuals experiencing poor body image and associated maladaptive outcomes. The purpose of the study was to examine within-person associations (whilst controlling for between-person differences) between appearance-related self-compassion, appearance-related threats (operationalised as upward appearance comparisons), and body image-related variables, namely, social physique anxiety, drive for thinness, and body dissatisfaction. A diary methodology was used whereby young women (n = 126; M age = 21.26) responded to brief online surveys three times per day (11am, 3pm, and 7pm) every second day for one week (i.e. a total of 12 measurement points). Results of mixed linear modeling revealed that both state appearance-related upward comparisons and self-compassion independently predicted all three outcomes in a positive and negative fashion, respectively. No significant interaction effects between state appearance-related upward comparisons and self-compassion were found. The results suggested that appearance-based self-compassion was important, not just when there was a potential threat to body image via upward appearance comparisons. The findings highlight the importance of fostering self-compassion on a daily level. © 2017 The International Association of Applied Psychology.
興津, 裕美
2014-01-01
博士(医学) 乙第2814号, 著者名:Hiromi Okitsu・Jitsuki Sawamura・Katsuji Nishimura・Yasuto Sato・Jun Ishigooka,タイトル:A comparison of a patient-rated visual analogue scale with the Liebowitz Social Anxiety Scale for social anxiety disorder: A cross-sectional study,掲載誌:Open Journal of Psychiatry (2161-7325),巻・頁・年:4巻1号 p.68~74 (2014),著作権関連情報:Copyright © 2014 by authors and Scientific Research Publishing Inc.,DOI:10.4236/ojpsych.2014.41010...
Ulloa-Martínez, Marcela; Burguete-García, Ana I.; Murugesan, Selvasankar; Hoyo-Vadillo, Carlos; Cruz-Lopez, Miguel
2016-01-01
Introduction Obesity is a chronic, complex, and multifactorial disease, characterized by excess body fat. Diverse studies of the human genome have led to the identification of susceptibility genes that contribute to obesity. However, relatively few studies have addressed specifically the association between the level of expression of these genes and obesity. Material and methods We studied 160 healthy and obese unrelated Mexican children aged 6 to 14 years. We measured the transcriptional expression of 20 genes associated with obesity, in addition to the biochemical parameters, in peripheral white blood cells. The detection of mRNA levels was performed using the OpenArray Real-Time PCR System (Applied Biosystems). Results Obese children exhibited higher values of fasting glucose (p = 0.034), fasting insulin (p = 0.004), low-density lipoprotein (p = 0.006), triglycerides (p GHRL (p = 0.0060) and FTO (p = 0.0348) genes. Conclusions Our results suggest that changes in the expression level of the studied genes are involved in biological processes implicated in the development of childhood obesity. Our study contributes new perspectives for a better understanding of biological processes involved in obesity. The protocol was approved by the National Committee and Ethical Committee Board from the Mexican Social Security Institute (IMSS) (IMSS FIS/IMSS/PRIO/10/011). PMID:27695486
Donald, Juliet; Abbott, Maree J; Smith, Evelyn
2014-01-01
Prominent models of social phobia highlight the role played by attentional factors, such as self-focused attention, in the development and maintenance of social phobia. Elevated self-focused attention is associated with increases in self-rated anxiety. Treatments that aim to modify and change attentional processes, specifically self-focused attention, will have a direct effect on social phobia symptoms. Thus, Attention Training targets attentional focus. The present study aimed to investigate the efficacy of Attention Training in comparison to an established treatment for social phobia, Cognitive Therapy. Participants (Intention-to-treat = 45; completers = 30) were allocated to either 6 weeks of Attention Training or Cognitive Therapy. It was hypothesized that both treatments would be effective in reducing social phobia symptoms, but that Attention Training would work primarily by reducing levels of self-focused attention. The results found an overall effectiveness of both treatment conditions in reducing social phobia symptoms. However, Attention Training significantly improved scores on the Self-Focused Attention questionnaire and the Brief Fear of Negative Evaluation questionnaire compared to Cognitive Therapy. Attention Training seems to be a promising treatment for social phobia.
Social comparisons in adults with type 2 diabetes: Patients' reasons for target selection.
Arigo, Danielle; Cornell, Max; Smyth, Joshua M
2018-07-01
To examine reasons for selecting a social comparison target (i.e. a specific other for relative self-evaluation), and their influence on affect and motivation for self-care, in type 2 diabetes (T2DM). Adults with T2DM (n = 180, M A1c = 7.6%) chose to read about one of four targets. Participants rated five reasons for their choice (strongly disagree - strongly agree), and rated affect and self-care motivation before and after reading. To boost confidence in my ability to manage diabetes was rated highest overall (ps motivation (p motivation only among those who chose better-off targets (p = 0.01). Patients' reasons for a particular comparison are associated with short-term changes in affect and self-care motivation, and warrant greater empirical and clinical attention.
Arsznov, Bradley M; Sakai, Sharleen T
2013-01-01
The present study investigated whether increased relative brain size, including regional brain volumes, is related to differing behavioral specializations exhibited by three member species of the family Procyonidae. Procyonid species exhibit continuums of behaviors related to social and physical environmental complexities: the mostly solitary, semiarboreal and highly dexterous raccoons (Procyon lotor); the exclusively arboreal kinkajous (Potos flavus), which live either alone or in small polyandrous family groups, and the social, terrestrial coatimundi (Nasua nasua, N. narica). Computed tomographic (CT) scans of 45 adult skulls including 17 coatimundis (9 male, 8 female), 14 raccoons (7 male, 7 female), and 14 kinkajous (7 male, 7 female) were used to create three-dimensional virtual endocasts. Endocranial volume was positively correlated with two separate measures of body size: skull basal length (r = 0.78, p Comparisons of relative regional brain volumes revealed that the anterior cerebrum volume consisting mainly of frontal cortex and surface area was significantly larger in the social coatimundi compared to kinkajous and raccoons. The dexterous raccoon had the largest relative posterior cerebrum volume, which includes the somatosensory cortex, in comparison to the other procyonid species studied. The exclusively arboreal kinkajou had the largest relative cerebellum and brain stem volume in comparison to the semi arboreal raccoon and the terrestrial coatimundi. Finally, intraspecific comparisons failed to reveal any sex differences, except in the social coatimundi. Female coatimundis possessed a larger relative frontal cortical volume than males. Social life histories differ in male and female coatimundis but not in either kinkajous or raccoons. This difference may reflect the differing social life histories experienced by females who reside in their natal bands, and forage and engage in antipredator behavior as a group, while males disperse upon reaching
[Use of health services by a population of 60-year olds and older in Mexico].
Borges-Yáñez, S A; Gómez-Dantés, H
1998-01-01
To describe the sociodemographic characteristics and determinants of health services utilization by the Mexican population of 60 years of age or more. Information obtained from the National Health Survey II (ENSA-II) allowed analysis of 4,628 elderly people. Prevalence of chronic diseases was analyzed and the determinants of individuals who had used the health services in the two weeks prior to the interview. The chronic diseases most frequently reported were: hypertension, diabetes and heart disease. The utilization and hospitalization rates of that age group were 11.4 and 5.5%, respectively. The services most frequently used were: the private physician, social security (IMSS, ISSSTE) welfare services (Ministry of Health--SSA- and IMSS-Solidaridad). Interestingly, 25 to 45% of social security insurance holders did not use the services, instead they consulted a private physician. The most important explanatory variables for health services utilization were: the perceived illness, not having worked for the previous week and being a social security insurance holder. Gender, area of residence and level of education were not significant in the explanation of health services utilization. This study demonstrates the need to strengthen preventive and support programs for the elderly population, since they only demand health services when they feel sick.
Directory of Open Access Journals (Sweden)
A shirazitehrani
2016-01-01
Full Text Available Abstract Background & aim: Multidimensional and complex nature of social phobia disorder requires assessment, efficacy and comparison of treatment. The present study aimed to investigate the effectiveness of interpersonal and metacognitive group therapy. in reducing symptoms of social phobia Method: This study is an experimental research and the design of study is pre-test- post-test in which 45 patients suffering from social phobia disorder were selected and randomly assigned to three groups of interpersonal , metacognitive and control . Therapy sessions in groups of 15 people in 8 meeting held .The tools used in this study included the Social Phobia Inventory(SPIN Social Interaction Anxiety Scale(SIAS and the Brief Fear Negative Evaluation Scale Revised Version(BFNE-II and the Structured Clinical Interview for DSM-IV(SCIDis that in the pre-test and post-test were completed by patients.Data was statically analyzed Multivariate Covariance analysis (MANCOVA and Bonferroni post hoc test to compare difference scale scores pre test-post test variables were used in the experimental and control groups. Results:The results showed that there is significant differences between experimental (interpersonal and metacognitive Therapy and control group( waiting list (P<0/001.Also results showed that both interpersonal and metacognitive group therapies were equally effective on the symptom of social phobia disorder, social interaction anxiety and fear of negative evaluation(P<0/001 and its effect size by order of was 0/49, 0/75,0/95. Conclusion: Given the effectiveness of both treatment on social phobia symptoms can be relevant option for clients who go to counseling centers for an effective treatment .
Kugler, Matther B.; Goethals, George R.
2006-01-01
Two studies explored the experience and performance of students at Williams College in three-person groups that were homogeneous or heterogeneous in rated academic ability. In accord with hypotheses from Festinger's (1954) social comparison theory, students in academically homogeneous groups had more positive experiences and performed better on…
Socialization of Social Anxiety in Adolescent Crowds
Van Zalk, Nejra; Van Zalk, Maarten Herman Walter; Kerr, Margaret
2011-01-01
In this study, we looked at whether social anxiety is socialized, or influenced by peers' social anxiety, more in some peer crowds than others. Adolescents in crowds with eye-catching appearances such as Goths and Punks (here termed "Radical"), were compared with three comparison groups. Using data from 796 adolescents (353 girls and 443 boys; M…
Directory of Open Access Journals (Sweden)
Alessandra Pokrajac-Bulian
2008-12-01
Full Text Available This study examined the role of internalization and comparison as mediators of relationships between socio-cultural pressures to be thin, psychological factors, restrictive and bulimic behaviours in college females. Participants were 262 Croatian college females (mean age = 21.22 ± 1.47 years who completed self-report questionnaires. Regression analysis was used to test a model in which internalization and social comparison mediated the impact of socio-cultural pressure (parents and peers dieting, teasing, pressure to be thin, media influences, self-esteem, anxiety, depression, and perfectionism in restrictive and bulimic behaviours. Internalization is a significant mediator of the relationships between all predictors included in this research and disturbed eating habits. Social comparison is relevant as a mediator between social influence, negative affect, self-esteem, perfectionism and restrictive behaviour but does not mediate bulimic behaviour. These findings could be seful in understanding processes that may predispose young women to develop eating dysfunctions and indicate the need for prevention programs that incorporate formative influences and processes such as internalization of societal norms and comparison in the construction of therapeutic strategies.
Baumeister, Antonia E.; Engelmann, Tanja; Hesse, Friedrich W.
2017-01-01
This experimental study extends conflict elaboration theory (1) by revealing social influence dynamics for a knowledge-rich computer-supported socio-cognitive conflict task not investigated in the context of this theory before and (2) by showing the impact of individual differences in social comparison orientation. Students in two conditions…
Thau, Stefan; Aquino, Karl; Wittek, Rafael
2007-01-01
A multisource field study of 103 employees and their supervisors tested an extension of uncertainty management theory (E. A. Lind & K. Van den Bos, 2002; K. Van den Bos & E. A. Lind, 2002). According to this theory, persons high in social comparison orientation (F. X. Gibbons & B. P. Buunk, 1999) experience chronic uncertainty about the self. It was hypothesized that this should strengthen the effects of interactional and procedural justice perceptions on antisocial work behaviors. As predicted, the negative relationship between employee perceptions of interactional justice and supervisory ratings of antisocial work behaviors was stronger for people who are high as compared with low in social comparison orientation. Results provide evidence for an extension of uncertainty management theory to the self-domain. 2007 APA, all rights reserved
Wilson, Hope E.; Siegle, Del; McCoach, D. Betsy; Little, Catherine A.; Reis, Sally M.
2014-01-01
Academic self-concept predicts students' future goals and is affected by a student's relative success compared with his or her peer group. This exploratory study used structural equation modeling to examine the contributions of the perceived level of difficulty of the curriculum, in addition to the contributions of social comparison and…
SOCIAL RESPONSIBILITY VALUES: A CROSS COUNTRY COMPARISON
Directory of Open Access Journals (Sweden)
CATANA DOINA
2011-07-01
Full Text Available This empirical study aims at finding out how similar and/or different are the future Romanian and Slovenian managers in assessing the importance of organizations social responsibility values. The assumption of the research is that most of most of students in engineering and business will hold middle management position in the near future. The sample consists of 727 undergraduate and graduate students levels from Romania and Slovenia, two former socialist countries. The data has been collected between 2008 and 2009 in the framework of GLOBE student project , using a section of GLOBE III questionnaire, about the importance of CSR related values in critical decisions. The findings concern the similarities and significant differences between: 1 whole Romanian and Slovenian samples; 2 Romanian and Slovenian students in engineering; 3 Romanian and Slovenian students in business. Our findings revealed a trend toward convergence in the importance given to decisions effect on contribution to the economic welfare of the nation and local community, as well as on employees professional growth and development and on environment. The biggest difference between the groups concerns the decisions effect on firm profitability (the Romanians considering this value as more important in critical decisions than the Slovenians. The students in engineering proved to be a more homogeneous group, showing convergence in assessing the importance of eight out of fifteen social responsibility values. The biggest difference concerns the decisions effect on firm profitability (Romanians consider it as having higher importance in critical decisions than the Slovenians. Comparison of students in business revealed convergence in assessing the importance of employees professional growth and development and decisions effect on environment. The biggest positive difference concerns the same value of decisions effect on firm profitability. The Romanians are well behind Slovenians in
Raat, Adriana
2015-01-01
Undergraduate students in clinical workplace frequently compare their own experiences with those of peers. The research reported in this thesis shows that these so called social comparisons are vital to the process of learning in clinical practice. The first study confirms students’ tendency to
Comparison of the Efficiency of Budget Financing and the Social Security of a Region
Directory of Open Access Journals (Sweden)
Aleksandr Anatolyevich Kuklin
2016-09-01
Perm Krai and Sverdlovsk region on the social and economic development of the Volga and Ural Federal Districts respectively, the given comparison is of scientific and practical interest.
Directory of Open Access Journals (Sweden)
Katia Gallegos-Carrillo
2008-06-01
Full Text Available OBJECTIVE: To establish how health care service utilization patterns are associated with health-related quality of life (HRQL perception in older adults. MATERIAL AND METHODS: A cross-sectional study in adults aged 60 years or more was conducted in a random sample of 1150 beneficiaries of the Mexican Social Security Institute (IMSS in Mexico City during 2003. Health care services utilization was categorized as preventive or curative, which generated six usage profiles. HRQL was measured by means of the SF-36 questionnaire. Analyses of variance and multiple linear regressions were conducted to evaluate the relationship between health care services utilization and HRQL. RESULTS: The use of preventive and curative services has a positive association with HRQL levels. Usage profiles with a prevalence of preventive services have a stronger positive association with HRQL scales. CONCLUSIONS: This study suggests a positive association between use patterns for primarily preventive health care services and a better HRQL perception among older adults.OBJETIVO: Determinar cómo distintos patrones de utilización de servicios están asociados con calidad de vida relacionada a la salud (CVRS de adultos mayores. MATERIAL Y MÉTODOS: Estudio transversal en adultos de 60 años y mayores con muestra aleatoria de 1150 derechohabientes del Instituto Mexicano del Seguro Social (IMSS en la Ciudad de México en 2003. El uso de los servicios se clasificó en preventivos y curativos, lo que generó seis perfiles de utilización de servicios. La CVRS se midió con el SF-36. Para evaluar la asociación del uso de servicios con CVRS se realizaron análisis de varianza y regresión lineal múltiple. RESULTADOS: La utilización de servicios preventivos y curativos muestra una asociación positiva con CVRS. Los perfiles en que predominan servicios preventivos tienen una asociación positiva más fuerte con escalas de CVRS. CONCLUSIONES: Este estudio sugiere una asociaci
Directory of Open Access Journals (Sweden)
Roberto Castro
2002-01-01
Full Text Available Se presentan los resultados de una encuesta entre 446 mujeres usuarias de los servicios de salud del Instituto Mexicano del Seguro Social (IMSS en Morelos, que se encontraban en su tercer trimestre de embarazo. El objetivo era indagar si la violencia contra mujeres se incrementa durante el embarazo o si, por el contrario, disminuye. Se encontró que la prevalencia no varió en ambos periodos (aproximadamente 15 por ciento, en general. En cambio, la severidad de la violencia emocional se incrementó durante el embarazo, mientras que la de la violencia física y sexual se mantuvo constante. Un análisis de regresión logística mostró que las variables que mejor predicen la violencia durante el embarazo son el número de hijos, el consumo de alcohol por parte de la pareja, la historia de violencia en la infancia de la pareja y la existencia de violencia durante el año previo al embarazo.
Rodríguez Bolaños, Rosibel de Los Ángeles; Reynales Shigematsu, Luz Myriam; Jiménez Ruíz, Jorge Alberto; Juárez Márquezy, Sergio Arturo; Hernández Ávila, Mauricio
2010-12-01
Estimate the direct cost of medical care incurred by the Mexican Social Security Institute (IMSS, Instituto Mexicano del Seguro Social) for patients with type 2 diabetes mellitus (DM2). The clinical files of 497 patients who were treated in secondary and tertiary medical care units in 2002-2004 were reviewed. Costs were quantified using a disease costing approach (DCA) from the provider's perspective, a micro-costing technique, and a bottom-up methodology. Average annual costs by diagnosis, complication, and total cost were estimated. Total IMSS DM2 annual costs were US$452 064 988, or 3.1% of operating expenses. The annual average cost per patient was US$3 193.75, with US$2 740.34 per patient without complications and US$3 550.17 per patient with complications. Hospitalization and intensive care bed-days generated the greatest expenses. The high cost of providing medical care to patients with DM2 and its complications represents an economic burden that health institutions should consider in their budgets to enable them to offer quality service that is both adequate and timely. Using the micro-costing methodology allows an approximation to real data on utilization and management of the disease.
Balconi, Michela; Pagani, Silvia
2014-06-22
The perception and interpretation of social hierarchies are a key part of our social life. In the present research we considered the activation of cortical areas, mainly the prefrontal cortex, related to social ranking perception in conjunction with some personality components (BAS - Behavioral Activation System - and BIS - Behavioral Inhibition System). In two experiments we manipulated the perceived superior/inferior status during a competitive cognitive task. Indeed, we created an explicit and strongly reinforced social hierarchy based on incidental rating in an attentional task. Specifically, a peer group comparison was undertaken and improved (Experiment 1) or decreased (Experiment 2) performance was artificially manipulated by the experimenter. For each experiment two groups were compared, based on a BAS and BIS dichotomy. Alpha band modulation in prefrontal cortex, behavioral measures (performance: error rate, ER; response times, RTs), and self-perceived ranking were considered. Repeated measures ANOVAs and regression analyses showed in Experiment 1 a significant improved cognitive performance (decreased ER and RTs) and higher self-perceived ranking in high-BAS participants. Moreover, their prefrontal activity was increased within the left side (alpha band decreasing). Conversely, in Experiment 2 a significant decreased cognitive performance (increased ER and RTs) and lower self-perceived ranking was observed in higher-BIS participants. Their prefrontal right activity was increased in comparison with higher BAS. The regression analyses confirmed the significant predictive role of alpha band modulation with respect of subjects' performance and self-perception of social ranking, differently for BAS/BIS components. The present results suggest that social status perception is directly modulated by cortical activity and personality correlates. Copyright © 2014 Elsevier Inc. All rights reserved.
Rosario Valdez-Santiago; Clara Juárez-Ramírez; V Nelly Salgado-de Snyder; Carolina Agoff; Leticia Avila-Burgos; Martha C Híjar
2006-01-01
OBJETIVO: Identificar los factores asociados al malestar emocional en una muestra nacional de usuarias de servicios de salud del sector público: Secretaría de Salud (SSA), Instituto Mexicano del Seguro Social (IMSS), Instituto de Seguridad y Servicios Sociales de los Trabajadores del Estado (ISSSTE). MATERIAL Y MÉTODOS: Se utilizó la base de datos de la Encuesta Nacional de Violencia contra las Mujeres en México, donde se aplicaron 26 042 encuestas a usuarias de los servicios de salud de la S...
Ozimek, Phillip; Baer, Fiona; Förster, Jens
2017-01-01
In this study, we examine chronic materialism as a possible motive for Facebook usage. We test an explanatory mediation model predicting that materialists use Facebook more frequently, because they compare themselves to others, they objectify and instrumentalize others, and they accumulate friends. For this, we conducted two online surveys (N1 = 242, N2 = 289) assessing demographic variables, Facebook use, social comparison, materialism, objectification and instrumentalization. Results confir...
Lev-Ari, Lilac; Baumgarten-Katz, Inbar; Zohar, Ada H
2014-11-01
Women with attachment insecurity have greater eating disorder symptoms and poorer prognosis. Socio-cultural agents, such as peers and family, are predictive of the development of body image dissatisfaction (BID). The present study examines the association of insecure attachment styles and direct and indirect social comparisons of body image to women's BID and drive to thinness. Two hundred and eighty three women aged 18-42 years completed online self-reports concerning attachment styles, body mass index (BMI), drive for thinness, body image satisfaction, the Figure Rating Scale (FRS), as well as a modified FRS comparing self to mother, to sister closest in age and to best friend. Hierarchical Linear Models reveal that anxious-ambivalent, but not avoidant attachment style, along with indirect and direct comparisons to best friend and to sister influence drive for thinness and body dissatisfaction, even after controlling for BMI and age. Of all social comparisons, feeling one's best friend is thinner than yourself is the most detrimental to body ideal. Copyright © 2014 John Wiley & Sons, Ltd and Eating Disorders Association.
Want, Stephen C; Saiphoo, Alyssa
2017-03-01
The present study investigated whether social comparisons with media images are cognitively efficient (demanding minimal mental effort) or cognitively effortful processes, in a sample of female undergraduate students (N=151) who reported feeling pressure from the media regarding their appearance. Two groups were shown 12 images of thin and attractive female models. One group was asked to memorize a complex 8-digit number during exposure to the images (Cognitively Busy condition), while the other memorized a much simpler number (Free View condition). A third group (Control condition) viewed images without people. Participants in the Free View condition demonstrated significantly increased negative mood and lowered appearance satisfaction from before to after exposure, while participants in the Cognitively Busy and Control conditions did not. We argue that these results suggest social comparisons with media images are at least somewhat cognitively effortful even among women who say they feel pressure from the media. Copyright © 2016 Elsevier Ltd. All rights reserved.
O'Toole, Mia Skytte; Watson, Lynn A; Rosenberg, Nicole K; Berntsen, Dorthe
2016-03-01
Empirical interest in mental imagery in social anxiety disorder (SAD) has grown over the past years but still little is known about the specificity to SAD. The present study therefore examines negative autobiographical memories in participants with social anxiety disorder (SAD), compared to patients with panic disorder (PD), and healthy controls (HCs). A total of 107 participants retrieved four memories cued by verbal phrases associated with either social anxiety (SA) or panic anxiety (PA), with two memories for each cue category. PA-cued memories were experienced with stronger imagery and as more traumatic. They were also rated as more central to identity than SA-cued memories, but not among participants with SAD, who perceived SA-cued memories as equally central to their identity. When between-group effects were detected, participants with anxiety disorders differed from HCs, but not from each other. Central limitations include reliance on self-report measures, comorbidity in the anxiety disorder groups, and lack of a neutrally cued memory comparison. The findings align with models of SAD suggesting that past negative social events play a central role in this disorder. Future research is suggested to further explore the function of negative memories, not only in SAD, but also in other anxiety disorders. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Rouven Doran
2017-01-01
Full Text Available Two online experiments explored the effects of social comparison feedback on indicators of eco-friendly travel choices. It was tested whether the chosen indicators are sensitive to the information conveyed, and if this varies as a function of in-group identification. Study 1 (N = 134 focused on unfavourable feedback (i.e., being told that one has a larger ecological footprint than the average member of a reference group. People who received unfavourable feedback reported stronger intentions to choose eco-friendly travel options than those who received nondiscrepant feedback, when in-group identification was high (not moderate or low. Perceived self- and collective efficacy were not associated with the feedback. Study 2 (N = 323 extended the focus on favourable feedback (i.e., being told that one has a smaller ecological footprint than the average member of a reference group. Neither unfavourable nor favourable feedback was associated with behavioural intentions, self- or collective efficacy. This means that Study 2 failed to replicate the finding of Study 1 that behavioural intentions were associated with unfavourable feedback, given that in-group identification is high. The findings are discussed in light of the existing literature. Suggestions are made for future studies investigating social comparison feedback as a means to motivate people to make eco-friendly travel choices.
Directory of Open Access Journals (Sweden)
Joel Navarrete-Espinosa
2000-09-01
Full Text Available OBJETIVO: Establecer la relación entre el nivel de plomo sanguíneo materno (PSM y el de sangre en cordón umbilical (PSC al momento del parto, así como determinar los principales predictores del PSM en derechohabientes del Instituto Mexicano del Seguro Social (IMSS, en el Distrito Federal (D.F.. MATERIAL Y MÉTODOS: Se realizó un estudio transversal en el que se reclutaron voluntarias con embarazo normoevolutivo y se les tomaron muestras de sangre al momento del parto, en cuatro hospitales del IMSS en el D.F., de 1991 a 1993. Se tomó, además, muestra de sangre de cordón umbilical. Los datos fueron analizados mediante regresión lineal simple y múltiple. RESULTADOS: Se estudiaron un total de 1 404 binomios madre-hijo; el promedio de edad de las madres fue de 25 años. La media de PSM fue 10.7 ± 6.5 µg/dl; no se encontraron variaciones significativas por hospital, edad o estado civil. Para el PSC la media fue de 10.4 ± 6.2 µg/dl. Por cada aumento en una unidad logarítmica de PSM, el PSC aumenta 0.62 (pOBJECTIVE: To establish the relation between maternal blood lead (MBL and umbilical cord blood lead (CBL levels during delivery, and to determine the major predictors for MBL in women covered by the Mexican Institute of Social Security (MISS, in Mexico City. MATERIAL AND METHODS: From 1991 to 1993, a cross-sectional study was conducted in four MISS hospitals, among normal pregnant women who volunteered to participate. Blood samples were taken from women and from the umbilical cord during delivery. Statistical analysis consisted of descriptive statistics and simple and multiple linear regression. RESULTS: A total of 1 404 mother-newborn pairs were studied. Mean maternal age was 25 years. MBL average was 10.7 ± 6.5 µg/dl; no significant differences were found by hospital, age, or marital status. Mean CBL was 10.4 ± 6.2 µg/dl. A log unit increase in MBL corresponded to a log increase of 0.62 in CBL (p< 0.01. Pearson's correlation was 0
Ozimek, Phillip; Baer, Fiona; Förster, Jens
2017-11-01
In this study, we examine chronic materialism as a possible motive for Facebook usage. We test an explanatory mediation model predicting that materialists use Facebook more frequently, because they compare themselves to others, they objectify and instrumentalize others, and they accumulate friends. For this, we conducted two online surveys ( N 1 = 242, N 2 = 289) assessing demographic variables, Facebook use, social comparison, materialism, objectification and instrumentalization. Results confirm the predicted mediation model. Our findings suggest that Facebook can be used as a means to an end in a way of self-regulatory processes, like satisfying of materialistic goals. The findings are the first evidence for our Social Online Self-regulation Theory (SOS-T), which contains numerous predictions that can be tested in the future.
Directory of Open Access Journals (Sweden)
SALMERÓN-CASTRO JORGE
1997-01-01
Full Text Available Objetivo. Describir el comportamiento de la mortalidad global por cáncer, así como la mortalidad específica para las principales neoplasias malignas en población adulta derechohabiente (DH del Instituto Mexicano del Seguro Social (IMSS. Material y métodos. A partir de los registros oficiales de defunción y de la información sobre la población para los años 1991-1995, se estimaron las tasas anuales de mortalidad global y específica para las 10 principales neoplasias malignas por sexo, en mayores de 20 años. Asimismo, se estimaron las tendencias nacionales y estatales para las principales neoplasias malignas para cada sexo por medio de regresión de Poisson. Se calcularon las diferencias de tasas de mortalidad específica para las dos principales neoplasias por sexo restando las tasas estatales a su respectiva tasa nacional en 1995. Resultados. La mortalidad global por cáncer en los hombres se incrementó de 76.2 en 1991, a 94.8 por 100 000 DH en 1995; entre las mujeres, ésta se incrementó de 85.6 a 105.8 por 100 000 DH, representando un incremento de 24.4 y de 24% en hombres y mujeres, respectivamente, durante el periodo de estudio. Entre los hombres las neoplasias de riñón, leucemia, páncreas, próstata y pulmón; y entre mujeres las de colon, mama, páncreas, leucemias e hígado, mostraron los incrementos más significativos. Conclusiones. En el IMSS es impostergable la conformación de un registro poblacional de cáncer que permita una mejor vigilancia epidemiológica de las neoplasias y una evaluación permanente del impacto de programas específicos para la prevención y control de este padecimiento en las instituciones.
Groothof, Hinke A.K.; Scholtes, Ria
2008-01-01
Peer support plays an important role in coping with many chronic health problems. Peer support may, however, contain a risk. Research has indicated that people with high social comparison orientation (SCO) are, on the one hand, more interested in contact with peers, but may, on the other hand, be
Directory of Open Access Journals (Sweden)
Contreras-Lemus Javier
2001-01-01
Full Text Available Objetivo. Analizar la forma en que se registran los nacimientos y la muerte en el periodo perinatal, en el Instituto Mexicano del Seguro Social (IMSS, y documentar si el registro de la muerte, en este periodo, es adecuado. Material y métodos. Entre enero y marzo de 2000, se aplicó una encuesta en las 37 delegaciones del IMSS, para conocer, del año 1999, el total de nacimientos vivos y muertos, las defunciones ocurridas antes del séptimo día, considerando su edad gestacional y peso al nacimiento. Con estos datos se analizó la mortalidad hebdomadal e infantil y se calcularon las tasas correspondientes, incluyendo o desagregando a los niños con o = 28 semanas de gestación. Antes de la primera semana de vida extrauterina fallecieron 4 556 niños, de los cuales 1 385 (30.4% pesaron http://www.insp.mx/salud/index.html
Bride, Brian E.; Kintzle, Sara; Abraham, Amanda J.; Roman, Paul M.
2012-01-01
The purpose of this study was to examine factors that may be associated with variation in social workers' perceptions of effectiveness, perceptions of acceptability, and use of psychosocial evidence-based practices (EBPs) for the treatment of substance use disorders (SUD) in comparison to other SUD counselors who are non–social workers. A national sample of 1,140 counselors in private SUD treatment settings completed a mailed survey. Overall, counselors perceive both motivational interviewing (MI) and contingency management (CM) to be effective and acceptable interventions, with MI perceived to be both more effective and more acceptable than CM. The results of this study also shed light on the factors associated with perceptions of effectiveness and acceptability of MI and CM. The results of this study underscore the importance of exposure to EBPs in the development of positive attitudes toward and use of EBPs. In particular, professional networks are an important route to introduce social workers to EBPs, as is professional training on specific EBPs. Efforts to increase the uptake of evidence-based SUD interventions should not be limited to dissemination of information regarding effectiveness; rather, efforts should also be expended to expose social workers to EBPs. PMID:23193729
DEFF Research Database (Denmark)
Hampton, Keith; Ling, Richard
2013-01-01
The size and diversity of Americans’ core social networks has declined. Some suggest that the replacement of face-to-face contact with new media, and combined with more insular core networks is detrimental to both individual and societal well-being. Based on a cross-national comparison of the Uni......The size and diversity of Americans’ core social networks has declined. Some suggest that the replacement of face-to-face contact with new media, and combined with more insular core networks is detrimental to both individual and societal well-being. Based on a cross-national comparison...
Directory of Open Access Journals (Sweden)
Phillip Ozimek
2017-11-01
Full Text Available In this study, we examine chronic materialism as a possible motive for Facebook usage. We test an explanatory mediation model predicting that materialists use Facebook more frequently, because they compare themselves to others, they objectify and instrumentalize others, and they accumulate friends. For this, we conducted two online surveys (N1 = 242, N2 = 289 assessing demographic variables, Facebook use, social comparison, materialism, objectification and instrumentalization. Results confirm the predicted mediation model. Our findings suggest that Facebook can be used as a means to an end in a way of self-regulatory processes, like satisfying of materialistic goals. The findings are the first evidence for our Social Online Self-regulation Theory (SOS-T, which contains numerous predictions that can be tested in the future. Keywords: Psychology, Information science
Want, Stephen C
2009-09-01
Experimental exposure to idealized media portrayals of women is thought to induce social comparisons in female viewers and thereby to be generally detrimental to female viewers' satisfaction with their own appearance. Through meta-analysis, the present paper examines the impact of moderators of this effect, some identified and updated from a prior meta-analysis and some that have hitherto received little attention. Participants' pre-existing appearance concerns and the processing instructions participants were given when exposed to media portrayals were found to significantly moderate effect sizes. With regard to processing instructions, a novel and counter-intuitive pattern was revealed; effect sizes were smallest when participants were instructed to focus on the appearance of women in media portrayals, and largest when participants processed the portrayals on a distracting, non-appearance dimension. These results are interpreted through a framework that suggests that social comparisons are automatic processes, the effects of which can be modified through conscious processing.
Psychopathological Processes Involved in Social Comparison, Depression, and Envy on Facebook.
Pera, Aurel
2018-01-01
Is Facebook utilization beneficial or detrimental for psychological well-being? I draw on outstanding research (e.g., Chou and Edge, 2012; Lin and Utz, 2015; Appel et al., 2016; Ehrenreich and Underwood, 2016; Vogel and Rose, 2016; Hu et al., 2017) to substantiate that examining other individuals' positively presented material on Facebook may have detrimental consequences. Increasing comparisons on Facebook may generate feelings of envy, the latter being a significant process determining the effect of growing social comparison on psychological well-being. To date, there is an increasing body of literature investigating the psychological consequences of Facebook usage, the function of relationship closeness in producing the feelings of contentment and envy, the impacts of exposure to positive content on Facebook, the link between envy and depression on Facebook, and the function of tie strength in expecting the emotional results of browsing Facebook. I am specifically interested in how previous research explored the consequences of Facebook use on psychological outcomes, the moderating function of envy in the link between Facebook use and reduced affective wellbeing, the psychological results of non-interactive Facebook conduct, and the role of relationship closeness in anticipating user's contentment and envy after inspecting a post. A synthesis of the extant literature suggests that inspecting other individuals' positive news on Facebook brings about contentment through emotional contagion, whereas negative news causes discomfort as a consequence of mood contagion, the transmissible effect being more powerful when the news is associated with a strong tie. The outcomes of this research back the argument that self-confidence and dispositional envy are instrumental in producing Facebook envy. These findings highlight that the emotional results of browsing Facebook are considerably affected by the substance of the comment, the personal attributes of the Facebook user
Psychopathological Processes Involved in Social Comparison, Depression, and Envy on Facebook
Directory of Open Access Journals (Sweden)
Aurel Pera
2018-01-01
Full Text Available Is Facebook utilization beneficial or detrimental for psychological well-being? I draw on outstanding research (e.g., Chou and Edge, 2012; Lin and Utz, 2015; Appel et al., 2016; Ehrenreich and Underwood, 2016; Vogel and Rose, 2016; Hu et al., 2017 to substantiate that examining other individuals’ positively presented material on Facebook may have detrimental consequences. Increasing comparisons on Facebook may generate feelings of envy, the latter being a significant process determining the effect of growing social comparison on psychological well-being. To date, there is an increasing body of literature investigating the psychological consequences of Facebook usage, the function of relationship closeness in producing the feelings of contentment and envy, the impacts of exposure to positive content on Facebook, the link between envy and depression on Facebook, and the function of tie strength in expecting the emotional results of browsing Facebook. I am specifically interested in how previous research explored the consequences of Facebook use on psychological outcomes, the moderating function of envy in the link between Facebook use and reduced affective wellbeing, the psychological results of non-interactive Facebook conduct, and the role of relationship closeness in anticipating user’s contentment and envy after inspecting a post. A synthesis of the extant literature suggests that inspecting other individuals’ positive news on Facebook brings about contentment through emotional contagion, whereas negative news causes discomfort as a consequence of mood contagion, the transmissible effect being more powerful when the news is associated with a strong tie. The outcomes of this research back the argument that self-confidence and dispositional envy are instrumental in producing Facebook envy. These findings highlight that the emotional results of browsing Facebook are considerably affected by the substance of the comment, the personal
Psychopathological Processes Involved in Social Comparison, Depression, and Envy on Facebook
Pera, Aurel
2018-01-01
Is Facebook utilization beneficial or detrimental for psychological well-being? I draw on outstanding research (e.g., Chou and Edge, 2012; Lin and Utz, 2015; Appel et al., 2016; Ehrenreich and Underwood, 2016; Vogel and Rose, 2016; Hu et al., 2017) to substantiate that examining other individuals’ positively presented material on Facebook may have detrimental consequences. Increasing comparisons on Facebook may generate feelings of envy, the latter being a significant process determining the effect of growing social comparison on psychological well-being. To date, there is an increasing body of literature investigating the psychological consequences of Facebook usage, the function of relationship closeness in producing the feelings of contentment and envy, the impacts of exposure to positive content on Facebook, the link between envy and depression on Facebook, and the function of tie strength in expecting the emotional results of browsing Facebook. I am specifically interested in how previous research explored the consequences of Facebook use on psychological outcomes, the moderating function of envy in the link between Facebook use and reduced affective wellbeing, the psychological results of non-interactive Facebook conduct, and the role of relationship closeness in anticipating user’s contentment and envy after inspecting a post. A synthesis of the extant literature suggests that inspecting other individuals’ positive news on Facebook brings about contentment through emotional contagion, whereas negative news causes discomfort as a consequence of mood contagion, the transmissible effect being more powerful when the news is associated with a strong tie. The outcomes of this research back the argument that self-confidence and dispositional envy are instrumental in producing Facebook envy. These findings highlight that the emotional results of browsing Facebook are considerably affected by the substance of the comment, the personal attributes of the Facebook
Guerra, Germán; Gutiérrez-Calderón, Emilio; Salgado de Snyder, Nelly; Borja-Aburto, Víctor Hugo; Martínez-Valle, Adolfo; González-Block, Miguel Ángel
2018-06-15
The Mexican health system segments access and right to healthcare according to worker position in the labour market. In this contribution we analyse how access and continuity of healthcare gets interrupted by employment turnover in the labour market, including its formal and informal sectors, as experienced by affiliates to the Mexican Institute of Social Security (IMSS) at national level, and of workers with type 2 diabetes (T2DM) in Mexico City. Using data from the National Employment and Occupation Survey, 2014, and from IMSS electronic medical records for workers in Mexico City, we estimated annual employment turnover rates to measure the loss of healthcare access due to labour market dynamics. We fitted a binary logistic regression model to analyse the association between sociodemographic variables and employment turnover. Lastly we analysed job-related access to health care in relation to employment turnover events. At national level, 38.3% of IMSS affiliates experienced employment turnover at least once, thus losing the right to access to healthcare. The turnover rate for T2DM patients was 22.5%. Employment turnover was more frequent at ages 20-39 (38.6% national level; 28% T2DM) and among the elderly (62.4% national level; 26% T2DM). At the national level, higher educational levels (upper-middle, OR = 0.761; upper, OR = 0.835) and income (5 minimum wages or more, OR = 0.726) were associated with lower turnover. Being single and younger were associated with higher turnover (OR = 1.413). T2DM patients aged 40-59 (OR = 0.655) and with 5 minimum wages or more (OR = 0.401) experienced less turnover. Being a T2DM male patient increased the risk of experiencing turnover (OR = 1.166). Up to 89% of workers losing IMSS affiliation and moving on to other jobs failed to gain job-related access to health services. Only 9% gained access to the federal workers social security institute (ISSSTE). Turnover across labour market sectors is
Bocage-Barthélémy, Yvana; Chatard, Armand; Jaafari, Nematollah; Tello, Nina; Billieux, Joël; Daveau, Emmanuel; Selimbegović, Leila
2018-01-01
Women are routinely exposed to images of extremely slim female bodies (the thin ideal) in advertisements, even if they do not necessarily pay much attention to these images. We hypothesized that paradoxically, it is precisely in such conditions of low attention that the impact of the social comparison with the thin ideal might be the most pronounced. To test this prediction, one hundred and seventy-three young female participants were exposed to images of the thin ideal or of women's fashion accessories. They were allocated to either a condition of high (memorizing 10 digits) or low cognitive load (memorizing 4 digits). The main dependent measure was implicit: mean recognition latency of negative words, relative to neutral words, as assessed by a lexical decision task. The results showed that thin-ideal exposure did not affect negative word accessibility under low cognitive load but that it increased it under high cognitive load. These findings are consistent with the hypothesis that social comparison with the thin ideal is an automatic process, and contribute to explain why some strategies to prevent negative effects of thin-ideal exposure are inefficient.
Cantisano, Gabriela Topa; Domínguez, J Francisco Morales; García, J Luis Caeiro
2007-05-01
This study focuses on the mediator role of social comparison in the relationship between perceived breach of psychological contract and burnout. A previous model showing the hypothesized effects of perceived breach on burnout, both direct and mediated, is proposed. The final model reached an optimal fit to the data and was confirmed through multigroup analysis using a sample of Spanish teachers (N = 401) belonging to preprimary, primary, and secondary schools. Multigroup analyses showed that the model fit all groups adequately.
Thau, Stefan; Aquino, Karl; Wittek, Rafael; Aquino, 27021
A multisource field study of 103 employees and their supervisors tested an extension of uncertainty management theory (E. A. Lind & K. Van den Bos, 2002; K. Van den Bos & E. A. Lind, 2002). According to this theory, persons high in social comparison orientation (F. X. Gibbons & B. P. Buunk, 1999)
Figueroa-Lara, Alejandro; Gonzalez-Block, Miguel Angel; Alarcon-Irigoyen, Jose
2016-01-01
Chronic diseases (CD) are a public health emergency in Mexico. Despite concern regarding the financial burden of CDs in the country, economic studies have focused only on diabetes, hypertension, and cancer. Furthermore, these estimated financial burdens were based on hypothetical epidemiology models or ideal healthcare scenarios. The present study estimates the annual expenditure per patient and the financial burden for the nine most prevalent CDs, excluding cancer, for each of the two largest public health providers in the country: the Ministry of Health (MoH) and the Mexican Institute of Social Security (IMSS). Using the Mexican National Health and Nutrition Survey 2012 (ENSANUT) as the main source of data, health services consumption related to CDs was obtained from patient reports. Unit costs for each provided health service (e.g. consultation, drugs, hospitalization) were obtained from official reports. Prevalence data was obtained from the published literature. Annual expenditure due to health services consumption was calculated by multiplying the quantity of services consumed by the unit cost of each health service. The most expensive CD in both health institutions was chronic kidney disease (CKD), with an annual unit cost for MoH per patient of US$ 8,966 while for IMSS the expenditure was US$ 9,091. Four CDs (CKD, arterial hypertension, type 2 diabetes, and chronic ischemic heart disease) accounted for 88% of the total CDs financial burden (US$ 1.42 billion) in MoH and 85% (US$ 3.96 billion) in IMSS. The financial burden of the nine CDs analyzed represents 8% and 25% of the total annual MoH and IMSS health expenditure, respectively. The financial burden from the nine most prevalent CDs, excluding cancer, is already high in Mexico. This finding by itself argues for the need to improve health promotion and disease detection, diagnosis, and treatment to ensure CD primary and secondary prevention. If the status quo remains, the financial burden could be higher.
Figueroa-Lara, Alejandro; Gonzalez-Block, Miguel Angel; Alarcon-Irigoyen, Jose
2016-01-01
Background Chronic diseases (CD) are a public health emergency in Mexico. Despite concern regarding the financial burden of CDs in the country, economic studies have focused only on diabetes, hypertension, and cancer. Furthermore, these estimated financial burdens were based on hypothetical epidemiology models or ideal healthcare scenarios. The present study estimates the annual expenditure per patient and the financial burden for the nine most prevalent CDs, excluding cancer, for each of the two largest public health providers in the country: the Ministry of Health (MoH) and the Mexican Institute of Social Security (IMSS). Methods Using the Mexican National Health and Nutrition Survey 2012 (ENSANUT) as the main source of data, health services consumption related to CDs was obtained from patient reports. Unit costs for each provided health service (e.g. consultation, drugs, hospitalization) were obtained from official reports. Prevalence data was obtained from the published literature. Annual expenditure due to health services consumption was calculated by multiplying the quantity of services consumed by the unit cost of each health service. Results The most expensive CD in both health institutions was chronic kidney disease (CKD), with an annual unit cost for MoH per patient of US$ 8,966 while for IMSS the expenditure was US$ 9,091. Four CDs (CKD, arterial hypertension, type 2 diabetes, and chronic ischemic heart disease) accounted for 88% of the total CDs financial burden (US$ 1.42 billion) in MoH and 85% (US$ 3.96 billion) in IMSS. The financial burden of the nine CDs analyzed represents 8% and 25% of the total annual MoH and IMSS health expenditure, respectively. Conclusions/Significance The financial burden from the nine most prevalent CDs, excluding cancer, is already high in Mexico. This finding by itself argues for the need to improve health promotion and disease detection, diagnosis, and treatment to ensure CD primary and secondary prevention. If the
Directory of Open Access Journals (Sweden)
Alejandro Figueroa-Lara
Full Text Available Chronic diseases (CD are a public health emergency in Mexico. Despite concern regarding the financial burden of CDs in the country, economic studies have focused only on diabetes, hypertension, and cancer. Furthermore, these estimated financial burdens were based on hypothetical epidemiology models or ideal healthcare scenarios. The present study estimates the annual expenditure per patient and the financial burden for the nine most prevalent CDs, excluding cancer, for each of the two largest public health providers in the country: the Ministry of Health (MoH and the Mexican Institute of Social Security (IMSS.Using the Mexican National Health and Nutrition Survey 2012 (ENSANUT as the main source of data, health services consumption related to CDs was obtained from patient reports. Unit costs for each provided health service (e.g. consultation, drugs, hospitalization were obtained from official reports. Prevalence data was obtained from the published literature. Annual expenditure due to health services consumption was calculated by multiplying the quantity of services consumed by the unit cost of each health service.The most expensive CD in both health institutions was chronic kidney disease (CKD, with an annual unit cost for MoH per patient of US$ 8,966 while for IMSS the expenditure was US$ 9,091. Four CDs (CKD, arterial hypertension, type 2 diabetes, and chronic ischemic heart disease accounted for 88% of the total CDs financial burden (US$ 1.42 billion in MoH and 85% (US$ 3.96 billion in IMSS. The financial burden of the nine CDs analyzed represents 8% and 25% of the total annual MoH and IMSS health expenditure, respectively.The financial burden from the nine most prevalent CDs, excluding cancer, is already high in Mexico. This finding by itself argues for the need to improve health promotion and disease detection, diagnosis, and treatment to ensure CD primary and secondary prevention. If the status quo remains, the financial burden could be
Cluster A personality pathology in social anxiety disorder: a comparison with panic disorder.
O'Toole, Mia Skytte; Arendt, Mikkel; Fentz, Hanne Nørr; Hougaard, Esben; Rosenberg, Nicole K
2014-10-01
Social anxiety disorder (SAD) has been associated with cluster A personality disorder (PD) traits, mainly paranoid and schizoid traits. The aim of the study was to further investigate cluster A personality pathology in patients with SAD. Self-reported PD traits were investigated in a clinical sample of 161 participants with SAD and in a clinical comparison group of 145 participants with panic disorder with or without agoraphobia (PAD). A diagnosis of SAD was associated with more paranoid and schizotypal PD traits, and an association between depression and personality pathology could indicate a state-effect of depression on PD traits. Patients with SAD had more cluster A personality pathology than patients with PAD, with the most solid indication for paranoid personality pathology.
Munoz, Valentina; Stravynski, Ariel
2010-03-01
This study sought to test the putative link between social phobia and sexual functioning. Three groups consisting of 106 social phobic, 164 sexually dysfunctional and 111 normal participants were assessed in terms of sexual functioning, social anxiety, social functioning and general psychopathology. Although social phobic men were less sexually active than normal men, they were as sexually satisfied. Social phobic women were alike their normal counterparts in all respects. Overall, social phobic individuals were not more prone to report sexual problems than normal individuals despite reporting the severest levels of social anxiety. Theoretically, our results are best understood as supporting an interpersonal conception of social phobia and a related socio-cultural perspective regarding sexual roles.
A generational comparison of social networking site use: the influence of age and social identity.
Barker, Valerie
2012-01-01
An online survey (N=256) compared social networking site (SNS) use among younger (millennial: 18-29) and older (baby-boomer: 41-64) subscribers focusing on the influence of collective self-esteem and group identity on motives for SNS use. Younger participants reported higher positive collective self-esteem, social networking site use for peer communication, and social compensation. Regardless of age, participants reporting high collective self-esteem and group identity were more likely to use social networking sites for peer communication and social identity gratifications, while those reporting negative collective self-esteem were more likely to use social networking sites for social compensation. The theoretical implications of the strong relationship between social identity gratifications and social compensation are discussed.
The influence of social comparison on cognitive bias modification and emotional vulnerability.
Standage, Helen; Harris, Jemma; Fox, Elaine
2014-02-01
The Cognitive Bias Modification (CBM) paradigm was devised to test predictions that cognitive biases have a causal influence on emotional status. Increasingly, however, researchers are testing the potential clinical applications of CBM. Although generally successful in reducing emotional vulnerability in clinical populations, the impact of CBM interventions has been somewhat variable. The aim of the current experiment was to investigate whether social comparison processing might be an important moderator of CBM. Healthy participants were presented with 80 valenced scenarios devised to induce a positive or negative interpretative bias. Critically, participants answered a series of questions designed to establish whether they assimilated or contrasted themselves with the valenced descriptions. The induction of an interpretation bias that was congruent with the valence of the training scenarios was successful only for participants who tended to assimilate the valenced scenarios, and not for those participants who tended to evaluate themselves against the scenarios. Furthermore, the predicted influence of CBM on emotional outcomes occurred only for those who had an assimilative rather than evaluative orientation toward CBM training material. Of key importance, results indicated that "evaluators" showed increased emotional vulnerability following positive CBM training. This result has both theoretical and clinical implications in suggesting that the success of CBM is dependent upon the way in which participants socially compare themselves with CBM training material. PsycINFO Database Record (c) 2014 APA, all rights reserved.
When Using Facebook to Avoid Isolation Reduces Perceived Social Support.
Lee, Eun-Ju; Cho, Eugene
2018-01-01
A survey (N = 316) examined how other-directed Facebook use driven by fear of social isolation affects users' perception of social support they possess. As predicted, those higher on fear of isolation were more likely to (a) closely monitor others' activities for self-evaluation (i.e., social comparison) and (b) regulate their self-presentation to garner social approval (i.e., other-directed self-presentation), but less likely to (c) express their true inner feelings and thoughts (i.e., inner-directed self-presentation) on Facebook. Social comparison, in turn, lowered perceived social support among heavy Facebook users, whereas inner-directed self-presentation heightened it. Other-directed self-presentation had no significant effect on perceived social support. Results indicate that the desire to avoid social isolation may paradoxically diminish perceived social support by promoting social comparison, while suppressing the expression of true self on Facebook.
Directory of Open Access Journals (Sweden)
Daniel Le Grange
2012-09-01
Full Text Available The purpose of this study was to investigate the association between body-related social comparison (BRSC and eating disorders (EDs by: (a comparing the degree of BRSC in adolescents with an ED, depressive disorder (DD, and no psychiatric history; and (b investigating whether BRSC is associated with ED symptoms after controlling for symptoms of depression and self-esteem. Participants were 75 girls, aged 12–18 (25 per diagnostic group. To assess BRSC, participants reported on a 5-point Likert scale how often they compare their body to others’. Participants also completed a diagnostic interview, Eating Disorders Inventory-2 (EDI-2, Beck Depression Inventory-II (BDI-II, and Rosenberg Self-Esteem Scale (RSE. Compared to adolescents with a DD and healthy adolescents, adolescents with an ED engaged in significantly more BRSC (p ≤ 0.001. Collapsing across groups, BRSC was significantly positively correlated with ED symptoms (p ≤ 0.01, and these associations remained even after controlling for two robust predictors of both ED symptoms and social comparison, namely BDI-II and RSE. In conclusion, BRSC seems to be strongly related to EDs. Treatment for adolescents with an ED may focus on reducing BRSC.
Hamel, Andrea E; Zaitsoff, Shannon L; Taylor, Andrew; Menna, Rosanne; Le Grange, Daniel
2012-09-01
The purpose of this study was to investigate the association between body-related social comparison (BRSC) and eating disorders (EDs) by: (a) comparing the degree of BRSC in adolescents with an ED, depressive disorder (DD), and no psychiatric history; and (b) investigating whether BRSC is associated with ED symptoms after controlling for symptoms of depression and self-esteem. Participants were 75 girls, aged 12-18 (25 per diagnostic group). To assess BRSC, participants reported on a 5-point Likert scale how often they compare their body to others'. Participants also completed a diagnostic interview, Eating Disorders Inventory-2 (EDI-2), Beck Depression Inventory-II (BDI-II), and Rosenberg Self-Esteem Scale (RSE). Compared to adolescents with a DD and healthy adolescents, adolescents with an ED engaged in significantly more BRSC (p ≤ 0.001). Collapsing across groups, BRSC was significantly positively correlated with ED symptoms (p ≤ 0.01), and these associations remained even after controlling for two robust predictors of both ED symptoms and social comparison, namely BDI-II and RSE. In conclusion, BRSC seems to be strongly related to EDs. Treatment for adolescents with an ED may focus on reducing BRSC.
Directory of Open Access Journals (Sweden)
Rosibel de los Ángeles Rodríguez Bolaños
2010-12-01
Full Text Available OBJETIVO: Estimar los costos directos de la atención médica a pacientes con diabetes mellitus tipo 2 (DM2 en el Instituto Mexicano del Seguro Social (IMSS. MÉTODOS: Se revisaron expedientes clínicos de 497 pacientes que ingresaron a unidades de segundo y tercer nivel de atención durante el período 2002-2004. Los costos se cuantificaron utilizando el enfoque de costeo de enfermedad (CDE desde la perspectiva del proveedor, la técnica del microcosteo y la metodología de abajo-arriba (bottom-up. Se estimaron costos promedio anuales de diagnóstico, por complicación y total de la enfermedad. RESULTADOS: El costo total anual de los pacientes con DM2 para el IMSS fue de US$452 064 988, correspondiente a 3,1% del gasto de operación. El costo promedio anual por paciente fue de US$3 193,75, correspondiendo US$2 740,34 para el paciente sin complicaciones y US$3 550,17 para el paciente con complicaciones. Los días/cama en hospitalización y en unidad de cuidados intensivos fueron los servicios con mayor costo. CONCLUSIONES: Los elevados costos en la atención médica a pacientes con DM2 y complicaciones representan una carga económica que las instituciones de salud deben considerar en su presupuesto, a fin de poder brindar un servicio de calidad, adecuado y oportuno. El empleo de la metodología de microcosteo permite un acercamiento a datos reales de utilización y manejo de la enfermedadOBJECTIVE: Estimate the direct cost of medical care incurred by the Mexican Social Security Institute (IMSS, Instituto Mexicano del Seguro Social for patients with type 2 diabetes mellitus (DM2. METHODS: The clinical files of 497 patients who were treated in secondary and tertiary medical care units in 2002-2004 were reviewed. Costs were quantified using a disease costing approach (DCA from the provider's perspective, a micro-costing technique, and a bottom-up methodology. Average annual costs by diagnosis, complication, and total cost were estimated. RESULTS
[The Revista Médica del IMSS in the 2017 Healthcare Book Fair].
Ramiro-H, Manuel; Acosta-Pérez, L; Cruz-Aranda, J E; García-Damián, J J; Miguel-Reyes, R; González-Martínez, R
2017-01-01
On August, the second edition of the Healthcare Book Fair took place, sponsored by the Facultad de Medicina of UNAM. Again, the Revista Médica del Instituto Mexicano del Seguro Social participated with a stand where we promoted it, talked about the different indexes where our journal is included, explained its objective and scope, and finally talked about its nature as an open access journal, which is aimed to the clinical staff of the different health institutions of our country.
Yvonne Flores; Keerti Shah; Eduardo Lazcano; Mauricio Hernández; David Bishai; Daron G Ferris; Attila Lörincz; Pilar Hernández; Jorge Salmerón
2002-01-01
Objective. The purpose of this paper is to describe the design and methodology of the Morelos HPV Study. The main objective of this study is to examine the use of two different methods for obtaining HPV DNA specimens, self-collected vaginal and clinician-collected cervical, to detect pre-invasive cervical lesions and cancer. Material and Methods. This study was conducted within the regular population-based framework of the Mexican Institute of Social Security (IMSS) cervical cancer screening ...
[Job satisfaction among primary care physicians at the IMSS].
Valderrama-Martínez, José Arturo; Dávalos-Díaz, Guillermina
2009-01-01
To know factors related to job satisfaction among primary care Physicians from the Mexican Social Security Institute. Cross-sectional survey applied to physicians of outpatient visit areas in four Family Medicine Units in Leon, Guanajuato, from February to May 2007. The survey explored six areas. We used 95% confidence intervals and One-Way ANOVA to compare means among clinics and Chi square and OR'95% confidence intervals to compare proportions. One hundred sixty physicians participated (response rate 88.9%), three were excluded. Most physicians were satisfied with their work (86%). Half of the doctors feel satisfied with their economic benefits (48%), non-economic benefits (52%), and those from the collective bargaining agreement (53%), as well as with the labor union (46%) and their actual insurances (45%). Only one third or less of participants refer to receive incentives (31%) or recognitions for their work (33%), were satisfied with the opportunities for training (31%), the economic incentives (29%), or the salary (24%). The satisfaction's means of work, benefits, insurances, labor union and collective bargaining agreement were significantly higher than the means of salary and economic incentives. Satisfaction means were significantly higher in Clinic #53 than in Clinic #51 for job satisfaction and opportunities for training, as well as percentages of response in institutional support, incentives and recognitions for their work, were higher in Clinic 53 compared to all other clinics; however, it's the smallest clinic in this study. Family doctors find satisfaction in their practice, and factors such as institutional support, recognition and incentives may improve their general job satisfaction.
Comparison of Lithuanian, Italian and British Social Business Models
Directory of Open Access Journals (Sweden)
Zaneta Simanaviciene
2017-03-01
Full Text Available Daily life in the world is accompanied by a variety of global social problems such as discrimination, ignorance, suicides, poverty, hunger, environmental pollution and several others frequently caused by human beings. These have been particularly exacerbated by the recent and arguably ongoing economic crisis. Traditional global market makers and participants are gradually getting involved in the creation of social welfare while acting in a socially responsible manner, however, such actions are often led by a certain “fashion” or public pressure. Social entrepreneurship is cited as one of those alternatives. This business model is driven by the desire to have social impact, it is one of the main tools being used as a response to fight against growing social exclusion and unemployment, dealing with sensitive regional problems. According to European Commission, one of four start-ups each year is a social business company. It is being championed as a new opportunity to reduce inequality and exclusion so as to encourage economic growth. However, although social entrepreneurship has won the attention of scientists, its inconsistent theoretical basis and very limited perception are widely argued. It is claimed that poor perception of the social business model is a major barrier to the development of such entrepreneurship in Europe.
Directory of Open Access Journals (Sweden)
Solórzano-Santos Fortino
2007-12-01
Full Text Available Abstract Background The aging population poses a challenge to Mexican health services. The aim of this study is to describe recent oral health services utilization and its association with socio-demographic characteristics and co-morbidity in Mexican Social Security beneficiaries 60 years and older. Methods A sample of 700 individuals aged 60+ years was randomly chosen from the databases of the Mexican Institute of Social Security (IMSS. These participants resided in the southwest of Mexico City and made up the final sample of a cohort study for identifying risk factors for root caries in elderly patients. Sociodemographic variables, presence of cognitive decline, depression, morbidity, medication consumption, and utilization of as well as reasons for seeking oral health services within the past 12 months were collected through a questionnaire. Clinical oral assessments were carried out to determine coronal and root caries experience. Results The sample consisted of 698 individuals aged 71.6 years on average, of whom 68.3% were women. 374 participants (53.6% had made use of oral health services within the past 12 months. 81% of those who used oral health services sought private medical care, 12.8% sought social security services, and 6.2% public health services. 99.7% had experienced coronal caries and 44.0% root caries. Female sex (OR = 2.0, 6 years' schooling or less (OR = 1.4, and caries experience in more than 22 teeth (OR = 0.6 are factors associated with the utilization of these services. Conclusion About half the elderly beneficiaries of social security have made use of oral health services within the past 12 months, and many of them have to use private services. Being a woman, having little schooling, and low caries experience are factors associated with the use of these services.
Creating Social Reality: Informational Social Influence and the Content of Stereotypic Beliefs.
Wittenbrink, Bernd; Henly, Julia R.
1996-01-01
Three experiments tested the hypothesis that comparison information about other people's stereotypic beliefs is used to validate personal beliefs about a target group. A simple manipulation of questionnaire items and their response scales, presented as part of a political opinion survey, served as social comparison information regarding beliefs…
Comparison of Student and Instructor Perceptions of Social Presence
Directory of Open Access Journals (Sweden)
Kathleen Mathieson
2014-05-01
Full Text Available As enrollment in online courses continues to grow and online education is increasingly recognized as an established instructional mode, the unique challenges posed by this learning environment should be addressed. A primary challenge for virtual educators is developing social presence such that participants feel a sense of human connection with each other. Accomplishing this within learning management systems (LMS that are often restrictive can be difficult. Prior research has established a relationship between student perceptions of social presence and satisfaction, but little research has included perceptions of instructors. This study compares student and instructor perceptions of social presence and the importance placed on social connections. While students and instructors reported high levels of social presence, students reported significantly lower levels than instructors. In particular, students found the LMS more impersonal than instructors and were less comfortable participating in LMS activities than instructors. Students had less desire for social connections with other students and instructors, and reported having less time available for such connections. Strategies to facilitate social presence, including offering social networking opportunities outside the LMS, are discussed in light of these differences in perceptions between students and instructors.
Social Surveys about Solid Waste Management within Higher Education Institutes: A Comparison
Directory of Open Access Journals (Sweden)
Navarro Ferronato
2017-03-01
Full Text Available Solid waste mismanagement is a social burden that requires the introduction of reliable public policies, including recycling principles and technological facilities. However, the development of recycling plans is a real issue for municipal governments, since it involves psychological and cultural factors, both in developed and developing countries. Questionnaire survey is an important tool for evaluating which solid waste management policy is suited for each specific study area, involving citizens and stakeholders. The aim of this paper is to evaluate what approach should be applied for social surveys in higher education institutes, comparing developing and developed countries. Italy is the developed country analyzed, where two universities in different cities are compared, while La Paz (Bolivia is the emerging reality considered. The research conducted in La Paz led us to understand that, although recycling rates are low (about 8%, many students (56.96% separate up to half of the waste produced at home. At the same time, about 53% of those interviewed do not know the recycling practices implemented by the informal sector which is the one that constantly act for improving the recycling rates of the city. Low technological acceptance is instead underlined in the high income country, since there is a common negative opinion concerning the introduction of landfills and incinerators near residential areas (49% disagree. A comparison of the methodologies adopted for the two case studies is introduced whereas investigations results are presented.
Scharfstein, Lindsay A.; Beidel, Deborah C.; Sims, Valerie K.; Finnell, Laura Rendon
2011-01-01
Social skills deficits are commonly reported among children with social phobia (SP) and children with Asperger's Disorder (AD); however, a lack of direct comparison makes it unclear whether these groups, both of which endorse the presence of social anxiety, have similar or unique skills deficits. In this investigation, the social behaviors of…
On models and vases: body dissatisfaction and proneness to social comparison effects.
Trampe, Debra; Stapel, Diederik A; Siero, Frans W
2007-01-01
When and why do media-portrayed physically attractive women affect perceivers' self-evaluations? In 6 studies, the authors showed that whether such images affect self-evaluations depends jointly on target features and perceiver features. In Study 1, exposure to a physically attractive target, compared with exposure to an equally attractive model, lowered women's self-evaluations. Study 2 showed that body-dissatisfied women, to a greater extent than body-satisfied women, report that they compare their bodies with other women's bodies. In Study 3, body-dissatisfied women, but not body-satisfied women, were affected by both attractive models and nonmodels. Furthermore, in Study 4, it was body-dissatisfied women, rather than body-satisfied women, who evaluated themselves negatively after exposure to a thin (versus a fat) vase. The authors replicated this result in Study 5 by manipulating, instead of measuring, body dissatisfaction. Finally, Study 6 results suggested that body dissatisfaction increases proneness to social comparison effects because body dissatisfaction increases self-activation. 2007 APA, all rights reserved
Neural representations of social status hierarchy in human inferior parietal cortex.
Chiao, Joan Y; Harada, Tokiko; Oby, Emily R; Li, Zhang; Parrish, Todd; Bridge, Donna J
2009-01-01
Mental representations of social status hierarchy share properties with that of numbers. Previous neuroimaging studies have shown that the neural representation of numerical magnitude lies within a network of regions within inferior parietal cortex. However the neural basis of social status hierarchy remains unknown. Using fMRI, we studied subjects while they compared social status magnitude of people, objects and symbols, as well as numerical magnitude. Both social status and number comparisons recruited bilateral intraparietal sulci. We also observed a semantic distance effect whereby neural activity within bilateral intraparietal sulci increased for semantically close relative to far numerical and social status comparisons. These results demonstrate that social status and number comparisons recruit distinct and overlapping neuronal representations within human inferior parietal cortex.
Social Rhythm and Mental Health: A Cross-Cultural Comparison.
Directory of Open Access Journals (Sweden)
Jürgen Margraf
Full Text Available Social rhythm refers to the regularity with which one engages in social activities throughout the week, and has established links with bipolar disorder, as well as some links with depression and anxiety. The aim of the present study is to examine social rhythm and its relationship to various aspects of health, including physical health, negative mental health, and positive mental health.Questionnaire data were obtained from a large-scale multi-national sample of 8095 representative participants from the U.S., Russia, and Germany.Results indicated that social rhythm irregularity is related to increased reporting of health problems, depression, anxiety, and stress. In contrast, greater regularity is related to better overall health state, life satisfaction, and positive mental health. The effects are generally small in size, but hold even when controlling for gender, marital status, education, income, country, and social support. Further, social rhythm means differ across Russia, the U.S., and Germany. Relationships with mental health are present in all three countries, but differ in magnitude.Social rhythm irregularity is related to mental health in Russia, the U.S., and Germany.
False consensus in social context: differential projection and perceived social distance.
Jones, Paul E
2004-09-01
The study implicates the notion of perceived social distance as an explanation of why ingroup false consensus exceeds outgroup false consensus. Whilst previous demonstrations are best understood from social identity perspectives, the findings reported here suggest that self-group as well as inter-group comparisons can underlie such effects. In particular, perceived social distance was shown to mediate the effect of social categorisation: ingroup false consensus was greater because more social distance was perceived with the outgroup. The findings also extended to non-student samples and generalised across both opinion and ability items. In addition, examining the effect of item type in conjunction with social categorisation seriously challenged the generality of the false consensus effect.
Directory of Open Access Journals (Sweden)
Senem ATVUR
2014-06-01
Full Text Available Dams having social, cultural, ecological effects; have triggered social movements in different parts of the world. In Turkey and India, too, similar social movements appeared. The aim of this article is to compare social movements against dams in two countries where social, cultural and political structures are totally different. The movement against the dam construction in Narmada Valley, India and the movement against HES (hydroelectric plants in Turkey are evaluated in terms of the organizer actors of the movement; repertoire of action; international impacts; reaction of the state power; consequences in the way of realization of their aims. Comparison of two examples is important in order to reveal insufficiencies of the struggle against dams.
On the Use of Social Clocks for the Monitoring of Multidimensional Social Development
Mueller, Georg P.
2011-01-01
This article describes a new methodology for monitoring multidimensional social development using social clocks: comparisons with so called reference trajectories make it possible to establish the development stage of a country along a number of independent time axes, thus affording new opportunities for analyzing leads, lags, and asynchronies…
Liao, Tim Futing
2011-01-01
An incomparably useful examination of statistical methods for comparisonThe nature of doing science, be it natural or social, inevitably calls for comparison. Statistical methods are at the heart of such comparison, for they not only help us gain understanding of the world around us but often define how our research is to be carried out. The need to compare between groups is best exemplified by experiments, which have clearly defined statistical methods. However, true experiments are not always possible. What complicates the matter more is a great deal of diversity in factors that are not inde
Maria Anne Schmidt; Daniel Cracau
2015-01-01
Corporate social responsibility (CSR) is a phenomenon of increasing interest. Today, it is practiced in most countries around the globe and studied in various fields of academia. However, the focus still lies on Western developed countries, their understanding, and implementation of CSR. This paper focuses on the comparison of the orientation towards CSR in Germany and Qatar, thereby closing a research gap by providing insights from a Middle Eastern country. Based on a survey among 265 busine...
HEALTH COMPLAINTS, SOCIAL COMPARISONS, AND ABSENTEEISM
GEURTS, SA; BUUNK, BP; SCHAUFELI, WB
1994-01-01
In this study the relationship between health problems and objectively recorded absence frequency is investigated from a social psychological perspective in a prospective design. By employing LISREL, a model is developed (tested and revised) among blue-collar workers in Plant North (N = 254) of a
[Comparison of the effects of exchange forms on social solidarity].
Inaba, Misato; Takahashi, Nobuyuki
2012-04-01
Although social solidarity is an essential component that helps maintaining social order, what produces solidarity and how does it work have not been fully investigated. We conducted an experiment to examine whether experiencing different forms of social exchange produces different levels of solidarity. We compared four forms of social exchange: reciprocal exchange (exchange resources without negotiation), negotiated exchange (with negotiation), pure-generalized exchange (giver can choose who to give) and chain-generalized exchange (giver cannot choose who to give). Two dimensions classify these exchanges: the number of players (two vs. more than two), and involvement of negotiation. Reciprocal and negotiated exchanges occur within dyads, while pure- and chain-generalized exchanges involve three or more players. Only the negotiated exchange involves negotiation process; the other exchanges are purely unilateral giving. Participants played a one-shot social dilemma game (SDG) before and after social exchange session. The more the players cooperated in SDG, the stronger the social solidarity. Results show that the cooperation rate in SDG increased more in the reciprocal, pure- and chain-generalized exchange conditions than that in the negotiated exchange condition, suggesting that social solidarity is facilitated by experiencing social exchange which does not involve negotiation.
Martínez-Andrade, Gloria Oliva; Cespedes, Elizabeth M; Rifas-Shiman, Sheryl L; Romero-Quechol, Guillermina; González-Unzaga, Marco Aurelio; Benítez-Trejo, María Amalia; Flores-Huerta, Samuel; Horan, Chrissy; Haines, Jess; Taveras, Elsie M; Pérez-Cuevas, Ricardo; Gillman, Matthew W
2014-03-20
Mexico has the highest adult overweight and obesity prevalence in the Americas; 23.8% of children obese. Creciendo Sanos was a pilot intervention to prevent obesity among preschoolers in Instituto Mexicano del Seguro Social (IMSS) clinics. We randomized 4 IMSS primary care clinics to either 6 weekly educational sessions promoting healthful nutrition and physical activity or usual care. We recruited 306 parent-child pairs: 168 intervention, 138 usual care. Children were 2-5 years old with WHO body mass index (BMI) z-score 0-3. We measured children's height and weight and parents reported children's diet and physical activity at baseline and 3 and 6-month follow-up. We analyzed behavioral and BMI outcomes with generalized mixed models incorporating multiple imputation for missing values. 93 (55%) intervention and 96 (70%) usual care families completed 3 and 6-month follow-up. At 3 months, intervention v. usual care children increased vegetables by 6.3 servings/week (95% CI, 1.8, 10.8). In stratified analyses, intervention participants with high program adherence (5-6 sessions) decreased snacks and screen time and increased vegetables v. usual care. No further effects on behavioral outcomes or BMI were observed. Transportation time and expenses were barriers to adherence. 90% of parents who completed the post-intervention survey were satisfied with the program. Although satisfaction was high among participants, barriers to participation and retention included transportation cost and time. In intention to treat analyses, we found intervention effects on vegetable intake, but not other behaviors or BMI. ClinicalTrials.gov NCT01539070.Comisión Nacional de Investigación Científica del IMSS: 2009-785-120.
Cheung, Felix; Lucas, Richard E
2016-02-01
Previous research has shown that having rich neighbors is associated with reduced levels of subjective well-being, an effect that is likely due to social comparison. The current study examined the role of income inequality as a moderator of this relative income effect. Multilevel analyses were conducted on a sample of more than 1.7 million people from 2,425 counties in the United States. Results showed that higher income inequality was associated with stronger relative income effects. In other words, people were more strongly influenced by the income of their neighbors when income inequality was high. (c) 2016 APA, all rights reserved).
Cheung, Felix; Lucas, Richard E.
2015-01-01
Previous research has shown that having rich neighbors is associated with reduced levels of subjective well-being, an effect that is likely due to social comparison. The current study examined the role of income inequality as a moderator of this relative income effect. Multilevel analyses were conducted on a sample of over 1.7 million people from 2,425 counties in the United States. Results showed that higher income inequality was associated with stronger relative income effects. In other words, people were more strongly influenced by the income of their neighbors when income inequality was high. PMID:26191957
Rethinking the health consequences of social class and social mobility.
Simandan, Dragos
2018-03-01
The task of studying the impact of social class on physical and mental health involves, among other things, the use of a conceptual toolbox that defines what social class is, establishes how to measure it, and sets criteria that help distinguish it from closely related concepts. One field that has recently witnessed a wealth of theoretical and conceptual research on social class is psychology, but geographers' and sociologists' attitude of diffidence toward this "positivistic" discipline has prevented them from taking advantage of this body of scholarship. This paper aims to highlight some of the most important developments in the psychological study of social class and social mobility that speak to the long-standing concerns of health geographers and sociologists with how social position, perceptions, social comparisons, and class-based identities impact health and well-being. Crown Copyright © 2017. Published by Elsevier Ltd. All rights reserved.
Integrated Monitoring and Surveillance System demonstration project. Phase 2 accomplishments
International Nuclear Information System (INIS)
Aumeier, S.E.; Walters, B.G.; Singleterry, R.C.
1997-01-01
The paper presents the results of the Integrated Monitoring and Surveillance System (IMSS) demonstration project Phase 2 efforts. the rationale behind IMSS development is reviewed and progress in each of the 5 basic tasks is detailed. Significant results include further development of the data acquisition system and procurement of necessary hardware/software, options and associated costs for plutonium canning systems and gloveboxes, initiation of facility modifications, determination of possibly affected facility documentation, results from sensor system trade study, and preliminary storage configuration designs. Resources invested during Phase 1 and Phase 2 are summarized and budgetary requirements for completion of Phase 3 presented. The results show that the IMSS demonstration project team has met and in many cases exceeded the commitments made for Phase 2 deliverables
Bhardwaj, Anjali K; Forrester-Jones, Rachel V E; Murphy, Glynis H
2018-03-01
Little research exists comparing the social networks of people with intellectual disability (ID) from South Asian and White backgrounds. This UK study reports on the barriers that South Asian people with intellectual disability face in relation to social inclusion compared to their White counterparts. A mixed-methods research design was adopted to explore the social lives of 27 men (15 White; 12 South Asian) and 20 women (10 White; 10 South Asian with intellectual disability). Descriptive and parametric tests were used to analyse the quantitative data. The average network size of the whole group was 32 members. South Asian participants had more family members whilst White participants had more service users and staff in their networks; 96% network members from White intellectual disability group were also of White background, whilst the South Asian group had mixed ethnic network members. Social networks of individuals with intellectual disability in this study were found to be larger overall in comparison with previous studies, whilst network structure differed between the White and South Asian population. These differences have implications relating to future service planning and appropriateness of available facilities. © 2017 John Wiley & Sons Ltd.
A Comparison of Online Social Networks and Real-Life Social Networks: A Study of Sina Microblogging
Directory of Open Access Journals (Sweden)
Dayong Zhang
2014-01-01
Full Text Available Online social networks appear to enrich our social life, which raises the question whether they remove cognitive constraints on human communication and improve human social capabilities. In this paper, we analyze the users' following and followed relationships based on the data of Sina Microblogging and reveal several structural properties of Sina Microblogging. Compared with real-life social networks, our results confirm some similar features. However, Sina Microblogging also shows its own specialties, such as hierarchical structure and degree disassortativity, which all mark a deviation from real-life social networks. The low cost of the online network forms a broader perspective, and the one-way link relationships make it easy to spread information, but the online social network does not make too much difference in the creation of strong interpersonal relationships. Finally, we describe the mechanisms for the formation of these characteristics and discuss the implications of these structural properties for the real-life social networks.
Directory of Open Access Journals (Sweden)
Vuokko Heikinheimo
2017-03-01
Full Text Available Protected area management and marketing require real-time information on visitors’ behavior and preferences. Thus far, visitor information has been collected mostly with repeated visitor surveys. A wealth of content-rich geographic data is produced by users of different social media platforms. These data could potentially provide continuous information about people’s activities and interactions with the environment at different spatial and temporal scales. In this paper, we compare social media data with traditional survey data in order to map people’s activities and preferences using the most popular national park in Finland, Pallas-Yllästunturi National Park, as a case study. We compare systematically collected survey data and the content of geotagged social media data and analyze: (i where do people go within the park; (ii what are their activities; (iii when do people visit the park and if there are temporal patterns in their activities; (iv who the visitors are; (v why people visit the national park; and (vi what complementary information from social media can provide in addition to the results from traditional surveys. The comparison of survey and social media data demonstrated that geotagged social media content provides relevant information about visitors’ use of the national park. As social media platforms are a dynamic source of data, they could complement and enrich traditional forms of visitor monitoring by providing more insight on emerging activities, temporal patterns of shared content, and mobility patterns of visitors. Potentially, geotagged social media data could also provide an overview of the spatio-temporal activity patterns in other areas where systematic visitor monitoring is not taking place.
[Cost-effectiveness of two hospital care schemes for psychiatric disorders].
Nevárez-Sida, Armando; Valencia-Huarte, Enrique; Escobedo-Islas, Octavio; Constantino-Casas, Patricia; Verduzco-Fragoso, Wázcar; León-González, Guillermo
2013-01-01
In Mexico, six of every twenty Mexicans suffer psychiatric disorders at some time in their lives. This disease ranks fifth in the country. The objective was to determine and compare the cost-effectiveness of two models for hospital care (partial and traditional) at a psychiatric hospital of Instituto Mexicano del Seguro Social (IMSS). a multicenter study with a prospective cohort of 374 patients was performed. We made a cost-effectiveness analysis from an institutional viewpoint with a six-month follow-up. Direct medical costs were analyzed, with quality of life gains as outcome measurement. A decision tree and a probabilistic sensitivity analysis were used. patient care in the partial model had a cost 50 % lower than the traditional one, with similar results in quality of life. The cost per successful unit in partial hospitalization was 3359 Mexican pesos while in the traditional it increased to 5470 Mexican pesos. treating patients in the partial hospitalization model is a cost-effective alternative compared with the traditional model. Therefore, the IMSS should promote the infrastructure that delivers the psychiatric services to the patient attending to who requires it.
Directory of Open Access Journals (Sweden)
Carlos Hernández-Girón
2005-12-01
Full Text Available OBJETIVO: Algunos estudios sugieren la posibilidad de que el proceso fisiológico del embarazo modifique algunas características del hospedero, lo que incrementa el riesgo de infección por VPH; sin embargo, esta asociación no está bien establecida. Pocos estudios se han realizado para determinar la prevalencia de infección por VPH de alto riesgo en mujeres embarazadas, y sus factores relacionados. El presente estudio busca determinar la prevalencia de infección por VPH de alto riesgo, en una muestra de mujeres embarazadas mexicanas, y sus posibles factores de riesgo. MATERIAL Y MÉTODOS: Se realizó un estudio epidemiológico de tipo transversal en una muestra de 274 mujeres embarazadas que acudieron a los servicios de primer nivel de atención del Hospital General del Instituto Mexicano del Seguro Social (IMSS en Cuernavaca, Morelos, durante el año 2000. Se obtuvieron muestras de exudado vaginal mediante autotoma, y se aplicó un cuestionario estructurado sobre características sociodemográficas, ginecoobstétricas y de comportamiento sexual. La detección de infección por VPH de alto riesgo, se realizó empleando un método de captura de híbridos (Hybrid Capture II, HCII, Digene Corp.. RESULTADOS: La prevalencia de infección por VPH fue de 37.2% (102/274. En promedio acudieron a su primera cita prenatal al sexto mes de embarazo; la media de edad fue 25.7 años. Los principales factores de riesgo asociados a infección por VPH fueron: edad, entre 20 y 29 años (RM = 2.82; IC95% 1.02-7.76, 30 o más años (RM ajustada = 6.85; IC95% 1.22-38.2; compañeros sexuales con otras parejas (RM= 2.05; IC95% 1.2-3.7. Mostraron asociación positiva, aunque marginalmente significativas: escolaridad menor de 6 años (RM = 1.67; IC95% 0.67-4.3; más de dos parejas sexuales en su vida (RM = 1.54; IC95% 0.7-3.4; y tabaquismo actual (RM= 1.6; IC95% 0.6-5.0. CONCLUSIONES: Los hallazgos indican una mayor prevalencia de infección por VPH de alto riesgo
Directory of Open Access Journals (Sweden)
Ramón Alberto Rascón-Pacheco
2000-08-01
Full Text Available OBJETIVO: Presentar un instrumento que permita llevar a cabo la vigilancia epidemiológica y evaluar la calidad de la atención a la diabetes mellitus en el primer nivel de atención. MATERIAL Y MÉTODOS: Este estudio se realizó del 1 de enero de 1998 al 30 de junio de 1999, en la Unidad de Investigación Epidemiológica y en Servicios de Salud, del Instituto Mexicano del Seguro Social (IMSS, en Hermosillo, Sonora. Se diseñó un formato único de reporte compuesto por los diferentes elementos que integran el sistema para la atención del paciente diabético en una Unidad de Medicina Familiar del IMSS. RESULTADOS: Se desarrolló e implementó un paquete de computación (software que permite la captura de los datos de dicho formato y la generación de reportes, de tipo individual y grupal, sobre el cumplimiento de citas, antecedentes personales patológicos y no patológicos, evolución de signos y síntomas, exámenes de laboratorio y el manejo terapéutico. CONCLUSIONES: La sistematización de datos en forma electrónica favorece la obtención de información confiable y permanente para la vigilancia de los procesos en la atención integral del paciente diabético.OBJECTIVE: To describe an instrument for epidemiologic surveillance of diabetes mellitus and evaluating the quality of care in primary health care. MATERIAL AND METHODS: The study was conducted from January 1, 1998, to June 30, 1999, at the Epidemiology and Health Services Research Unit of the Mexican Institute for Social Security (IMSS, in Hermosillo, Sonora. A single data collection form was designed, which contains items included in the diabetes care clinic of the Unit of Family Medicine of the Mexican Institute of Social Security. RESULTS: We developed and implemented a software program to enter data from the paper format and to generate individual and group reports on attendance to scheduled medical visits, medical history, evolution of signs and symptoms, laboratory tests, and
Fung, Joey; Kim, Joanna J.; Jin, Joel; Wu, Qiaobing; Fang, Chao; Lau, Anna S.
2017-01-01
This study examined the relationship between perceived social change, parental control and family relations in a sample of 419 4th and 5th grade children and their mothers who are of Chinese descent but reside in three different contexts: Los Angeles (LA), Hong Kong (HK), and Beijing (BJ). HK mothers endorsed the highest levels of psychological control and the lowest levels of autonomy support compared to BJ and LA mothers. Perceived social change as measured by mothers’ endorsement of new values and ideologies was associated with increased use of both autonomy support and psychological control. Results of the mediation analyses suggested that perceived social change explained differences between LA and HK mothers in autonomy support, but group differences in psychological control were magnified when perceived social change was accounted for. Finally, whereas autonomy support was associated with higher levels of child perceived acceptance in HK and LA, psychological control was associated with greater family conflict in BJ and LA. Findings suggested that as families undergo urbanization or social change, it may shift the implications of traditional strategies that are intended to socialize the child toward interpersonal attunement. Overall, the study highlights the importance of moving beyond ethnic-group or cross-national comparisons to investigate the role of changing social and economic contexts in understanding differences in the use of parental control and their associations with family relations. PMID:29062285
Fung, Joey; Kim, Joanna J; Jin, Joel; Wu, Qiaobing; Fang, Chao; Lau, Anna S
2017-01-01
This study examined the relationship between perceived social change, parental control and family relations in a sample of 419 4th and 5th grade children and their mothers who are of Chinese descent but reside in three different contexts: Los Angeles (LA), Hong Kong (HK), and Beijing (BJ). HK mothers endorsed the highest levels of psychological control and the lowest levels of autonomy support compared to BJ and LA mothers. Perceived social change as measured by mothers' endorsement of new values and ideologies was associated with increased use of both autonomy support and psychological control. Results of the mediation analyses suggested that perceived social change explained differences between LA and HK mothers in autonomy support, but group differences in psychological control were magnified when perceived social change was accounted for. Finally, whereas autonomy support was associated with higher levels of child perceived acceptance in HK and LA, psychological control was associated with greater family conflict in BJ and LA. Findings suggested that as families undergo urbanization or social change, it may shift the implications of traditional strategies that are intended to socialize the child toward interpersonal attunement. Overall, the study highlights the importance of moving beyond ethnic-group or cross-national comparisons to investigate the role of changing social and economic contexts in understanding differences in the use of parental control and their associations with family relations.
Directory of Open Access Journals (Sweden)
Joey Fung
2017-10-01
Full Text Available This study examined the relationship between perceived social change, parental control and family relations in a sample of 419 4th and 5th grade children and their mothers who are of Chinese descent but reside in three different contexts: Los Angeles (LA, Hong Kong (HK, and Beijing (BJ. HK mothers endorsed the highest levels of psychological control and the lowest levels of autonomy support compared to BJ and LA mothers. Perceived social change as measured by mothers’ endorsement of new values and ideologies was associated with increased use of both autonomy support and psychological control. Results of the mediation analyses suggested that perceived social change explained differences between LA and HK mothers in autonomy support, but group differences in psychological control were magnified when perceived social change was accounted for. Finally, whereas autonomy support was associated with higher levels of child perceived acceptance in HK and LA, psychological control was associated with greater family conflict in BJ and LA. Findings suggested that as families undergo urbanization or social change, it may shift the implications of traditional strategies that are intended to socialize the child toward interpersonal attunement. Overall, the study highlights the importance of moving beyond ethnic-group or cross-national comparisons to investigate the role of changing social and economic contexts in understanding differences in the use of parental control and their associations with family relations.
Desigualdad de género en las relaciones conyugales y prácticas sexuales de los hombres mexicanos
Directory of Open Access Journals (Sweden)
Ivonne Szasz
2008-01-01
Full Text Available El objetivo de este trabajo es explorar, con base en los resultados de la Encuesta de Salud Reproductiva con Población Derechohabiente del Instituto Mexicano del Seguro Social (imssIMSS de 1998, las hipótesis que se desprenden de los estudios cualitativos. Esos estudios exploratorios sugieren importantes conexiones entre la construcción de las identidades masculinas y las prácticas anticonceptivas, de relacionamiento sexual y de prevención de las infecciones de transmisión sexual. También advierten de la existencia de marcadas diferencias generacionales y por clase social en las desigualdades de género que se expresan en las relaciones conyugales.Tomando en cuenta lo anterior, buscamos poner a prueba la hipótesis de que cuando las relaciones de género son más autoritarias en la pareja, los hombres están más expuestos a ejercer prácticas sexuales que pueden representar riesgo para la salud de ellos o sus parejas. Para ello ajustamos tres modelos de regresión logística teniendo como variables dependientes algunas que indican prácticas sexuales que pueden implicar riesgos, y revisamos si se mantiene la relación esperada al incluir la influencia conjunta de las variables indicativas de la supremacía masculina en las relaciones conyugales, así como el estrato socioeconómico y edad de los hombres estudiados.
Cultural differences in perceived social norms and social anxiety.
Heinrichs, Nina; Rapee, Ronald M; Alden, Lynn A; Bögels, Susan; Hofmann, Stefan G; Oh, Kyung Ja; Sakano, Yuji
2006-08-01
Cultural considerations in social anxiety are a rarely investigated topic although it seems likely that differences between countries in social norms may relate to the extent of social anxiety. The present study investigated individuals' personal and perceived cultural norms and their relation to social anxiety and fear of blushing. A total of 909 participants from eight countries completed vignettes describing social situations and evaluated the social acceptability of the behavior of the main actor both from their own, personal perspective as well as from a cultural viewpoint. Personal and cultural norms showed somewhat different patterns in comparison between types of countries (individualistic/collectivistic). According to reported cultural norms, collectivistic countries were more accepting toward socially reticent and withdrawn behaviors than was the case in individualistic countries. In contrast, there was no difference between individualistic and collectivistic countries on individuals' personal perspectives regarding socially withdrawn behavior. Collectivistic countries also reported greater levels of social anxiety and more fear of blushing than individualistic countries. Significant positive relations occurred between the extent to which attention-avoiding behaviors are accepted in a culture and the level of social anxiety or fear of blushing symptoms. These results provide initial evidence that social anxiety may be related to different cultural norms across countries.
Social networks, support and early psychosis: a systematic review.
Gayer-Anderson, C; Morgan, C
2013-06-01
Background. There is strong evidence that those with a long-standing psychotic disorder have fewer social contacts and less social support than comparison groups. There is less research on the extent of social contacts and support prior to or at the onset of psychosis. In the light of recent evidence implicating a range of social experiences and contexts at the onset of psychosis, it is relevant to establish whether social networks and support diminished before or at the time of onset and whether the absence of such supports might contribute to risk, either directly or indirectly. We, therefore, conducted a systematic review of this literature to establish what is currently known about the relationship between social networks, support and early psychosis. Methods. We identified all studies investigating social networks and support in first episode psychosis samples and in general population samples with measures of psychotic experiences or schizotype by conducting systematic searches of electronic databases using pre-defined search terms and criteria. Findings were synthesized using non-quantitative approaches. Results. Thirty-eight papers were identified that met inclusion criteria. There was marked methodological heterogeneity, which limits the capacity to draw direct comparisons. Nonetheless, the existing literature suggests social networks (particularly close friends) and support diminished both among first episode samples and among non-clinical samples reporting psychotic experiences or with schizotype traits, compared with varying comparison groups. These differences may be more marked for men and for those from minority ethnic populations. Conclusions. Tentatively, reduced social networks and support appear to pre-date onset of psychotic disorder. However, the substantial methodological heterogeneity among the existing studies makes comparisons difficult and suggests a need for more robust and comparable studies on networks, support and early psychosis.
Miyamoto, Yuri
2017-12-01
A large body of research in Western cultures has demonstrated the psychological and health effects of social class. This review outlines a cultural psychological approach to social stratification by comparing psychological and health manifestations of social class across Western and East Asian cultures. These comparisons suggest that cultural meaning systems shape how people make meaning and respond to material/structural conditions associated with social class, thereby leading to culturally divergent manifestations of social class. Specifically, unlike their counterparts in Western cultures, individuals of high social class in East Asian cultures tend to show high conformity and other-orientated psychological attributes. In addition, cultures differ in how social class impacts health (i.e. on which bases, through which pathways, and to what extent). Copyright © 2017 Elsevier Ltd. All rights reserved.
Integrated monitoring and surveillance system demonstration project: Phase I accomplishments
International Nuclear Information System (INIS)
Aumeier, S.E.; Walters, B.G.; Crawford, D.C.
1997-01-01
The authors present the results of the Integrated Monitoring and Surveillance System (IMSS) demonstration project Phase I efforts. The rationale behind IMSS development is reviewed and progress in each of the 5 basic tasks is detailed. Significant results include decisions to use Echelon LonWorks networking protocol and Microsoft Access for the data system needs, a preliminary design for the plutonium canning system glovebox, identification of facilities and materials available for the demonstration, determination of possibly affected facility documentation, and a preliminary list of available sensor technologies. Recently imposed changes in the overall project schedule and scope are also discussed and budgetary requirements for competition of Phase II presented. The results show that the IMSS demonstration project team has met and in many cases exceeded the commitments made for Phase I deliverables
A comparison of unemployed job-seekers with and without social anxiety
Himle, Joseph A; Weaver, Addie; Bybee, Deborah; O'Donnell, Lisa; Vlnka, Sarah; Laviolette, Wayne; Steinberger, Edward; Zipora, Golenberg; Levine, Debra Siegel
2014-01-01
Objective Literature consistently demonstrates that social anxiety disorder has substantial negative impacts on occupational functioning. However, to date, no identified empirical work has focused on understanding the specific nature of vocational problems among persons with social anxiety disorder. This study examines the association between employment-related factors (i.e., barriers to employment; skills related to employment; and job aspirations) and social anxiety among a sample of adults seeking vocational rehabilitation services. Methods Data from intake assessments, including a screen for social anxiety disorder, of 265 low-income, unemployed adults who initiated vocational rehabilitation services in urban Michigan was examined to assess differences in barriers to employment, employment skills, job aspirations, and demographic characteristics among participants who screened positive for social anxiety disorder compared to those who did not. Bivariate and multiple logistic regression analyses were performed. Results Multiple logistic regression analysis revealed that greater perceived experience and skill barriers to employment, fewer skills related to social-type occupations, and less education were significantly associated with social anxiety, after adjusting for other factors. Bivariate analysis also suggested that participants who screened positive for social anxiety disorder were significantly less likely to aspire to social jobs. Conclusions Employment-related factors likely impacting occupational functioning were significantly different between persons with and without social anxiety problems. Identifying these differences in employment barriers, skills, and job aspirations offer potentially important functional targets for psychosocial interventions aimed at social anxiety disorder and suggest the need for vocational service professionals to assess and address social anxiety among their clients. PMID:24733524
Directory of Open Access Journals (Sweden)
Martin Meyer
2016-08-01
Full Text Available We here compared pathogenic (p and non-pathogenic (np isolates of Entamoeba histolytica to identify molecules involved in the ability of this parasite to induce amoebic liver abscess (ALA-like lesions in two rodent models for the disease. We performed a comprehensive analysis of 12 clones (A1-A12 derived from a non-pathogenic isolate HM-1:IMSS-A and 12 clones (B1-B12 derived from a pathogenic isolate HM-1:IMSS-B. "Non-pathogenicity" included the induction of small and quickly resolved lesions while "pathogenicity" comprised larger abscess development that overstayed day 7 post infection. All A-clones were designated as non-pathogenic, whereas 4 out of 12 B-clones lost their ability to induce ALAs in gerbils. No correlation between ALA formation and cysteine peptidase (CP activity, haemolytic activity, erythrophagocytosis, motility or cytopathic activity was found. To identify the molecular framework underlying different pathogenic phenotypes, three clones were selected for in-depth transcriptome analyses. Comparison of a non-pathogenic clone A1np with pathogenic clone B2p revealed 76 differentially expressed genes, whereas comparison of a non-pathogenic clone B8np with B2p revealed only 19 differentially expressed genes. Only six genes were found to be similarly regulated in the two non-pathogenic clones A1np and B8np in comparison with the pathogenic clone B2p. Based on these analyses, we chose 20 candidate genes and evaluated their roles in ALA formation using the respective gene-overexpressing transfectants. We conclude that different mechanisms lead to loss of pathogenicity. In total, we identified eight proteins, comprising a metallopeptidase, C2 domain proteins, alcohol dehydrogenases and hypothetical proteins, that affect the pathogenicity of E. histolytica.
Meyer, Martin; Fehling, Helena; Matthiesen, Jenny; Lorenzen, Stephan; Schuldt, Kathrin; Bernin, Hannah; Zaruba, Mareen; Lender, Corinna; Ernst, Thomas; Ittrich, Harald; Roeder, Thomas; Tannich, Egbert; Lotter, Hannelore; Bruchhaus, Iris
2016-08-01
We here compared pathogenic (p) and non-pathogenic (np) isolates of Entamoeba histolytica to identify molecules involved in the ability of this parasite to induce amoebic liver abscess (ALA)-like lesions in two rodent models for the disease. We performed a comprehensive analysis of 12 clones (A1-A12) derived from a non-pathogenic isolate HM-1:IMSS-A and 12 clones (B1-B12) derived from a pathogenic isolate HM-1:IMSS-B. "Non-pathogenicity" included the induction of small and quickly resolved lesions while "pathogenicity" comprised larger abscess development that overstayed day 7 post infection. All A-clones were designated as non-pathogenic, whereas 4 out of 12 B-clones lost their ability to induce ALAs in gerbils. No correlation between ALA formation and cysteine peptidase (CP) activity, haemolytic activity, erythrophagocytosis, motility or cytopathic activity was found. To identify the molecular framework underlying different pathogenic phenotypes, three clones were selected for in-depth transcriptome analyses. Comparison of a non-pathogenic clone A1np with pathogenic clone B2p revealed 76 differentially expressed genes, whereas comparison of a non-pathogenic clone B8np with B2p revealed only 19 differentially expressed genes. Only six genes were found to be similarly regulated in the two non-pathogenic clones A1np and B8np in comparison with the pathogenic clone B2p. Based on these analyses, we chose 20 candidate genes and evaluated their roles in ALA formation using the respective gene-overexpressing transfectants. We conclude that different mechanisms lead to loss of pathogenicity. In total, we identified eight proteins, comprising a metallopeptidase, C2 domain proteins, alcohol dehydrogenases and hypothetical proteins, that affect the pathogenicity of E. histolytica.
The long-term effect of social comparison on academic performance
Wehrens, Maike J. P. W.; Kuyper, Hans; Dijkstra, Pieternel; Buunk, Abraham P.; van der Werf, Margaretha P. C.
2010-01-01
The present study was part of a large-scale cohort study among several thousand students in the Netherlands. The purpose of the study was to investigate the long-term effects of comparison choice, i.e., comparison with a target performing better or worse than oneself, and academic comparative
Social Security Programs Throughout the World: Africa, 2015
Social Security Administration — This report, which is part of a four-volume series, provides a cross-national comparison of the social security systems in 48 countries in Africa. It summarizes the...
Sex Role Socialization in Sport.
Mawson, L. Marlene
Sport values follow societal values, and, in American society, it is evident that men have determined the social, political, and economic values upon which this country has established its laws. An overview of the social influence of men in comparison to that of women in the development of American society points out how men and women have assumed…
Hales, Sarah; Turner-McGrievy, Gabrielle M; Wilcox, Sara; Fahim, Arjang; Davis, Rachel E; Huhns, Michael; Valafar, Homayoun
2016-10-01
To test the efficacy of a weight loss mobile app based on recommender systems and developed by experts in health promotion and computer science to target social support and self-monitoring of diet, physical activity (PA), and weight (Social POD app), compared to a commercially available diet and PA tracking app (standard). Overweight adults [N=51] were recruited and randomly assigned to either the experimental group [n=26; theory-based podcasts (TBP)+Social POD app] or the comparison group (n=25; TBP+standard app). The Social POD app issued notifications to encourage users to self-monitor and send theory-based messages to support users who had not self-monitored in the previous 48h. Independent samples t-test were used to examine group differences in kilograms lost and change in BMI. Analysis of covariance was used to analyze secondary outcomes while controlling for baseline values. Participant attrition was 12% (n=3 experimental and n=3 comparison). Experimental group participants lost significantly more weight (-5.3kg, CI: -7.5, -3.0) than comparison group (-2.23kg, CI: -3.6, -1.0; d=0.8, r=0.4, p=0.02) and had a greater reduction in BMI (p=0.02). While there were significant differences in positive outcome expectations between groups (p=0.04) other secondary outcomes (e.g., caloric intake and social support) were not significant. Use of the Social POD app resulted in significantly greater weight loss than use of a commercially available tracking app. This mobile health intervention has the potential to be widely disseminated to reduce the risk of chronic disease associated with overweight and obesity. Published by Elsevier Ireland Ltd.
Familial correlates of social anxiety in children and adolescents.
Bögels, S M; van Oosten, A; Muris, P; Smulders, D
2001-03-01
Retrospective studies suggest a relationship between parental rearing practices and social phobia. The present study investigated whether socially anxious children perceive their current parental rearing as rejecting, overprotective, and lacking emotional warmth, and as emphasizing the importance of other's opinion, and de-emphasizing social initiatives and family sociability. Furthermore, we examined whether parents of socially anxious children report to rely on such rearing practices, and suffer themselves from social fears. A regression analysis as well as extreme group comparisons were applied. Little support was found for the presumed role of the assessed family rearing aspects in the development of social anxiety in children. Solely family sociability (children's and mothers' report) and children's perception of overprotection of the mother predicted social anxiety in the regression analysis. Given the influence of the mentioned rearing practices, social anxiety of the mother still significantly predicted social anxiety of the child. In the extreme group comparisons, differences in the expected direction were found between socially anxious and normal children on parental rejection, emotional warmth, and family sociability. However, the lack of differences between socially anxious and clinical control children suggests that these variables do not form a specific pathway to social fears.
Rousseau, Ann; Eggermont, Steven; Frison, Eline
2017-01-01
Facebook has been found to provide a fertile ground for social comparison. Emerging evidence indicates that social comparison may mediate the relationship between Facebook use and young people’s body dissatisfaction. Yet, little work has been done on how these relationships evolve over time in adolescence and no study has examined the reciprocal relationships between passive Facebook use, social comparison, and adolescents’ body dissatisfaction. To examine these reciprocal relationships, t...
van Rijn, Sophie; Stockmann, Lex; Borghgraef, Martine; Bruining, Hilgo; van Ravenswaaij-Arts, Conny; Govaerts, Lutgarde; Hansson, Kerstin; Swaab, Hanna
2014-01-01
The present study aimed to gain more insight in the social behavioral phenotype, and related autistic symptomatology, of children with an extra X chromosome in comparison to children with ASD. Participants included 60 children with an extra X chromosome (34 boys with Klinefelter syndrome and 26 girls with Trisomy X), 58 children with ASD and 106…
平野, 光俊; 笠谷, 千佳
2017-01-01
The aim of this study is to use perspectives from equity theory and social comparison to explain the reason why non-regular employees’ motivation is not low, despite working at relatively low pay compared to regular employees. To achieve this, the study conducted a questionnaire survey of regular (full-time) and part-time employees of a grocery store chain retail business. The results indicated the following: (1) part-time workers have greater motivation, affective commitment, and job satisfa...
Social Wellbeing Predictor of illness behavior among HIV ...
African Journals Online (AJOL)
Administrator
the intensity and impact of social support on HIV ... and family, the 'F' ratio for diagnosis and nationality ... relationship and social support to an extent that even ..... measurement of effort-reward imbalance at. Work. European Comparison.
[Self-esteem: a comparison study between eating disorders and social phobia].
Eiber, R; Vera, L; Mirabel-Sarron, C; Guelfi, J-D
2003-01-01
Eating disorder patients evidenced very often a low self-esteem. Self-esteem in eating disorder patients is excessively based on body dissatisfaction. In eating disorders there seems to be a link between body image dissatisfaction and social anxiety. We hypothesised: self-esteem would be as low in eating disorder patients as in social phobia patients; self-esteem would be lower in eating disorder patients with social phobia than in patients with social phobia alone; self-esteem would be lower in eating disorder patients with depressive cognitions than in social phobia patients with depressive cognitions; self-esteem could have different characteristics in the two disorders; self-esteem would be as low in anorexia as in bulimia; 103 eating disorder patients (33 restrictive anorectics, 34 anorectics-bulimics, 36 bulimics) and 26 social phobia patients diagnosed according to DSM IV and ICD-10 criteria have been investigated by the Self-Esteem Inventory of Coopersmith, the Assertiveness Schedule of Rathus, the Fear Survey Schedule of Wolpe (FSS III) and the Beck Depression Inventory (BDI). Patients were free of medication and presented no episode of major depression according to DSM IV criteria. Evaluations took place before any psychotherapy. Self-esteem in eating disorder patients is reduced at the same level as in social phobia patients; 86.1% of the total sample and 84.5% of the eating disorder patients have a very low self-esteem (score 33 in the SEI). Eating disorder patients have significantly higher scores in the Social (p=0.016) and Professional (p=0.0225) sub-scales of the SEI than social phobia patients. Eating disorder patients show higher scores on the Assertiveness Schedule of Rathus (p=0.0013) than social phobia patients. Eating disorder patients disclose higher scores on the BDI (p=0.0003) but eating disorder patients with depressive cognitions do not differ from social phobia patients with depressive cognitions in the level of self-esteem. The FSS III
A Generational Comparison of Social Networking Site Use: The Influence of Age and Social Identity
Barker, Valerie
2012-01-01
An online survey (N = 256) compared social networking site (SNS) use among younger (millennial: 18-29) and older (baby-boomer: 41-64) subscribers focusing on the influence of collective self-esteem and group identity on motives for SNS use. Younger participants reported higher positive collective self-esteem, social networking site use for peer…
Friendships and social interactions of school-aged children with migraine.
Vannatta, K; Getzoff, E A; Gilman, D K; Noll, R B; Gerhardt, C A; Powers, S W; Hershey, A D
2008-07-01
We set out to evaluate the friendships and social behaviour of school-aged children with migraine. Concern exists regarding the impact of paediatric migraine on daily activities and quality of life. We hypothesized that children with migraine would have fewer friends and be identified as more socially sensitive and isolated than comparison peers. Sixty-nine children with migraine participated in a school-based study of social functioning. A comparison sample without migraine included classmates matched for gender, race and age. Children with migraine had fewer friends at school; however, this effect was limited to those in elementary school. Behavioural difficulties were not found. Middle-school students with migraine were identified by peers as displaying higher levels of leadership and popularity than comparison peers. Concern may be warranted about the social functioning of pre-adolescent children with migraine; however, older children with migraine may function as well as or better than their peers.
When tolerance leads to intolerance: accessibility effects on social judgment.
Araya, Tadesse; Ekehammar, Bo
2009-08-01
We investigated the effects of unobtrusively primed constructs that were evocative of tolerance (e.g., tolerant, nonprejudiced) on subsequent task performances and found, contrary to our expectation, contrast effects in the judgment of an ambiguous behavioral description (Study 1 and 2). Suspecting that these results might be the outcome of social-comparison processes, in Study 3, we attempted to corroborate our findings by providing the participants with either an explicit or implicit comparison standard. The results showed that the participants who were provided with the implicit comparison standard evaluated the target behavior as more intolerant as compared to those with the explicit or no comparison standard. The results are discussed in relation to the moderating role of automatic social-comparison processes in the incidence of assimilation and contrast effects and the reduction of prejudice.
Grossen, Michèle; Iannaccone, Antonio; Liengme Bessire, Marie-Jeanne; Perret-Clermont, Anne-Nelly
2010-01-01
In line with the post-Piagetian strand, this article presents a study exploring the role of social comparison with regard to the individual benefits children might gain after a peer interaction session. 52 7-8 year-old children participated in the expenment. The task involved the recognition of right and left on one's own or another's body. The experimental design was a classical pretest-post-test design including an additional session in which the perceptions each child had of hisker own lev...
Economic Comparison and Group Identity: Lessons from India
Xavier Fontaine; Katsunori Yamada
2012-01-01
The caste issue dominates a large part of India's social and political life. Caste shapes one's identity. Furthermore, strong tensions exist between castes. Using subjective well-being data, we assess the role economic comparisons play in this society. We focus on both within and between-castes comparisons. Within-caste comparisons appear to reduce well-being. Comparisons between rival castes are found to decrease well-being three times more. We link these results to two models in which econo...
Social communication deficits: Specific associations with Social Anxiety Disorder.
Halls, Georgia; Cooper, Peter J; Creswell, Cathy
2015-02-01
Social communication deficits are prevalent amongst children with anxiety disorders; however whether they are over-represented specifically among children with Social Anxiety Disorder has not been examined. This study set out to examine social communication deficits among children with Social Anxiety Disorder in comparison to children with other forms of anxiety disorder. Parents of 404 children with a diagnosed anxiety disorder completed the Social Communication Questionnaire (SCQ; Rutter, M., Bailey, A., Lord, C., 2003. The Social Communication Questionnaire - Manual. Western Psychological Services, Los Angeles, CA). Children with a diagnosis of Social Anxiety Disorder (n=262) and anxious children without Social Anxiety Disorder (n=142) were compared on SCQ total and subscale scores and the frequency of participants scoring above clinical cut-offs. Children with Social Anxiety Disorder scored significantly higher than anxious children without Social Anxiety Disorder on the SCQ total (t(352)=4.85, p<.001, d=.55, r=.27), Reciprocal Social Interaction (t(351)=4.73, p<.001, d=.55, r=.27), communication (t(344)=3.62, p<.001, d=.43, r=.21) and repetitive, restrictive and stereotyped behaviors subscales (t(353)=3.15, p=.002, d=.37, r=.18). Furthermore, children with Social Anxiety Disorder were three times more likely to score above clinical cut-offs. The participants were a relatively affluent group of predominantly non-minority status. The social communication difficulties measure relied on parental report which could be influenced by extraneous factors. Treatments for Social Anxiety Disorder may benefit from a specific focus on developing social communication skills. Future research using objective assessments of underlying social communication skills is required. Copyright © 2014 The Authors. Published by Elsevier B.V. All rights reserved.
Content relatedness in the social web based on social explicit semantic analysis
Ntalianis, Klimis; Otterbacher, Jahna; Mastorakis, Nikolaos
2017-06-01
In this paper a novel content relatedness algorithm for social media content is proposed, based on the Explicit Semantic Analysis (ESA) technique. The proposed scheme takes into consideration social interactions. In particular starting from the vector space representation model, similarity is expressed by a summation of term weight products. In this paper, term weights are estimated by a social computing method, where the strength of each term is calculated by the attention the terms receives. For this reason each post is split into two parts, title and comments area, while attention is defined by the number of social interactions such as likes and shares. The overall approach is named Social Explicit Semantic Analysis. Experimental results on real data show the advantages and limitations of the proposed approach, while an initial comparison between ESA and S-ESA is very promising.
Vargas-Salfate, Salvador; Paez, Dario; Liu, James H; Pratto, Felicia; Gil de Zúñiga, Homero
2018-07-01
This study tests specific competing hypotheses from social dominance theory/realistic conflict theory (RCT) versus system justification theory about the role of social status. In particular, it examines whether system justification belief and effects are stronger among people with low socioeconomic status, and in less socially developed and unequal nations than among better-off people and countries. A cross-national survey was carried out in 19 nations from the Americas, Western and Eastern Europe, Asia, and Oceania using representative online samples ( N = 14,936, 50.15% women, M age = 41.61 years). At the individual level, system justification beliefs, right-wing authoritarianism, social dominance orientation, national identification, sociopolitical conservatism, sex, age, and social status were measured. At the national level, the human development index and the Gini index were used. Multilevel analyses performed indicated that results fit better with the social dominance/RCT approach, as system justification was higher in high-status and developed nations; further, associations between legitimizing ideologies and system justification were stronger among high-status people.
Comparative analysis of e-commerce and social media based trading in Indonesia
Sfenrianto; Wang, Gunawan; Abdul, Halim; Nurul, Fajar Ahmad
2017-09-01
The growth of social media and e-commerce recently has caused the unique phenomenon in Indonesia. That phenomenon is online trading using social media like Facebook, Blackberry messenger, Whatsapp, etc. This phenomenon attracts the researcher to know how to use social media to trade, not using e-commerce marketplace like Lazada, Tokopedia, Bukalapak. The aim of the research is to know the profiling of product and buyer in e-commerce and social media and to do the comparison of that 2 channels based on eight purchase decision factors. Research conducted by taking surveys involving 306 respondents. For product and buyer profiling, this study identifies profile base on sex, education, area, jobs and online trading channel. For e-commerce & social media comparison, this study use 8 factors made based on previous related studies. Finding related purchase decision comparisons are: online trust and usability are the factors influencing people to buy the product via e-commerce. While, marketing mix, and interactivity are the factors why people buy the product via social media.
International Nuclear Information System (INIS)
Jiang, Bo; Farid, Amro M.; Youcef-Toumi, Kamal
2015-01-01
Highlights: • We compare two demand side management in a day-ahead electricity wholesale market. • We develop and reconcile social welfare & industrial DSM mathematical models. • We show the industrial netload has an additional forecast quantity of baseline. • We analytically and numerically show the model equivalence with accurate baseline. • We numerically demonstrate the baseline errors lead to higher and costlier dispatch. - Abstract: The intermittent nature of renewable energy has been discussed in the context of the operational challenges that it brings to electrical grid reliability. Demand side management (DSM) with its ability to allow customers to adjust electricity consumption in response to market signals has often been recognized as an efficient way to mitigate the variable effects of renewable energy as well as to increase system efficiency and reduce system costs. However, the academic & industrial literature have taken divergent approaches to DSM implementation. While the popular approach among academia adopts a social welfare maximization formulation, the industrial practice compensates customers according to their load reduction from a predefined electricity consumption baseline that would have occurred without DSM. This paper rigorously compares these two different approaches in a day-ahead wholesale market context analytically and in a test case using the same system configuration and mathematical formalism. The comparison of the two models showed that a proper reconciliation of the two models might make them mitigate the stochastic netload in fundamentally the same way, but only under very specific conditions which are rarely met in practice. While the social welfare model uses a stochastic net load composed of two terms, the industrial DSM model uses a stochastic net load composed of three terms including the additional baseline term. DSM participants are likely to manipulate the baseline in order to receive greater financial
On sampling social networking services
Wang, Baiyang
2012-01-01
This article aims at summarizing the existing methods for sampling social networking services and proposing a faster confidence interval for related sampling methods. It also includes comparisons of common network sampling techniques.
Glover, McKinley; Choy, Garry; Boland, Giles W; Saini, Sanjay; Prabhakar, Anand M
2015-05-01
This study assesses the prevalence of use of the most commonly used social media sites among private radiology groups (PRGs) and academic radiology departments (ARDs). The 50 largest PRGs and the 50 ARDs with the highest level of funding from the National Institutes of Health were assessed for presence of a radiology-specific social media account on Facebook, Twitter, Instagram, Pinterest, YouTube, and LinkedIn. Measures of organizational activity and end-user activity were collected, including the number of posts and followers, as appropriate; between-group comparisons were performed. PRGs adopted Facebook 12 months earlier (P = .02) and Twitter 18 months earlier (P = .02) than did ARDs. A total of 76% of PRGs maintained ≥1 account on the social media sites included in the study, compared with 28% of ARDs (P Instagram, 2%. The prevalence of radiology-specific social media accounts for ARDs was: Facebook, 18%; LinkedIn, 0%; Twitter, 24%; YouTube, 6%; Pinterest, 0%; and Instagram, 0%. There was no significant difference between ARDs and PRGs in measures of end-user or organizational activity on Facebook or Twitter. Use of social media in health care is emerging as mainstream, with PRGs being early adopters of Facebook and Twitter in comparison with ARDs. Competitive environments and institutional policies may be strong factors that influence how social media is used by radiologists at the group and department levels. Copyright © 2015 American College of Radiology. Published by Elsevier Inc. All rights reserved.
[Prevalence of domestic violence in pregnant women from 20 to 35 years in a family medicine unit].
Cervantes-Sánchez, Paulina; Delgado-Quiñones, Edna Gabriela; Nuño-Donlucas, María Olimpia; Sahagún-Cuevas, Minerva Natalia; Hernández-Calderón, Jéssica; Ramírez-Ramos, Joana Kareli
2016-01-01
Violence against women is one of the most important health problems in recent times. In Mexico, it is reported a prevalence of 21.5% during pregnancy; however, it seems to be underdiagnosed. The objective is to determine the prevalence of domestic violence in pregnant women from 20 to 35 years at the Unidad de Medicina Familiar (UMF) 171 of the Instituto Mexicano del Seguro Social (IMSS). It was performed a cross-sectional descriptive study with a sample of 102 pregnant women to which we applied a sociodemographic questionnaire and the Severity of Violence Against Women Scale (ISVP). 19 women (18.6%) suffered violence; of these, 10.8% (n=11) experienced physical violence, 5.9% (n=6) psychological violence, and 4% (n=4) sexual violence. We used chi squared between the variable violence and each of the sociodemographic factors: 52.6% women (n=10) were married (p=0.005), 26.3% (n=5) had a bachelor's degree (p=0.074), 57.8% (n=11) had planned their pregnancy, 47.3% (n=9) were in the third trimester of pregnancy, and 78.95% (n=15) worked as laborers, shop-keepers or professionals (p=0.016). Among pregnant women belonging in UMF 171 of IMSS, domestic violence is a problem with a prevalence of 18.6%.
[Lower extremity amputation rates in diabetic patients].
Cisneros-González, Nelly; Ascencio-Montiel, Iván Jesús; Libreros-Bango, Vita Norma; Rodríguez-Vázquez, Héctor; Campos-Hernández, Ángel; Dávila-Torres, Javier; Kumate-Rodríguez, Jesús; Borja-Aburto, Víctor Hugo
2016-01-01
The lower extremity amputations diminish the quality of life of patients with Diabetes Mellitus (DM). The aim of this study was to describe the lower extremity amputation rates in subjects with DM in the Mexican Social Security Institute (IMSS), comparing 2004 and 2013. A comparative cross-sectional study was done. Amputations were identified from the hospital records of System of Medical Statistics (DataMart). The DM patient census was obtained from the System of Integral Attention to Health. Major and minor amputations rates were expressed per 100,000 DM patients. We observed 2 334 340 and 3 416 643 DM patients during 2004 and 2013, respectively. The average age at the time of the amputation was similar in 2004 and 2013 (61.7 and 65.6 years old for minor and major amputations respectively). The major amputations rates were 100.9 and 111.1 per 100 000 subjects with DM in during 2004 and 2013 (p = 0.001); while minor amputations rates were 168.8 and 162.5 per 100 000 subjects with DM in during 2004 and 2013 respectively (p = 0.069). The lower extremity amputations rates at IMSS are very high compared with that reported in developed countries. The major amputations rate increased in 2013 compared with 2004.
Basic Social-Economic Factors Modelling Customer’s Psychological Behaviour
Directory of Open Access Journals (Sweden)
Ivan Krastev
2013-04-01
Full Text Available This paper deals with some social and economic factors influencing on customer’s behaviour – such as social class, social-economic status,occupation, education, income, referent groups, family, gender roles and marketing. Some comparisons are made between some factorsinfluencing on customer’s behaviour in the U.S. and in Bulgaria.
Características clínico-epidemiológicas de pacientes con cólera en la ciudad de México
Vilchis-Guizar Agustina Elena; Uribe-Márquez Samuel; Pérez-Sánchez Patricia Leonor
1999-01-01
OBJETIVO: Comparar las características clínico-epidemiológicas de enfermos de cólera (casos) con las de pacientes con diarrea por otra causa (no casos), atendidos en las unidades médicas de la Delegación 2 Noreste del Distrito Federal, del Instituto Mexicano del Seguro Social (IMSS). MATERIAL Y MÉTODOS: Se realizó un estudio transversal analítico y se utilizaron datos de 4 952 notificaciones reunidas entre 1995 y 1998 a través del formato oficial "Hoja de notificación inmediata de casos de có...
Agustina Elena Vilchis-Guizar; Samuel Uribe-Márquez; Patricia Leonor Pérez-Sánchez
1999-01-01
OBJETIVO: Comparar las características clínico-epidemiológicas de enfermos de cólera (casos) con las de pacientes con diarrea por otra causa (no casos), atendidos en las unidades médicas de la Delegación 2 Noreste del Distrito Federal, del Instituto Mexicano del Seguro Social (IMSS). MATERIAL Y MÉTODOS: Se realizó un estudio transversal analítico y se utilizaron datos de 4 952 notificaciones reunidas entre 1995 y 1998 a través del formato oficial "Hoja de notificación inmediata de casos de có...
Suffering by comparison: Twitter users' reactions to the Victoria's Secret Fashion Show.
Chrisler, Joan C; Fung, Kaitlin T; Lopez, Alexandra M; Gorman, Jennifer A
2013-09-01
Social comparison theory suggests that evaluating the self in comparison with others (e.g., peers, celebrities, models) can influence body image. Experimental studies that have tested effects of viewing idealized images in the media often show that women feel worse about themselves after seeing images that illustrate the beauty ideal. Twitter presents a naturally occurring opportunity to study viewers' reactions. An analysis was conducted of 977 tweets sent immediately before and during the 2011 Victoria's Secret Fashion Show that reference the show. Although the majority were idiosyncratic remarks, many tweets contain evidence of upward social comparisons to the fashion models. There were tweets about body image, eating disorders, weight, desires for food or alcohol, and thoughts about self-harm. The results support social comparison theory, and suggest that vulnerable viewers could experience negative affect, or even engage in harmful behaviors, during or after viewing the show or others like it. Copyright © 2013 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Jingwen Zhang, PhD
2016-12-01
Full Text Available To identify what features of online social networks can increase physical activity, we conducted a 4-arm randomized controlled trial in 2014 in Philadelphia, PA. Students (n = 790, mean age = 25.2 at an university were randomly assigned to one of four conditions composed of either supportive or competitive relationships and either with individual or team incentives for attending exercise classes. The social comparison condition placed participants into 6-person competitive networks with individual incentives. The social support condition placed participants into 6-person teams with team incentives. The combined condition with both supportive and competitive relationships placed participants into 6-person teams, where participants could compare their team's performance to 5 other teams' performances. The control condition only allowed participants to attend classes with individual incentives. Rewards were based on the total number of classes attended by an individual, or the average number of classes attended by the members of a team. The outcome was the number of classes that participants attended. Data were analyzed using multilevel models in 2014. The mean attendance numbers per week were 35.7, 38.5, 20.3, and 16.8 in the social comparison, the combined, the control, and the social support conditions. Attendance numbers were 90% higher in the social comparison and the combined conditions (mean = 1.9, SE = 0.2 in contrast to the two conditions without comparison (mean = 1.0, SE = 0.2 (p = 0.003. Social comparison was more effective for increasing physical activity than social support and its effects did not depend on individual or team incentives.
Melki, Jad P; Hitti, Eveline A; Oghia, Michael J; Mufarrij, Afif A
2015-01-01
This study examined the association between anabolic-androgenic steroid (AAS) use and dominant sociocultural factors, specifically media exposure to idealized images of male muscularity, and mediated social comparison trends among a sample of young Arab adults. The study found evidence that participants more exposed to content that promotes muscularity and those who idealize images of muscularity and perceive them as motivators for achieving muscularity are more likely to be AAS users. It also found that a significant percentage of participants used at least one kind of dietary supplement and that the level of AAS use among health club participants indicates it is a significant public health problem in Lebanon. The study suggests that dealing with this problem requires a unique approach, beyond the typical awareness of risks strategy, since some users were well aware of the risks yet continue to use AAS, and their motivations pertain more to body image and sexuality. A stronger approach that utilizes critical media literacy teaching that ingrains these issues into school and university curricula will have a more lasting impact.
Berry, Clio; Greenwood, Kathryn
2017-09-19
Social disability in youth is an important precursor of long-term social and mental health problems. Social inclusion is a key policy driver and fits well within a new paradigm of health and well-being rather than illness-oriented services, yet little is known about social inclusion and its facilitators for "healthy" young people. We present a novel exploratory structural analysis of social inclusion using measures from 387 14- to 36-year-olds. Our model represents social inclusion as comprising social activity and community belonging, with both domains predicted by hopeful and dysfunctional self-beliefs but hopefulness more uniquely predicting social inclusion in adolescence. We conclude that social inclusion can be modeled for meaningful comparison across spectra of development, mental health, and functioning.
Pugliese, Cara E.; White, Bradley A.; White, Susan W.; Ollendick, Thomas H.
2013-01-01
The present study examined the degree to which social anxiety predicts aggression in children with high functioning autism spectrum disorders (HFASD, n = 20) compared to children with Social Anxiety Disorder (SAD, n = 20) or with Oppositional Defiant Disorder or Conduct Disorder (ODD/CD, n = 20). As predicted, children with HFASD reported levels…
Mindsets and social comparison: Being aware of the competitor
Directory of Open Access Journals (Sweden)
ROSA MARIA PUCA
2007-03-01
Full Text Available The mindset theory posits that people have less favorable beliefs while deliberating on actions or goals than while planning and implementing them. This is thought to be a self-regulatory mechanism that helps people choose reasonable goals, on one hand, and persist in goal pursuit, on the other. In the present experiment we tested the hypothesis that the beliefs of implemental participants differ from those of deliberative ones only in case that favorable views would not set them up for failure and disappointment. Participants in a deliberative or in an implemental mindset were asked to compare with two other persons with respect to a set of achievement-related activities. They were also told that they would have to compete with one of these persons in a motor-skills task. It could be shown that the participants generally tended to rate the comparison targets as being worse off. As in former experiments, this tendency was, however, reduced in deliberative participants. In addition, it was reduced in implemental participants when they expected to compete with the comparison target later on. Implemental participants did thus have more favorable views than deliberative ones only if they had not to compete with the comparison target. This seems to be a good strategy to enhance the feelings of one's own competence without running the risk of failure and embarrassment.
Directory of Open Access Journals (Sweden)
Ivanyos János
2016-12-01
Full Text Available The question is how the global and local economic actors’ innovation-based local social and environmental objectives and results can modify the social cohesion strategies, how the disparities in economic and social development can be measured and evaluated at regional level in addition to a comparison across countries. We have seen that any one indicator in itself is not enough since it does not provide sufficient explanation for either the development disparities or their reasons. Anyway, in addition to GDP per capita, it is worth applying - and it is important to apply - such indicators as SPI and Well-Being, and various indices of social progress.
Institute of Scientific and Technical Information of China (English)
郑晓莹; 彭泗清; 彭璐珞
2015-01-01
Social comparison is the process of evaluating oneself in comparison with others. People actively or passively, consciously or nonconsciously engage in social comparison. Upward comparison---comparing to better off others, engenders psychological inferiority, while downward comparison---comparing to worse off others, elicits psychological superiority. The purpose of the current research was to explore how such psychological inferiority and superiority information resulted from social comparison would influence others-oriented behavior, namely, prosocial behavior. We postulated that downward comparison could increase people’s empathy towards others, and thus would promote prosocial behavior. Two studies were conducted to test the hypotheses. In Study 1, undergraduates were randomly assigned to the upward comparison, the downward comparison, and the control conditions. In the upward (downward) comparison condition, participants were asked to compare their academic performance with the classmate whose academic performance was ranked the first place (last place) in their major. In the control condition, information aboutacademic performance or comparison was not mentioned. After making the comparison, participants indicated their willingness to help in four hypotheticalscenarios. Empathy, self evaluation, and emotion were measured. In Study 2, we used donation intention as an indicator of prosocial behavior. Rather than asking participants to consciously make upward or downward comparison as in Study1, we manipulated social comparisonbygivingfalse intelligence test feedback. All participants completed a subset of Raven intelligence test. Participants in the upward comparison condition were told that their performance in the test was ranked the bottom 10% of our population. Participants in the downward comparison condition were told their rank was in the top 10%. Those in the control condition did not receive any feedback about the test score. Then we asked
Social complexity parallels vocal complexity: a comparison of three nonhuman primate species
Directory of Open Access Journals (Sweden)
Hélène eBOUCHET
2013-07-01
Full Text Available Social factors play a key role in the structuring of vocal repertoires at the individual level, notably in nonhuman primates. Some authors suggested that, at the species level too, social life may have driven the evolution of communicative complexity, but this has rarely been empirically tested. Here, we use a comparative approach to address this issue. We investigated vocal variability, at both the call type and the repertoire levels, in three forest-dwelling species of Cercopithecinae presenting striking differences in their social systems, in terms of social organization as well as social structure. We collected female call recordings from twelve De Brazza’s monkeys (Cercopithecus neglectus, six Campbell’s monkeys (Cercopithecus campbelli and seven red-capped mangabeys (Cercocebus torquatus housed in similar conditions. First, we noted that the level of acoustic variability and individual distinctiveness found in several call types was related to their importance in social functioning. Contact calls, essential to intra-group cohesion, were the most individually distinctive regardless of the species, while threat calls were more structurally variable in mangabeys, the most ‘despotic’ of our three species. Second, we found a parallel between the degree of complexity of the species’ social structure and the size, diversity, and usage of its vocal repertoire. Mangabeys (most complex social structure called twice as often as guenons and displayed the largest and most complex repertoire. De Brazza’s monkeys (simplest social structure displayed the smallest and simplest repertoire. Campbell’s monkeys displayed an intermediate pattern. Providing evidence of higher levels of vocal variability in species presenting a more complex social system, our results are in line with the theory of a social-vocal coevolution of communicative abilities, opening new perspectives for comparative research on the evolution of communication systems in
Deficits in social cognition and response flexibility in pediatric bipolar disorder.
McClure, Erin B; Treland, Julia E; Snow, Joseph; Schmajuk, Mariana; Dickstein, Daniel P; Towbin, Kenneth E; Charney, Dennis S; Pine, Daniel S; Leibenluft, Ellen
2005-09-01
Little is known about neuropsychological and social-cognitive function in patients with pediatric bipolar disorder. Identification of specific deficits and strengths that characterize pediatric bipolar disorder would facilitate advances in diagnosis, treatment, and research on pathophysiology. The purpose of this study was to test the hypothesis that youths with bipolar disorder would perform more poorly than matched healthy comparison subjects on measures of social cognition, motor inhibition, and response flexibility. Forty outpatients with pediatric bipolar disorder and 22 comparison subjects (no differences in age, gender, and IQ) completed measures of social cognition (the pragmatic judgment subtest of the Comprehensive Assessment of Spoken Language, facial expression recognition subtests of the Diagnostic Analysis of Nonverbal Accuracy Scale, the oral expression subtest of the Test of Language Competence), inhibition and response flexibility (stop and stop-change tasks), and motor inhibition (continuous performance tasks). Pediatric bipolar disorder patients performed more poorly than comparison subjects on social-cognitive measures (pragmatic judgment of language, facial expression recognition) and on a task requiring response flexibility. These deficits were present in euthymic patients. Differences between patients and comparison subjects could not be attributed to comorbid attention deficit hyperactivity disorder. Findings of impaired social cognition and response flexibility in youths with pediatric bipolar disorder suggest continuity between pediatric bipolar disorder and adult bipolar disorder. These findings provide a foundation for neurocognitive research designed to identify the neural mechanisms underlying these deficits.
DEFF Research Database (Denmark)
Yang, Cheng; Chaudhuri, Atanu; Farooq, Sami
2016-01-01
Based on the data obtained from the sixth version of International Manufacturing Strategy Survey (IMSS VI), this paper explores the relationships at the level of plant between (1) inter-plant coordination and operational performance, and (2) between inter-plant coordination and internal/external ......Based on the data obtained from the sixth version of International Manufacturing Strategy Survey (IMSS VI), this paper explores the relationships at the level of plant between (1) inter-plant coordination and operational performance, and (2) between inter-plant coordination and internal...
Theory of mind impairments in social anxiety disorder.
Hezel, Dianne M; McNally, Richard J
2014-07-01
Social anxiety disorder (SAD) is a common psychiatric disorder characterized by a persistent, excessive fear and avoidance of social and performance situations. Research on cognitive biases indicates individuals with SAD may lack an accurate view of how they are perceived by others, especially in social situations when they allocate important attentional resources to monitoring their own actions as well as external threat. In the present study, we explored whether socially anxious individuals also have impairments in theory of mind (ToM), or the ability to comprehend others' mental states, including emotions, beliefs, and intentions. Forty socially anxious and 40 non-socially-anxious comparison participants completed two ToM tasks: the Reading the Mind in the Eyes and the Movie for the Assessment of Social Cognition. Participants with SAD performed worse on ToM tasks than did non-socially-anxious participants. Relative to comparison participants, those with SAD were more likely to attribute more intense emotions and greater meaning to what others were thinking and feeling. These group differences were not due to interpretation bias. The ToM impairments in people with SAD are in the opposite direction of those in people with autism spectrum conditions whose inferences about the mental states of other people are absent or very limited. This association between SAD and ToM may have important implications for our understanding of both the maintenance and treatment of social anxiety disorder. Copyright © 2014. Published by Elsevier Ltd.
Predictors of Mobile Phone and Social Networking Site Dependency in Adulthood.
Burnell, Kaitlyn; Kuther, Tara L
2016-10-01
The present study explored social and psychological predictors of social networking site (SNS) and mobile phone dependency in a sample of emerging adults (ages 18-25, n = 159, M = 21.87, SD = 2.08) and young adults (ages 26-40, n = 97, M = 31.21, SD = 4.11). Path analysis revealed that SNS dependency mediated the relationship of social comparison, SNS support, and impulsivity on mobile phone dependency. Impulsivity also showed direct links to mobile phone dependency. The present findings suggest that individuals with a strong orientation toward social comparison, who perceive a strong sense of support through SNS networks, or who show difficulty with self-regulation may be at risk for SNS and mobile phone dependency.
Do-gooder derogation in children: The social costs of generosity
Directory of Open Access Journals (Sweden)
Arber eTasimi
2015-07-01
Full Text Available Generosity is greatly valued and admired, but can it sometimes be unappealing? The current study investigated 8- to 10-year-old children’s (N=128 preference for generous individuals, and the effects of social comparison on their preferences. In Experiment 1, children showed a strong preference for a generous to a stingy child; however, this preference was significantly reduced in a situation that afforded children a comparison of their own (lesser generosity to that of another child. In Experiment 2, children’s liking for a generous individual was not reduced when that individual was an adult, suggesting that similarity in age influences whether a child engages in social comparison. These findings indicate that, by middle childhood, coming up short in comparison with a peer can decrease one’s liking for a generous individual.
Social emotion recognition, social functioning, and attempted suicide in late-life depression.
Szanto, Katalin; Dombrovski, Alexandre Y; Sahakian, Barbara J; Mulsant, Benoit H; Houck, Patricia R; Reynolds, Charles F; Clark, Luke
2012-03-01
: Lack of feeling connected and poor social problem solving have been described in suicide attempters. However, cognitive substrates of this apparent social impairment in suicide attempters remain unknown. One possible deficit, the inability to recognize others' complex emotional states has been observed not only in disorders characterized by prominent social deficits (autism-spectrum disorders and frontotemporal dementia) but also in depression and normal aging. This study assessed the relationship between social emotion recognition, problem solving, social functioning, and attempted suicide in late-life depression. : There were 90 participants: 24 older depressed suicide attempters, 38 nonsuicidal depressed elders, and 28 comparison subjects with no psychiatric history. We compared performance on the Reading the Mind in the Eyes test and measures of social networks, social support, social problem solving, and chronic interpersonal difficulties in these three groups. : Suicide attempters committed significantly more errors in social emotion recognition and showed poorer global cognitive performance than elders with no psychiatric history. Attempters had restricted social networks: they were less likely to talk to their children, had fewer close friends, and did not engage in volunteer activities, compared to nonsuicidal depressed elders and those with no psychiatric history. They also reported a pattern of struggle against others and hostility in relationships, felt a lack of social support, perceived social problems as impossible to resolve, and displayed a careless/impulsive approach to problems. : Suicide attempts in depressed elders were associated with poor social problem solving, constricted social networks, and disruptive interpersonal relationships. Impaired social emotion recognition in the suicide attempter group was related.
Benefits of social vs. non-social feedback on learning and generosity. Results from the Tipping Game
Directory of Open Access Journals (Sweden)
Matteo eColombo
2014-10-01
Full Text Available Although much work has recently been directed at understanding social decision-making, relatively little is known about how different types of feedback impact adaptive changes in social behavior. To address this issue quantitatively, we designed a novel associative learning task called the Tipping Game, in which participants had to learn a social norm of tipping in restaurants. Participants were found to make more generous decisions from reward feedback in the form of facial expressions, in comparison to reward feedback in the form of symbols such as ticks and crosses. Furthermore, more participants displayed learning in the condition where they received social reward feedback than participants in the non-social condition. Modeling results showed that the pattern of performance displayed by participants receiving social reward feedback could be explained by a lower sensitivity to economic costs.
Social relationships as a major determinant in the valuation of health states.
Frick, Ulrich; Irving, Hyacinth; Rehm, Jürgen
2012-03-01
To empirically determine the impact of the capacity to sustain social relationships on valuing health states. 68 clinical experts conducted a health state valuation exercise in five sites using pairwise comparison, ranking, and person trade-off as elicitation methods. 23,840 pairwise comparisons of a total of 379 health states were analyzed by conditional logistic regression. Social relationships had a clear monotonic association with perceived disability: the more limited the capacity to sustain social relationships, the more disabling the resulting health state valuations. The highest level of limitations with respect to social relationships was associated with slightly lower impact on health state valuations compared to the highest level of limitations in physical functioning. Social relationships showed an independent contribution to health state valuations and should be included in health state measures.
Social and economic impact of nuclear electricity in Britain
International Nuclear Information System (INIS)
White, D.
1985-01-01
The paper concerns a study of the social and economic impact of nuclear energy in the U.K., undertaken by an independent writer. Fears and risks; nuclear power is proven; cost comparisons; the nuclear industry; social impact and public relations; are all discussed. (U.K.)
The Commercial Utilization of Social Networks
Adlaf, Petr
2011-01-01
The presented bachelor's thesis deals with advertisement. It answers the question of what advertisement is, why firms use advertisement and what its benefits are. It concentrates especially on Internet advertisement presented through social networks. These social networks have come to occupy a significant position on the Internet during the last five years and offer new possibilities in terms of creating advertising campaigns (Hypertargeting). The thesis presents the division and comparison o...
Quality assurance in individual monitoring: A summary of the EURADOS survey 2012
International Nuclear Information System (INIS)
Gilvin, P.; Alves, J.G.; Cherestes, C.; Dijk, J.W.E. van; Lehtinen, M.; Rossi, F.; Vekic, B.
2014-01-01
EURADOS Working Group 2 (WG2) on Harmonization of Individual Monitoring is a network of individual monitoring services (IMSs) that aims to promote quality, technical excellence and good practice in European Member States. To help to improve quality, in 2012 EURADOS WG2 carried out a survey of IMSs in Europe. The survey was sent to about 170 IMS and included questions on: the use of formal quality assurance (QA) standards, QA in dosimetry, matters of practice, and common sources of error. The present paper summarises the main findings of the survey, and compares them with those of an earlier study (2003). The survey found that profile of QA is high amongst the responding IMSs, and that most are following good practice. A majority of services comply with formal quality standards and good attention is paid to traceability, method validation and proficiency testing. There are some areas where lessons can be learned, for example in the assessment of measurement uncertainty; and it remains very instructive to see what the main causes of error are for IMSs in general. - Highlights: • EURADOS has surveyed QA practice amongst European dosimetry services. • The survey was comprehensive, covering most of the monitored workers in Europe. • The profile of QA among IMS is reassuringly high. • Many services follow formal QA standards, e.g. ISO 17025. • But there are still some lessons that can be learned
Social orientations and adolescent health behaviours in Hungary.
Piko, Bettina F; Skultéti, Dóra; Luszczynska, Aleksandra; Gibbons, Frederick X
2010-02-01
Adolescent health behaviours are influenced by a variety of social factors, including social orientations, such as social comparison or competitiveness. The main goal of the present study was to investigate the role that these social orientations might play in health behaviours (both health-impairing and health-promoting). Data were collected from high school students (N = 548; ages 14-20 years; 39.9% males) in two counties of the Southern Plain Region of Hungary. The self-administered questionnaires contained items on sociodemographics, such as age, sex, parental schooling, and socioeconomic status (SES) self-assessment; school achievement, health behaviours, competitiveness and social comparison. Multiple regression analyses suggest that those who scored higher on competitiveness engaged in more substance use, a pattern that was not present for health-promoting behaviours. Social comparison, however, was associated with lower levels of substance use. In addition, in relation to health-impairing behaviours, both competitiveness and social comparison interacted with sex; both social orientation variables proved to be more important for boys. Social comparison also contributed to health-promoting behaviours among boys. Findings support the idea that the role of social orientations, such as competitiveness and social comparison, can be quite different depending on sex and the nature of the health behaviour. While competitiveness may act as a risk factor for substance use among boys, social comparison may act as a protection. It appears that social orientations play less of a role in girls' health-related behaviours. More focus is needed on gender differences in influences on adolescents' health-related behaviours. Les comportements de santé des adolescents sont influencés par une variété de facteurs sociaux, incluant les orientations sociales telles que la comparaison sociale ou la compétitivité. Le but principal de la présente étude était d'examiner le r
Self-efficacy, personal goals, social comparison and scientific productivity.
Vrugt, A.J.; Koenis, M.
2002-01-01
Investigated the extent to which perceived self-efficacy, personal goals, and upward comparison predict the scientific productivity of academic staff members. 123 academic staff employed at different Dutch universities answered written questions about their judgment of self-efficacy in the area of
Directory of Open Access Journals (Sweden)
Marissa O’Neill
2015-03-01
Full Text Available As definitions of “family” have evolved in the US over the past several decades, so too has child welfare agencies’ need to provide appropriate and meaningful services. This article discusses the findings and conclusions drawn from a case study involving two different types of social work agencies: Native American child welfare and not- for-profit family services. Within this discussion, the authors use their findings from case study vignette focus groups to explore how the definitions of family impact the provision of services.At each agency, participants addressed issues surrounding domestic violence, teen pregnancy, child welfare involvement and the inclusion of extended families as part of client’s support network. By focusing on the changing social concept of “family,” the study’s respondents discussed the need for direct practice using broader, more inclusive approaches to family and child welfare. Through the comparison of two agencies which serve different demographics, the article makes clear that further study is needed, and a wider scope must be considered, in order to adequately serve America’s expanding population in need of family services, direct practice and extended support.
A study on the social risk comparison for various power systems: focusing on the social acceptance
International Nuclear Information System (INIS)
Jung, Young Soo; Kim, Young Pyung; Lee, Jae Eun
2007-02-01
The objective of this study is to develop measurement indices for social risk acceptance of various power systems(nuclear, coal, oil, LNG, hydro, wind, solar) and compare them empirically. In order to measure social risk acceptance of various power systems, four measurement fields and twelve measurement indices were developed. Measurement areas contains rationality, emotion, trust, communication. Each measurement field has two or three measurement indices. Rationality field has indices of amount of knowledge, recognition of technological utility, risk controllability. Emotion field has indices of experiences, risk recognition. Trust field has indices of openness, sincerity, willingness of sharing knowledge and experiences. Communication field has indices of scientist's roll, media's roll, public relations. Based on these measurement field and indices, this study made questionnaire and surveyed citizens to compare deciding factors of social acceptance on risk of various power systems. Questionnaire respondents were sampled from six different groups, including power system specialists, highschool students, university students, general citizen, professors and environmental NGOs. The methodologies used to analyze the deciding factors of social acceptance on risk of various power systems were frequency analysis, cross-tab analysis, t-test and ANOVA analysis. AHP method was used to analyze power system specialists' perception on relative severance and priority among measurement fields and indices
A study on the social risk comparison for various power systems: focusing on the social acceptance
Energy Technology Data Exchange (ETDEWEB)
Jung, Young Soo [Myongji Univ., Seoul (Korea, Republic of); Kim, Young Pyung [Korea Univ, Seoul (Korea, Republic of); Lee, Jae Eun [Chungbuk Nat. Univ., Cheongju (Korea, Republic of)
2007-02-15
The objective of this study is to develop measurement indices for social risk acceptance of various power systems(nuclear, coal, oil, LNG, hydro, wind, solar) and compare them empirically. In order to measure social risk acceptance of various power systems, four measurement fields and twelve measurement indices were developed. Measurement areas contains rationality, emotion, trust, communication. Each measurement field has two or three measurement indices. Rationality field has indices of amount of knowledge, recognition of technological utility, risk controllability. Emotion field has indices of experiences, risk recognition. Trust field has indices of openness, sincerity, willingness of sharing knowledge and experiences. Communication field has indices of scientist's roll, media's roll, public relations. Based on these measurement field and indices, this study made questionnaire and surveyed citizens to compare deciding factors of social acceptance on risk of various power systems. Questionnaire respondents were sampled from six different groups, including power system specialists, highschool students, university students, general citizen, professors and environmental NGOs. The methodologies used to analyze the deciding factors of social acceptance on risk of various power systems were frequency analysis, cross-tab analysis, t-test and ANOVA analysis. AHP method was used to analyze power system specialists' perception on relative severance and priority among measurement fields and indices.
Lippold, T; Burns, J
2009-05-01
Social support has been identified as a major protective factor in preventing mental health problems and also as a major contributor to quality of life. People with intellectual disabilities (ID) have been identified as having limited social support structures. Interventions have been focused on promoting their social presence and integration. However, previous studies have shown that this does not always lead to the formation of social relationships. To date few studies have looked at how having an ID leads to impoverished social networks. This study aimed to do this by contrasting the social relationships of people with physical disabilities (PD) and people with ID. Two groups of participants were recruited; 30 people with mild ID and 17 people with PD. Social and functional support networks were assessed, in addition to life experiences. Between and within group differences were then explored statistically. Adults with ID had more restricted social networks than PD, despite being involved in more activities. Social support for adults with ID was mainly provided by family and carers and few relationships with non-disabled people were identified. In contrast adults with PD had larger social networks than had been reported in the mainstream literature and had a balance of relationships with disabled and non-disabled people. The results suggest that there are additional processes attached to having an ID, which lead to continued impoverished lifestyles. The findings also endorse other work that suggests being physically integrated and engaged in a wide range of activities does not guarantee good social and emotional support.
Fardouly, Jasmine; Diedrichs, Phillippa C; Vartanian, Lenny R; Halliwell, Emma
2015-03-01
The present study experimentally investigated the effect of Facebook usage on women's mood and body image, whether these effects differ from an online fashion magazine, and whether appearance comparison tendency moderates any of these effects. Female participants (N=112) were randomly assigned to spend 10min browsing their Facebook account, a magazine website, or an appearance-neutral control website before completing state measures of mood, body dissatisfaction, and appearance discrepancies (weight-related, and face, hair, and skin-related). Participants also completed a trait measure of appearance comparison tendency. Participants who spent time on Facebook reported being in a more negative mood than those who spent time on the control website. Furthermore, women high in appearance comparison tendency reported more facial, hair, and skin-related discrepancies after Facebook exposure than exposure to the control website. Given its popularity, more research is needed to better understand the impact that Facebook has on appearance concerns. Copyright © 2014 Elsevier Ltd. All rights reserved.
The Social Meaning of Leisure in Uganda and America.
Crandall, Rich; Thompson, Richard W.
1978-01-01
This paper analyzes cross-culturally the importance of social contact for leisure. The general findings of considerable similarity in evaluating preferences and the importance of social considerations provide a basis for preliminary comparisons and suggest that similar factors can affect leisure preferences in different cultural settings.…
Nuclear energy and social costs
International Nuclear Information System (INIS)
Ellens, S.H.
1975-01-01
The author introduces a new concept under the name 'social costs', defining it more or less as that which society is prepared to pay to solve the risks taken when a new technological system is introduced into that society. Social costs are the result of a complex of advantages and disadvantages inherent to a system. Applying this principle, a comparison is given of the health hazards involved in power generation by nuclear power plants and plants working on natural gas, oil or coal
DEFF Research Database (Denmark)
Yang, Cheng; Chaudhuri, Atanu; Farooq, Sami
2016-01-01
Purpose The objective of this paper is to investigate the relationships at the level of plant in a manufacturing network, labelled as networked plant in the paper, between (1) inter-plant coordination and operational performance, (2) supply chain integration (SCI) and operational performance......, and (3) inter-plant coordination and SCI. Design/methodology/approach This paper is developed based on the data obtained from the sixth version of International Manufacturing Strategy Survey (IMSS VI). Specifically, this paper uses a subset of the IMSS VI data set from the 606 plants that identified...
International Nuclear Information System (INIS)
Gilvin, P.J.; Gibbens, N.J.; Baker, S.T.
2016-01-01
Many individual monitoring services (IMSs) have long experience in delivering high-quality dosimetry, and many follow rigorous quality assurance (QA) procedures. Typically, these procedures have been developed through experience and are highly effective in maintaining high-quality dose measurements. However, it is not always clear how the range of QA procedures normally followed by IMSs maps on to the various requirements of ISO 17025. The Personal Dosimetry Service of Public Health England has interpreted its QA procedures both in operating existing services and in developing a new one. (authors)
Bezdíčková, Andrea
2012-01-01
Diploma thesis "Social Network Facebook in News: Comparison of Space Dedicated to Social Network Facebook and its Content in Czech Media in the Years 2009 and 2011", is dedicated to the way of use and citation of social network Facebook in the selected news media. The paper summarizes the establishment and strengthening of online media, particularly the phenomenon of social networks on the example of social network Facebook, and their influence on the transformation of the media sector, news ...
Editorial: Challenges of Social Science Literacy
Directory of Open Access Journals (Sweden)
Birgit Weber
2010-12-01
Full Text Available Since international tests compare the performance of students in different subjects, the issue of literacy in the social science subject is becoming more pressing. The successes and failures in international tests influence the national education policies considerably. First, the inclusion of subjects in international comparisons has consequences for their importance. Second, the race in the Olympics of education leads to an increasing focus on the output of educational processes, also measured in the central exams. Social Sciences can refuse to take part in the national comparison studies with the price of losing much more importance; they can participate with the danger of undermining their goals. This raises a lot of questions: What competences students need in this social world to reason about it und to act responsibly? What is the foundation of concepts from social science students need for guidance and understanding their place and role as an individual in society? The social science disciplines, as sociology, political science and economics in a narrow sense, history, law and geography in a broader sense, supported by philosophy, pedagogy and psychology are able to select them for educational purposes or determine such educational aims. This Journal wants to resume und discuss competences and core con¬cepts for political and economic teaching and learning as Social Science Literacy”. Contributions in this issue do not only discuss and recommend competences and core concepts from a domain specific political or economic point of view, but also from an interdisciplinary or psychological point of view. They analyse preconditions and interdependencies as well as obstacles und problems of development and diagnosis core concepts and competences of Social Science Literacy.
Social Information Processing in Preschool Children Diagnosed with Autism Spectrum Disorder
Ziv, Yair; Hadad, Bat Sheva; Khateeb, Yasmine
2014-01-01
The social cognitive deficiencies of children diagnosed with autism spectrum disorders (ASDs) are well documented. However, the mechanisms underlying these deficiencies are unclear. Therefore, we examined the social information processing (SIP) patterns and social behaviors of 25 preschool children with ASDs in comparison to a matched group of 25…
Scale indicators of social exchange relationships: a comparison of relative content validity.
Colquitt, Jason A; Baer, Michael D; Long, David M; Halvorsen-Ganepola, Marie D K
2014-07-01
Although social exchange theory has become one of the most oft-evoked theories in industrial and organizational psychology, there remains no consensus about how to measure its key mechanism: social exchange relationships (Blau, 1964). Drawing on Cropanzano and Byrne's (2000) review of contemporary social exchange theorizing, we examined the content validity of perceived support, exchange quality, affective commitment, trust, and psychological contract fulfillment as indicators of social exchange relationships. We used Hinkin and Tracey's (1999) quantitative approach to content validation, which asks participants to rate the correspondence between scale items and definitions of intended (and unintended) constructs. Our results revealed that some of the most frequently utilized indicators of social exchange relationships--perceived support and exchange quality--were significantly less content valid than rarely used options like affect-based trust. Our results also revealed that 2 direct measures--Bernerth, Armenakis, Feild, Giles, and Walker's (2007) scale and a scale created for this study--were content valid. We discuss the implications of these results for future applications of social exchange theory.
Directory of Open Access Journals (Sweden)
Antonio Lettieri
2012-08-01
Full Text Available A comparison of the 2007-08 crisis with that of 1929 showed its extreme gravity, but it also may have implied that the old harmful mistakes would not be repeated. After four years, the crisis has not been solved and it even threatens to worsen. Neo-conservative Republicans claim that this is proof of the failure of Keynesian policies. Yet, there is something structurally distorted in the institutions and policies of American industrial relations. The fall of the ‘social contract’ is the basic element of the crisis of the American social and economic model. In comparison with the crisis of the Thirties and its aftermath, what initially was supposed to possibly evolve toward a new New Deal of the Twenty-first century has evolved just in its opposite.JEL: G01, E12, B50
Suurmeijer, Theo P; Doeglas, Dirk M; Briancon, Serge; Krijnen, Wim P
1995-01-01
Investigated if the SSQT allows for meaningful comparisons between patients with rheumatoid arthritis from different countries and explored the dimensionality and invariance of the SSQT dimensions. Based on types of social support, the authors formulated a series of items to measure actual
An Investigation of a New Social Networks Contact Suggestion Based on Face Recognition Algorithm
Directory of Open Access Journals (Sweden)
Ivan Zelinka
2016-01-01
Full Text Available Automated comparison of faces in the photographs is a well established discipline. The main aim of this paper is to describe an approach whereby face recognition can be used in suggestion of a new contacts. The new contact suggestion is a common technique used across all main social networks. Our approach uses a freely available face comparison called "Betaface" together with our automated processig of the user´s Facebook profile. The research´s main point of interest is the comparison of friend´s facial images in a social network itself, how to process such a great amount of photos and what additional sources of data should be used. In this approach we used our automated processing algorithm Betaface in the social network Facebook and for the additional data, the Flickr social network was used. The results and their quality are discussed at the end.
The efficiency of similarity-focused comparisons in person perception.
Corcoran, Katja
2013-01-01
Comparison processes are ubiquitous in person perception. Comparative thinking can follow two routes: People either search for similarities or for dissimilarities while comparing. Which of these two routes is more efficient? Previous research indicates that people could compare two geometrical figures faster if they focused on similarities rather than dissimilarities. I examine comparisons of people and measure the consumption of cognitive resources as indicator for efficiency. The results confirm an efficiency-advantage of similarity-focused comparisons for social stimuli.
Weeks, Justin W; Carleton, R Nicholas; Asmundson, Gordon J G; McCabe, Randi E; Antony, Martin M
2010-10-01
Previous findings suggest that social anxiety disorder may be best characterized as having a dimensional latent structure (Kollman et al., 2006; Weeks et al., 2009). We attempted to extend previous taxometric investigations of social anxiety by examining the latent structure of social anxiety disorder symptoms in a large sample comprised of social anxiety disorder patients (i.e., putative taxon members) and community residents/undergraduate respondents (i.e., putative complement class members). MAXEIG and MAMBAC were performed with indicator sets drawn from a self-report measure of social anxiety symptoms, the Social Interaction Phobia Scale (Carleton et al., 2009). MAXEIG and MAMBAC analyses, as well as comparison analyses utilizing simulated taxonic and dimensional datasets, yielded converging evidence that social anxiety disorder has a taxonic latent structure. Moreover, 100% of the confirmed social anxiety disorder patients in our overall sample were correctly assigned to the identified taxon class, providing strong support for the external validity of the identified taxon; and k-means cluster analysis results corroborated our taxometric base-rate estimates. Implications regarding the conceptualization, diagnosis, and assessment of social anxiety disorder are discussed. Copyright 2010 Elsevier Ltd. All rights reserved.
SPECIFIC FEATURES OF THE SOCIAL INTELLIGENCE OF THE TEENAGERS MAKING USE OF SMOKING BLENDS
Directory of Open Access Journals (Sweden)
Anna Leonidovna Plotnikova
2016-02-01
Full Text Available In this article one can find the results of the research of the teenagers social intelligence at the age of 14-15 years old, making use of narcotic smoking blends. Some specific features of their social intelligence, development level of empathy and communicative skills in comparison with nonsmoking peers are given.Purpose: to find and describe specific features of the social intelligence of the teenagers at the age of 14-15 years old making use of the narcotic smoking blends in comparison with nonsmoking peers.Method: testing, Mann – Whitney U Test.Results: the teenagers making use of narcotic smoking blends have a low level of the social intelligence, communicative skills and empathic abilities. Such elements of the social intelligence as the ability to foresee the behavioral consequences in a concrete situation (prognostic competence and the ability to logical generalization of non-verbal reactions of a person are worse developed in comparison with nonsmoking peers. There are no significant differences between smoking girls and smoking boys.Areas of use: resocialization and rehabilitation of the addicted teenagers
Puissant, Sylvia Pinna; Gauthier, Jean-Marie; Van Oirbeek, Robin
2011-11-01
This study explores the relative contribution of the overall quality of attachment to the mother, to the father and to peers (Inventory of Parent and Peer Attachment scales), the style of attachment towards peers (Attachment Questionnaire for Children scale), the social rank variables (submissive behavior and social comparison), and sex and age variables in predicting the depression score (Center of Epidemiological Studies Depression Scale) on a non-psychiatric sample of 13-18 year old adolescents (n = 225). Results of our integrated model (adjusted R-Square of .50) show that attachment variables (overall quality of attachment to the father and to the mother), social rank variables (social comparison and submissive behavior), age and sex are important in predicting depressive symptoms during adolescence. Moreover, the attachment to peers variables (quality of attachment to peers, secure and ambivalent style of attachment) and sex are mediated by the social rank variables (social comparison and submissive behavior).
Energy Technology Data Exchange (ETDEWEB)
Espiritu R, R. [Centro Medico Nacional de Occidente, IMSS, Servicio Nacional de Radioneurocirugia, Belisario Dominguez 735, Sector Libertad, 44340 Guadalajara, Jalisco (Mexico)
2008-12-15
The perspective of patient protection at the Radio neurosurgery National Service of the Social Security Mexican Institute is divided into three parts: the testing program for equipment acceptance, an assurance quality program based on periodic tests, an also other assurance quality based on tests during the application. Among the technical aspects that influence in the equipment acceptance tests, it is the collimation type, the characteristics of the lineal accelerator, the platform for planning and the network type. In the case of the collimation system and the accelerator characteristics, we consider the manufacturer's specifications and requirements of Mexican Official Standard NOM-033-NUCL-1999, {sup T}echnical Specifications for the Teletherapy Units Operation, Linear Accelerators{sup .} Planning for the platform takes into account the manufacturer's specifications. In the case of computed tomography as well as review the calibration according to manufacturer's specifications should be considered the standard NOM-229-SSA1-2002. In the case of the linear accelerator must be the radiological characterization of radiation beam as part of this, the absolute dose determination. As for the periodic tests is verified the dose constancy, as well as the flattening and symmetry of X-rays beam. There are also tests battery with daily, monthly and yearly frequencies, which make up the assurance quality program. (Author)
Mass Media Influences on Public Conceptions of Social Problems
Hubbard, Jeffrey C.; And Others
1975-01-01
Explores possible relationships between the mass media of communication and social problems by three-way comparisons between the incidence of social problems suggested in media portrayals, conceptions of the incidence of these problems held by the public, and the relative frequency of such problems reflected in statistics accumulated by official…
Pyrrhic Victories: The Need for Social Status Drives Costly Competitive Behavior.
Directory of Open Access Journals (Sweden)
Wouter eVan Den Bos
2013-10-01
Full Text Available Competitive behavior is commonly defined as the decision to maximize one’s payoffs relative to others. We argue instead that competitive drive derives from a desire for social status. We make use of a multi-player auction task in which subjects knowingly incur financial losses for the sake of winning auctions. First, we show that overbidding is increased when the task includes members of a rival out-group, suggesting that social identity is an important mediator of competitiveness. In addition, we show that the extent that individuals are willing to incur losses is related to affective responses to social comparisons but not to monetary outcomes. Second, we show that basal levels of testosterone predict overbidding, and that this effect of testosterone is mediated by affective responses to social comparisons. Based on these findings, we argue that competitive behavior should be conceptualized in terms of social motivations as opposed to just relative monetary payoffs.
Melzer, Silvia; Muffels, R.J.A.
2017-01-01
German reunification provides a unique opportunity to investigate the effects of migration on subjective well-being (SWB) on the basis of longitudinal pre- and post-migration data. Our main goal is to assess the effects of adaptation, social comparison and economic integration on the change in SWB
A genomic comparison of two termites with different social complexity
DEFF Research Database (Denmark)
Korb, Judith; Thomas-Poulsen, Michael; Hu, Haofu
2015-01-01
large and complex societies with morphologically distinct castes that are life-time sterile. Here we compare key characteristics of genomic architecture, focusing on genes involved in communication, immune defenses, mating biology and symbiosis that were likely important in termite social evolution. We......The termites evolved eusociality and complex societies before the ants, but have been studied much less. The recent publication of the first two termite genomes provides a unique comparative opportunity, particularly because the sequenced termites represent opposite ends of the social complexity...
Cool Girls, Inc. and Self-Concept: The Role of Social Capital
Thomason, Jessica D.; Kuperminc, Gabriel
2014-01-01
Social capital was examined as a mediator of the association between youth development program participation and gains in self-concept in a sample of 86 primarily African American female adolescents in the Cool Girls, program, and 89 comparisons. Two dimensions of social capital (the diversity of girls' social networks and the number of life…
Smolak, Linda; Stein, Jonathan A
2006-06-01
This study examines the relationship of three sociocultural factors-media influence, peer teasing, and parent teasing/comments and three potential moderator variables-self-esteem, social comparison, and endorsement of male strength and athleticism-to drive for muscularity in middle school boys. There were 287 seventh and eighth grade boys who completed a questionnaire measuring these variables as well as body mass index (BMI) and pubertal status. Results indicated that media influence and male physical attributes endorsement were particularly important correlates of drive for muscularity. These findings have implications for programs designed to prevent body dissatisfaction among adolescent boys.
Social complexity parallels vocal complexity: a comparison of three non-human primate species.
Bouchet, Hélène; Blois-Heulin, Catherine; Lemasson, Alban
2013-01-01
Social factors play a key role in the structuring of vocal repertoires at the individual level, notably in non-human primates. Some authors suggested that, at the species level too, social life may have driven the evolution of communicative complexity, but this has rarely been empirically tested. Here, we use a comparative approach to address this issue. We investigated vocal variability, at both the call type and the repertoire levels, in three forest-dwelling species of Cercopithecinae presenting striking differences in their social systems, in terms of social organization as well as social structure. We collected female call recordings from twelve De Brazza's monkeys (Cercopithecus neglectus), six Campbell's monkeys (Cercopithecus campbelli) and seven red-capped mangabeys (Cercocebus torquatus) housed in similar conditions. First, we noted that the level of acoustic variability and individual distinctiveness found in several call types was related to their importance in social functioning. Contact calls, essential to intra-group cohesion, were the most individually distinctive regardless of the species, while threat calls were more structurally variable in mangabeys, the most "despotic" of our three species. Second, we found a parallel between the degree of complexity of the species' social structure and the size, diversity, and usage of its vocal repertoire. Mangabeys (most complex social structure) called twice as often as guenons and displayed the largest and most complex repertoire. De Brazza's monkeys (simplest social structure) displayed the smallest and simplest repertoire. Campbell's monkeys displayed an intermediate pattern. Providing evidence of higher levels of vocal variability in species presenting a more complex social system, our results are in line with the theory of a social-vocal coevolution of communicative abilities, opening new perspectives for comparative research on the evolution of communication systems in different animal taxa.
Directory of Open Access Journals (Sweden)
Emma Zang
2016-09-01
Full Text Available How and to what extent is rank mobility associated with happiness of the Chinese population? Does mobility provide insight into the vast numbers of frustrated workers in times of economic growth? To date, few studies have examined the consequences of social mobility on happiness in transitional societies. The present analysis investigates the association of both inter- and intragenerational rank mobility with happiness in China using data from the General Social Survey's 2003, 2006, and 2008 waves. We examine two general mechanisms, social adaptation and social comparison, by statistically decomposing the independent contributions of social origin, social destination, and mobility. We find there is a significant positive association between short-distance intragenerational downward mobility and happiness, while not any intergenerational mobility pattern has been found to be significant. Apparently, we have a group of satisfied losers. Our findings favor social comparison explanations.
Construction of corporate social performance indicators for Czech manufacturing industry
Directory of Open Access Journals (Sweden)
Marie Dočekalová
2013-01-01
Full Text Available This article aims to map out the level of social performance measurement of Czech companies, i.e. what social performance indicators companies monitor and what information they provide to their stakeholders and to construct alternative corporate social performance indicators. Based on an analysis of 24 corporate voluntary reports and results of an empirical research performed among 79 large companies operating in the manufacturing industry, it was found that companies partially monitor their social performance, but from the perspective of international standards (e.g. Global Reporting Initiative, International Federation of Accountants it is still insufficient. Czech companies usually provide only absolute numbers which disguise real trends and do not allow year on year comparison or comparison with other companies. Czech companies should provide a comprehensive picture of their overall performance, they should not focus only on financial indicators based on accounting data, since it is known that the performance measurement based only on financial and economic performance does not lead to long-term success and sustainability of organizations. Companies should monitor more their impact on society within which they operate. Proposed corporate social performance indicators in a measurable and thus manageable way express social issues.
Social comparison mediates chimpanzees' responses to loss, not frustration
DEFF Research Database (Denmark)
Hopper, Lydia M; Lambeth, Susan P; Schapiro, Steve
2014-01-01
Why do chimpanzees react when their partner gets a better deal than them? Do they note the inequity or do their responses reflect frustration in response to unattainable rewards? To tease apart inequity and contrast, we tested chimpanzees in a series of conditions that created loss through...... individual contrast, through inequity, or by both. Chimpanzees were tested in four social and two individual conditions in which they received food rewards in return for exchanging tokens with an experimenter. In conditions designed to create individual contrast, after completing an exchange, the chimpanzees...... were given a relatively less-preferred reward than the one they were previously shown. The chimpanzees' willingness to accept the less-preferred rewards was independent of previously offered foods in both the social and individual conditions. In conditions that created frustration through inequity...
[Lead poisoning and marginalization in newborns of Morelos, Mexico].
Téllez-Rojo, Martha María; Bautista-Arredondo, Luis F; Richardson, Vesta; Estrada-Sánchez, Daniel; Ávila-Jiménez, Laura; Ríos, Camilo; Cantoral-Preciado, Alejandra; Romero-Martínez, Martín; Flores-Pimentel, Delia; Melo-Zurita, María Del Carmen; Romero-Ramírez, Anita; León-Mazón, Marco Antonio; Montes, Sergio; Fuller, Richard; Hernández-Ávila, Mauricio
2017-01-01
To determine the prevalence of lead (Pb) poisoning at birth in Morelos, analyze its distribution by social marginalization level, and estimate the association with the use of lead glazed ceramics (LGC). Blood lead level (BLL) in umbilical cord was measured in a representative sample of 300 randomly selected births at the Morelos Health Services and state IMSS. The prevalence of Pb poisoning at birth (BLL> 5μg/dL) was 14.7% (95%CI: 11.1, 19.3) and 22.2% (95%CI: 14.4, 32.5) in the most socially marginalized municipalities. 57.1% (95%CI: 51.3, 62.7) of the mothers used LGC during pregnancy, and the frequency of use was significantly associated with BLL. This is the first study to document the proportion of newborns with Pb poisoning who are at risk of experiencing the related adverse effects. It is recommended to monitor BLL at birth and take action to reduce this exposure, especially in socially marginalized populations.
Susceptibility to social pressure following ventromedial prefrontal cortex damage.
Chen, Kuan-Hua; Rusch, Michelle L; Dawson, Jeffrey D; Rizzo, Matthew; Anderson, Steven W
2015-11-01
Social pressure influences human behavior including risk taking, but the psychological and neural underpinnings of this process are not well understood. We used the human lesion method to probe the role of ventromedial prefrontal cortex (vmPFC) in resisting adverse social pressure in the presence of risk. Thirty-seven participants (11 with vmPFC damage, 12 with brain damage outside the vmPFC and 14 without brain damage) were tested in driving simulator scenarios requiring left-turn decisions across oncoming traffic with varying time gaps between the oncoming vehicles. Social pressure was applied by a virtual driver who honked aggressively from behind. Participants with vmPFC damage were more likely to select smaller and potentially unsafe gaps under social pressure, while gap selection by the comparison groups did not change under social pressure. Participants with vmPFC damage also showed prolonged elevated skin conductance responses (SCR) under social pressure. Comparison groups showed similar initial elevated SCR, which then declined prior to making left-turn decisions. The findings suggest that the vmPFC plays an important role in resisting explicit and immediately present social pressure with potentially negative consequences. The vmPFC appears to contribute to the regulation of emotional responses and the modulation of decision making to optimize long-term outcomes. © The Author (2015). Published by Oxford University Press. For Permissions, please email: journals.permissions@oup.com.
Knowledge Sharing Among Tourists via Social Media: A Comparison Between Facebook and TripAdvisor
Okazaki Ono, Shintaro; Andreu, Luisa; Campo, Sara
2016-01-01
This paper examines tourists’ knowledge sharing behavior in social media. Based on social capital theory, we aim to examine the effects of three dimensions of social capital—structural (social interaction ties), cognitive (shared vision), and relational (trust)—for two different types of social media: Facebook and TripAdvisor. We propose a structural model that connects an antecedent (homophily) and a consequence (knowledge sharing through posting) of these main dimensions of social capital. ...
Neural sensitivity to social reward and punishment anticipation in Social Anxiety Disorder.
Directory of Open Access Journals (Sweden)
Henk eCremers
2015-01-01
Full Text Available An imbalance in the neural motivational system may underlie Social Anxiety Disorder (SAD. This study examines social reward and punishment anticipation in SAD, predicting a valence-specific effect: increased striatal activity for punishment avoidance compared to obtaining a reward. Individuals with SAD (n=20 and age, gender, and education case-matched controls (n=20 participated in a functional magnetic resonance imaging (fMRI study. During fMRI scanning, participants performed a Social Incentive Delay task to measure the anticipation of social reward and punishment. The left putamen (part of the striatum showed a valence-specific interaction with group after correcting for medication use and comorbidity. The control group showed a relatively stronger activation for reward vs. punishment trials, compared to the social anxiety group. However, post-hoc pairwise comparisons were not significant, indicating that the effect is driven by a relative difference. A connectivity analysis (Psychophysiological interaction further revealed a general salience effect: SAD patients showed decreased putamen-ACC connectivity compared to controls for both reward and punishment trials. Together these results suggest that the usual motivational preference for social reward is absent in SAD. In addition, cortical control processes during social incentive anticipation may be disrupted in SAD. These results provide initial evidence for altered striatal involvement in both valence-specific and valence nonspecific processing of social incentives, and stress the relevance of taking motivational processes into account when studying social anxiety.
Frison, Eline; Eggermont, Steven
2016-03-01
Social networking sites, such as Facebook, offer adolescent users an ideal platform for negative comparison (i.e., experiencing negative feelings from social comparison). Although such negative comparison on Facebook has been associated with users' well-being, the reciprocal relations between the two remain unclear, particularly in an adolescent sample. To examine this reciprocal process, a two-wave study among a representative sample of Flemish adolescents was set up (N Time1 = 1,840). Data were analyzed using structural equation modeling. Cross-lagged analyses indicated that negative comparison on Facebook predicted decreases in life satisfaction over time. Conversely, lower scores on life satisfaction predicted increases in negative comparison on Facebook. The discussion focuses on the understanding of these findings, key limitations, directions for future research, and implications for prevention and intervention strategies.
Diseguaglianza, conflitto sociale e sindacati in America
Directory of Open Access Journals (Sweden)
Antonio Lettieri
2012-06-01
Full Text Available A comparison of the 2007-08 crisis with that of 1929 showed its extreme gravity, but it also may have implied that the old harmful mistakes would not be repeated. After four years, the crisis has not been solved and it even threatens to worsen. Neo-conservative Republicans claim that this is proof of the failure of Keynesian policies. Yet, there is something structurally distorted in the institutions and policies of American industrial relations. The fall of the ‘social contract’ is the basic element of the crisis of the American social and economic model. In comparison with the crisis of the Thirties and its aftermath, what initially was supposed to possibly evolve toward a new New Deal of the Twenty-first century has evolved just in its opposite
Social support and bipolar disorder
Directory of Open Access Journals (Sweden)
Paula Mendonça Studart
2015-08-01
Full Text Available Background Bipolar disorder is a chronic condition that affects the functioning of its carriers in many different ways, even when treated properly. Therefore, it’s also important to identify the psychosocial aspects that could contribute to an improvement of this population’s quality of life.Objective Carry out a literature review on the role of social support in cases of bipolar disorder.Method A research on the following online databases PubMed, Lilacs and SciELO was conducted by using the keywords “social support” or “social networks” and “mood disorders” or “bipolar disorder” or “affective disorder,” with no defined timeline.Results Only 13 studies concerning the topic of social support and BD were found in the search for related articles. Generally speaking, the results show low rates of social support for BD patients.Discussion Despite the growing interest in the overall functioning of patients with bipolar disorder, studies on social support are still rare. Besides, the existing studies on the subject use different methodologies, making it difficult to establish data comparisons.
Bowen, Gary L; Jensen, Todd M; Martin, James A; Mancini, Jay A
2016-03-01
Anchored in the social organization theory of action and change, we use data from a large sample of active-duty Air Force members to examine the direct and indirect influence of social involvement and social responsibility on willingness to seek help in times of need via trust in formal systems and informal supports. Group comparisons are conducted between junior male, junior female, senior male, and senior female service members. The key mediational path in the model for all groups is the connection between social involvement and willingness to seek help via trust in formal systems. These results can inform both unit- and community-level interventions intended to increase the likelihood that active-duty AF members will seek help in times of need. © Society for Community Research and Action 2016.
Perceived Discrimination and Social Identity as Adolescents ...
African Journals Online (AJOL)
Perceived Discrimination and Social Identity as Adolescents' Pathways to ... Also, a comparison of gender on drug use reveals males using more drugs than ... and governmental organizations starting from families should work together in the ...
Marital Biography, Social Security Receipt, and Poverty.
Lin, I-Fen; Brown, Susan L; Hammersmith, Anna M
2017-01-01
Increasingly, older adults are unmarried, which could mean a larger share is at risk of economic disadvantage. Using data from the 2010 Health and Retirement Study, we chart the diverse range of marital biographies, capturing marital sequences and timing, of adults who are age eligible for Social Security and examine three indicators of economic well-being: Social Security receipt, Social Security benefit levels, and poverty status. Partnereds are disproportionately likely to receive Social Security and they enjoy relatively high Social Security benefits and very low poverty levels. Among singles, economic well-being varies by marital biography and gender. Gray divorced and never-married women face considerable economic insecurity. Their Social Security benefits are relatively low, and their poverty rates are quite high (over 25%), indicating Social Security alone is not sufficient to prevent these women from falling into poverty. By comparison, gray widoweds are the most advantaged singles.
Damron-Rodriguez, JoAnn; Goodman, Catherine; Ranney, Molly; Min, Jong Won; Takahashi, Nancy
2013-01-01
California has actively engaged in the Hartford Geriatric Social Work Initiative. Subsequently, the California Social Work Education Center Aging Initiative conducted a university survey of gerontology education in California graduate social work schools ("N"?=?17). In 2005, students taking aging courses were 12% in comparison to a…
Ethnic Identity and Social-Cognitive Maturity in a Multicultural Group Experience
Johnson, Jennifer M.; Lambie, Glenn W.
2013-01-01
This study examined a multicultural group experience on students' ("N"= 94) ethnic identity development and social-cognitive maturity. Although no differences were identified between treatment and comparison group participants, group therapeutic factors scores were predictive of ethnic identity development and social-cognitive…
Neural responses during social and self-knowledge tasks in bulimia nervosa
Directory of Open Access Journals (Sweden)
Carrie J Mcadams
2013-09-01
Full Text Available Self-evaluation closely dependent upon body shape and weight is one of the defining criteria for bulimia nervosa. We studied 53 adult women, 17 with bulimia nervosa, 18 with a recent history of anorexia nervosa, and 18 healthy comparison women, using three different fMRI tasks that required thinking about self-knowledge and social interactions: the Social Identity task, the Physical Identity task, and the Social Attribution task. Previously, we identified regions of interest (ROI in the same tasks using whole brain voxel-wise comparisons of the healthy comparison women and women with a recent history of anorexia nervosa. Here, we report on the neural activations in those ROIs in subjects with bulimia nervosa. In the Social Attribution task, we examined activity in the right temporoparietal junction, an area frequently associated with mentalization. In the Social Identity task, we examined activity in the precuneus and dorsal anterior cingulate. In the Physical Identity task, we examined activity in a ventral region of the dorsal anterior cingulate. Interestingly, in all tested regions, the average activation in subjects with bulimia was more than the average activation levels seen in the subjects with a history of anorexia but less than that seen in healthy subjects. In three regions, the right temporoparietal junction, the precuneus, and the dorsal anterior cingulate, group responses in the subjects with bulimia were significantly different from healthy subjects but not subjects with anorexia. The neural activations of people with bulimia nervosa performing fMRI tasks engaging social processing are more similar to people with anorexia nervosa than healthy people. This suggests biological measures of social processes may be helpful in characterizing individuals with eating disorders.
Researching Undergraduate Social Science Research
Rand, Jane
2016-01-01
The experience(s) of undergraduate research students in the social sciences is under-represented in the literature in comparison to the natural sciences or science, technology, engineering and maths (STEM). The strength of STEM undergraduate research learning environments is understood to be related to an apprenticeship-mode of learning supported…
Social Marketing: Vinea’s campaign “Bring life back to vineyard”
Horanská, Barbora
2017-01-01
Social marketing had been mainly connected with non-profit organisations. However, as the market develops the companies require higher level of sustainability and differentiation. Therefore, social marketing is now also applicable to other businesses. In order to prove the benefits of social marketing for company and society this thesis provides basic theories of classical marketing and their comparison with social marketing. These theories were applied to analyse a specific example of Vinea ...
Directory of Open Access Journals (Sweden)
Fernando Alberto Balbi
2015-06-01
Full Text Available En la antropología social y/o cultural actual, la comparación tiende a ser considerada como un recurso auxiliar de la etnografía cuya utilidad se limita a la detección y el análisis de la diversidad. En este artículo se argumenta que ello tiene efectos negativos sobre el control de los procedimientos comparativos, la productividad de la etnografía, la capacidad de los antropólogos para producir generalizaciones teóricas y, en consecuencia, la relevancia de la propia disciplina. Se sugiere que, con el objeto de recuperar la capacidad de la disciplina para formular generalizaciones, es necesario restablecer a la comparación en su condición originaria de recurso analítico por derecho propio y desnaturalizar su relación con la diversidad. Asimismo, se esbozan los fundamentos epistemológicos de dicha empresa, para finalmente pasar a delinear dos formas posibles de combinar a la comparación y la etnografía que facilitarían la producción simultánea de análisis de casos y de recursos teórico-metodológicos. Abstract In today’s social and/or cultural anthropology, there is a trend to consider comparison as an auxiliary resource to ethnography whose usefulness is restricted to the detection and analysis of diversity. This paper argues that such situation has negative effects on the control of comparative procedures, on ethnography’s productivity, on the ability of anthropologists to produce theoretical generalizations and, consequently, on the relevance of the discipline itself. It is suggested that, in order to recover anthropology’s ability to formulate generalizations, comparison needs to be restored to its original condition of analytical resource in its own right and overcome the naturalization of its connection with diversity. The epistemological foundations of this enterprise are outlined in order to trace two possible ways to combine comparison and ethnography which would facilitate the simultaneous production of
Long-term outcome of social skills intervention based on interactive LEGO play.
Legoff, Daniel B; Sherman, Michael
2006-07-01
LEGO building materials have been adapted as a therapeutic modality for increasing motivation to participate in social skills intervention, and providing a medium through which children with social and communication handicaps can effectively interact. A 3 year retrospective study of long-term outcome for autistic spectrum children participating in LEGO therapy (N = 60) compared Vineland Adaptive Behavior Scale socialization domain (VABS-SD) and Gilliam Autism Rating Scale social interaction subscale (GARS-SI) scores preand post-treatment with a matched comparison sample (N = 57) who received comparable non-LEGO therapy. Although both groups made significant gains on the two outcome measures, LEGO participants improved significantly more than the comparison subjects. Diagnosis and pre-treatment full-scale IQ scores did not predict outcome scores; however, Vineland adaptive behavior composite, Vineland communication domain, and verbal IQ all predicted outcome on the VABS-SD, especially for the LEGO therapy group. Results are discussed in terms of implications for methods of social skills intervention for autistic spectrum disorders.
Social Intuition and Social Information in Physical Child Abuse Evaluation and Diagnosis.
Keenan, Heather T; Cook, Lawrence J; Olson, Lenora M; Bardsley, Tyler; Campbell, Kristine A
2017-11-01
Poor and minority children with injuries concerning for abuse are evaluated and diagnosed for abuse differentially. We hypothesized that 2 steps in the decision-making process would influence evaluation and diagnosis: social intuition from meeting the family and objective social information associated with child abuse risk. Between 2009 and 2013, 32 child abuse pediatricians (CAPs) submitted 730 child abuse consultations including original medical evaluations and diagnoses. CAPs evaluated and diagnosed each other's cases. Comparisons of evaluations and diagnoses were made by levels of social understanding available to the CAP: meeting the family (social intuition and information), reading the case (social information), and reading the case without social information. Evaluations were compared with a consensus gold standard by using logistic regression modeling adjusting for child and CAP characteristics. Diagnostic categories were compared by level of social understanding and diagnostic certainty by using contingency tables. CAPs without access to social intuition were approximately twice as likely to perform gold standard evaluations for neurotrauma and long bone fracture compared with CAPs who met families. Diagnostic agreement fell from 73.3% (95% confidence interval [CI]: 70.1%-76.5%) when social information was present to 66.5% (95% CI: 63.1%-70.0%) when social information was restricted. In cases with less certainty, agreement dropped to 51.3% (95% CI: 46.0%-56.7%). Social intuition and information play a role in the physical child abuse decision-making process, which may contribute to differential diagnosis. Simple interventions including decision tools, check lists, and peer review may structure evaluations to ensure children's equal treatment. Copyright © 2017 by the American Academy of Pediatrics.
Szumski, Grzegorz; Smogorzewska, Joanna; Grygiel, Paweł; Orlando, Ann-Marie
2017-11-20
We compared the effectiveness of two programs for developing social skills, 'Play Time/Social Time' (PT/ST) and 'I Can Problem Solve' (ICPS), in improving the social skills and theory of mind (ToM) of preschoolers with ASD. The experiment took place in a classroom setting. Fifty-two children attended and data were analyzed with latent growth curve models. Comparison with a control group indicated that both programs were effective in developing social skills. The PT/ST program was more effective than ICPS in developing interaction skills; both programs improved children's ability to cope with difficult social situations. The ICPS program was marginally effective in developing ToM when compared with PT/ST and control condition. These results are relevant to children with ASD and their teachers.
Social opinion dynamics is not chaotic
Lim, Chjan; Zhang, Weituo
2016-08-01
Motivated by the research on social opinion dynamics over large and dense networks, a general framework for verifying the monotonicity property of multi-agent dynamics is introduced. This allows a derivation of sociologically meaningful sufficient conditions for monotonicity that are tailor-made for social opinion dynamics, which typically have high nonlinearity. A direct consequence of monotonicity is that social opinion dynamics is nonchaotic. A key part of this framework is the definition of a partial order relation that is suitable for a large class of social opinion dynamics such as the generalized naming games. Comparisons are made to previous techniques to verify monotonicity. Using the results obtained, we extend many of the consequences of monotonicity to this class of social dynamics, including several corollaries on their asymptotic behavior, such as global convergence to consensus and tipping points of a minority fraction of zealots or leaders.
The Relationship between Social Support and Adolescent Dating Violence: A Comparison across Genders
Richards, Tara N.; Branch, Kathryn A.
2012-01-01
Although much research has focused on the function of social support in adult intimate partner violence, little is known about the role of social support in adolescent dating violence. This study is an exploratory analysis of the independent impact of social support from friends and family on the risk of adolescent dating violence perpetration and…
Social isolation during puberty affects female sexual behavior in mice
Directory of Open Access Journals (Sweden)
Jasmina eKercmar
2014-09-01
Full Text Available Exposure to stress during puberty can lead to long-term behavioral alterations in adult rodents coincident with sex steroid hormone-dependent brain remodeling and reorganization. Social isolation is a stress for social animals like mice, but little is known about the effects of such stress during adolescence on later reproductive behaviors. The present study examined sexual behavior of ovariectomized, estradiol and progesterone primed female mice that were individually housed from 25 days of age until testing at approximately 95 days, or individually housed from day 25 until day 60 (during puberty, followed by housing in social groups. Mice in these isolated groups were compared to females that were group housed throughout the experiment. Receptive sexual behaviors of females and behaviors of stimulus males were recorded. Females housed in social groups displayed greater levels of receptive behaviors in comparison to both socially isolated groups. Namely, social females had higher lordosis quotients and more often displayed stronger lordosis postures in comparison to isolated females. No differences between female groups were observed in stimulus male sexual behavior suggesting that female ’attractiveness’ was not affected by their social isolation. Females housed in social groups had fewer cells containing immunoreactive estrogen receptor (ER α in the anteroventral periventricular nucleus (AVPV and in the ventromedial nucleus of the hypothalamus (VMH than both isolated groups. These results suggest that isolation during adolescence affects female sexual behavior and re-socialization for one month in adulthood is insufficient to rescue lordosis behavior from the effects of social isolation during the pubertal period.
The Integration of Disclosure of Islamic Social Reporting (ISR in Islamic Bank Financial Statements
Directory of Open Access Journals (Sweden)
Sugianto
2017-01-01
Full Text Available Islamic bank has an economy function as well as a social function. So that Islamic banks posses an ethical identity for their social objectives as important if not more important than economic goals due to the fact that the system and its operation is based on the Islamic Shari’ah. This objective is intended to Islamic bank also participate in the improvement of society, so it is expected to describe clear corporate social responsibility in their social reporting practices as evidenced in their annual reports. This study replicated the Haniffa and Hudaib research by examining social reporting practices of Islamic Banks in Indonesia. This examination involves a comparison of social disclosure 12 Islamic banks conducted through their annual reports to the ideal level of social disclosure that Islamic banks should be made, during the years 2014-2015. This comparison is done by using the Ethical Identity Index (EII developed by Haniffa and Hudaib (2007. The findings revealed that at present, Islamic banks in Indonesia is still poor in the practice of social reporting.
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available putative [Entamoeba histolytica HM-1:IMSS] ... Length = 228 ... Query: 96 ... VRENMEDVISTCHLERNKDLVGVFDGHNG...DSAARIAATLLKQDTKNYTLLDDIHFIDLFN 155 ... VRENMEDVISTCHLERNKDLVGVFDGHNGDSAARIAATLLKQDTKNYTLLDDIHFIDLFN Sbjct: 1 ... VRENMEDVISTC
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tative [Entamoeba histolytica HM-1:IMSS] ... Length = 141 ... Query: 94 ... GFKTLSPYELNQMINSSKLDELFIIDVRYPY...EYNGGHVRSSMNISTETALYKELNKLFEI 153 ... GFKTLSPYELNQMINSSKLDELFIIDVRYPYEYNGGHVRSSMNISTETALYKELNKLFEI Sbjct: 1 ... GFKTLSPYELNQMINS
Beyond hearing : social-emotional outcomes following cochlear implantation in young children
Ketelaar, Lizet
2014-01-01
In comparison to hearing children, children with hearing loss more often experience social-emotional problems. This thesis aimed to assess whether this was also true for 1-to-5-year-old children who had received a cochlear implant (CI) to remediate their hearing loss. In comparison to hearing peers,
Social exclusion and people with intellectual disabilities: a rural-urban comparison.
Nicholson, L; Cooper, S-A
2013-04-01
Research suggests that social exclusion is a problem both for people with intellectual disabilities (ID) and for people living in rural areas. This may give rise to a double disadvantage for people with ID living in rural areas. Conversely, aspects of rural life such as community spirit and social support may protect against social exclusion in this population. This study was designed to compare a number of measures of social exclusion in adults with ID living in rural and urban areas, with the aim of identifying whether a double disadvantage exists. Adults with ID were recruited from a rural and an urban area in Scotland. Participants participated in a face-to-face interview and their medical notes were accessed. Social exclusion was investigated using a number of measures comprising: daytime opportunities and physical access to community facilities (using part of the British Institute of Learning Disabilities questionnaire), recent contact with others and the quality of personal relationships (using a modified Interview Measure of Social Relationships questionnaire) and area deprivation by postcode (using the Scottish Index of Multiple Deprivation). The data were analysed using a series of binary logistic regression models that adjusted for variables including age, gender, level of ID, mental illhealth and common physical co-morbidities. A representative sample of adults with ID from rural (n = 39) and urban (n = 633) areas participated. Participants from rural areas were significantly more likely to have any regular daytime opportunity [odds ratio (OR) = 10.8, 95% CI = 2.3-51.5] including employment (OR = 22.1, 95% CI = 5.7-85.5) and attending resource centres (OR = 6.7, 95% CI = 2.6-17.2) than were participants from urban areas. They were also more likely to have been on holiday (OR = 17.8, 95% CI = 4.9-60.1); however, were less likely to use community facilities on a regular basis. Participants from urban and rural areas had a similar number of contacts with
A comparison of social accounting between local public healthcare services:An empirical research
Directory of Open Access Journals (Sweden)
Paolo Ursillo
2010-03-01
Full Text Available
Introduction: Social accounting in healthcare is a quantitative–qualitative accounting tool which marks the bond between the business and its social background. It displays healthcare business results and information to the stakeholder. Actually, its use is not widespread in Italy, but often published in United States and other Countries.
Methods: This work is based upon an empirical research, studying social accounting from Local Health Units (LHU, Italian ASL of Adria, Brindisi, Firenze and Umbria region published between 2006 and 2008. These documents have been analyzed, studying the business’ structure, healthcare services, social and economical conditions, financial status, performance indexes and much more data about most company activities.
Results: Accountability in Italy has been studied carefully through longitudinal and cross sectional analysis, observing models and contents, elaborating a concrete proposal for social accounting.
Discussion: Social accounting in healthcare can guarantee important information for non-expert users and expert technicians, allowing the former to take more conscious decisions, and the latter to study its business aspects more deeply. This is made possible by the consideration of extended economical data available in other accountability forms (like annual financial statement, and other performance indexes which give valuable data about social impact, efficiency and effectiveness to the end user.
Directory of Open Access Journals (Sweden)
Javier Contreras-Lemus
2001-06-01
Full Text Available Objetivo. Analizar la forma en que se registran los nacimientos y la muerte en el periodo perinatal, en el Instituto Mexicano del Seguro Social (IMSS, y documentar si el registro de la muerte, en este periodo, es adecuado. Material y métodos. Entre enero y marzo de 2000, se aplicó una encuesta en las 37 delegaciones del IMSS, para conocer, del año 1999, el total de nacimientos vivos y muertos, las defunciones ocurridas antes del séptimo día, considerando su edad gestacional y peso al nacimiento. Con estos datos se analizó la mortalidad hebdomadal e infantil y se calcularon las tasas correspondientes, incluyendo o desagregando a los niños con o = 28 semanas de gestación. Antes de la primera semana de vida extrauterina fallecieron 4 556 niños, de los cuales 1 385 (30.4% pesaron http://www.insp.mx/salud/index.htmlObjective. To analyze perinatal births and deaths recording at the Mexican Institute of Social Security (MISS, and to evaluate the correct classification of perinatal deaths. Material and methods. From January to March 2000, data were collected from the 37 MISS districts on the total number of births and deaths occurring during 1999, deaths occurring before the seventh day of life, and gestational age and weight at birth. Early neonatal and infant mortality rates were analyzed including or separating newborns with or = 28 gestation weeks. There were 4 556 newborns who died before the seventh day of extrauterine life; 1 385 of them (30.4% weighed less than 1 000 g and had a gestational age http://www.insp.mx/salud/index.html
Uso de los servicios de salud por la población de 60 años y más en México
Directory of Open Access Journals (Sweden)
BORGES-YÁÑEZ S. AÍDA
1998-01-01
Full Text Available Objetivo. Describir las características sociodemográficas y las determinantes de la utilización de los servicios de salud por la población de 60 años y más en México. Material y métodos. De la información captada en la Encuesta Nacional de Salud II se obtuvieron datos de 4 628 personas ancianas; se analizaron las prevalencias de las principales enfermedades crónicas y en los individuos que utilizaron los servicios de salud dos semanas antes de la encuesta se investigaron los factores determinantes de su utilización. Resultados. Las enfermedades crónicas más frecuentemente notificadas fueron: hipertensión arterial, diabetes mellitus y cardiopatías. La tasa de utilización de servicios en ese grupo de edad fue de 11.4%, y de hospitalización 5.5%. Los servicios de salud más utilizados fueron: el médico particular, el Instituto Mexicano del Seguro Social (IMSS, la Secretaría de Salud, el Instituto de Seguridad y Servicios Sociales de los Trabajadores del Estado y el IMSS-Solidaridad. De 25 a 45% de los derechohabientes no hacen uso de estos servicios y, en su lugar, acuden a los servicios privados. Las variables explicativas más importantes de la utilización de servicios fueron: el estar enfermo, no haber trabajado la semana anterior y ser derechohabiente. El género, la zona de residencia y el grado de escolaridad no fueron significativos en la explicación de la utilización de servicios de salud. Conclusiones. El estudio demuestra la necesidad de fortalecer los programas preventivos y de apoyo para esta población, ya que sólo acude a los servicios de salud cuando está enferma.
Heterogeneous social preferences, screening, and employment contracts
Ferdinand A. von Siemens
2011-01-01
This paper studies a monopsonistic firm's optimal employment contracts if workers have private information on both their propensity for social comparisons and their ability. Employees of the firm are taken to form their own distinct reference group. It is shown that screening workers with equal ability according to their social preferences is then not possible within the firm. In consequence, the firm distorts production by its employees with low ability, or it excludes workers with low abili...
Women's anxiety about social and exercise settings.
Walton, Vicki R; Finkenberg, Mel E
2002-04-01
This study involved a comparison of social physique anxiety, assessed through the application of a modified version of the Social Physique Anxiety Scale, with 28 women who were new members exercising at all-female facilities compared to 43 new female members exercising at coeducational facilities. Analyses indicated there were no significant differences in means between the groups. The scores of women attending all-female facilities were significantly more influenced by the sex of members when choosing a facility.
Gender differences in social provisions and loneliness: A comparison of three cohorts
Stevens, N.L.; Westerhof, G.J.
2007-01-01
Within the Dutch cultural framework, married men and women organize their social lives in similar ways in late adulthood. Like married women, Dutch men are involved in a variety of relationships. Social provisions from the partner, children and friends influence loneliness levels of both men and
Social capital calculations in economic systems: Experimental study
Chepurov, E. G.; Berg, D. B.; Zvereva, O. M.; Nazarova, Yu. Yu.; Chekmarev, I. V.
2017-11-01
The paper describes the social capital study for a system where actors are engaged in an economic activity. The focus is on the analysis of communications structural parameters (transactions) between the actors. Comparison between transaction network graph structure and the structure of a random Bernoulli graph of the same dimension and density allows revealing specific structural features of the economic system under study. Structural analysis is based on SNA-methodology (SNA - Social Network Analysis). It is shown that structural parameter values of the graph formed by agent relationship links may well characterize different aspects of the social capital structure. The research advocates that it is useful to distinguish the difference between each agent social capital and the whole system social capital.
Sheehy, Tammy L
2014-01-01
Group physical activity programs for clinical populations can provide opportunities for adaptive social interactions, improving perceptions of competence, and may facilitate posttraumatic growth (positive psychological changes resulting from traumatic life experiences). Therefore, the purpose of this study was to examine how people with Parkinson's experience social interactions and physical challenges in a group physical activity program, and to investigate what role they think those experie...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available otein [Entamoeba histolytica HM-1:IMSS] ... Length = 113 ... Query: 129 SGHTSTATTHSISFTGTGNSIGKSNATNFKVT...GSIPTLDISKPTTNIKVRFIDGKQKVFK 188 ... SGHTSTATTHSISFTGTGNSIGKSNATNFKVTGSIPTLDISKPTTNIKVRFIDGKQKVFK Sbjct: 1 ... SGHTSTATTHSISFTGTGNSIGKSNATNFKVTGSIPTLDISKPTTNIKVRFIDGKQKVFK 60 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available t00003 [Entamoeba histolytica HM-1:IMSS] ... Length = 365 ... Query: 252 LPFEMKYQDLIKEIGKHKIYNHFMKIIIDRN...NVFNSLFKQIKHSEKWDRLFKIEFKHEQG 311 ... LPFEMKYQDLIKEIGKHKIYNHFMKIIIDRNNVFNSLFKQIKHSEKWDRLFKIEFKHEQG Sbjct: 1 ... LPFEM
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available rotein [Entamoeba histolytica HM-1:IMSS] ... Length = 103 ... Query: 31 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHIS...PMIDTS 90 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHISPMIDTS Sbjct: 1 ... KVVRKPACNWSVEEDRKLLDAVNKFGKSRWVEIAEFVGSRSRKQCRERYINHISPMIDTS 60 ...
Goddard, Marcia N; Swaab, Hanna; Rombouts, Serge A R B; van Rijn, Sophie
2016-09-01
Klinefelter syndrome (47, XXY) is associated with several physical, cognitive, and behavioral consequences. In terms of social development, there is an increased risk of autism symptomatology. However, it remains unclear how social deficits are related to abnormal brain development and to what degree underlying mechanisms of social dysfunction in 47, XXY are similar to, or different from, those in idiopathic autism (ASD). This study was aimed at investigating the neural architecture of brain structures related to social information processing in boys with 47, XXY, also in comparison with boys with idiopathic ASD. MRI scans of 16 boys with 47, XXY, 16 with ASD, and 16 nonclinical, male controls were analyzed using voxel-based morphometry (VBM). A region of interest mask containing the superior temporal cortex, amygdala, orbitofrontal cortex (OFC), insular cortex, and medial frontal cortex was used. The Social Responsiveness Scale (SRS) was used to assess degree of autism spectrum symptoms. The 47, XXY group could not be distinguished from the ASD group on mean SRS scores, and their scores were significantly higher than in controls. VBM showed that boys with 47, XXY have significant gray matter volume reductions in the left and right insula, and the left OFC, compared with controls and boys with ASD. Additionally, boys with 47, XXY had significantly less gray matter in the right superior temporal gyrus than controls. These results imply social challenges associated with 47, XXY may be rooted in neural anatomy, and autism symptoms in boys with 47, XXY and boys with ASD might have, at least partially, different underlying etiologies.
Directory of Open Access Journals (Sweden)
Xiujuan Chen
2018-03-01
Full Text Available The significant increase of municipal solid wastes (e.g., food disposals, biomedical wastes, recyclable materials, etc. is a very important environmental issue around the world. Waste recycling, reduction, and reuse are not only methods to solve environmental problems, but also directions for social innovation for business to create potential social value. This study investigates the business models of two waste recycling companies in Thailand and Taiwan. First, the basic micro and macro environmental factors were analyzed, including the period of firm’s business operations, location of the firm, space for separating and storing recyclable waste and various types of recyclable waste purchasing affecting the firms’ performance in these two economies. Second, different recyclable waste materials, volumes and price strategies between the case companies were compared. Third, this study also investigates the impacts of factors regarding resource characteristics, a firm’s capabilities and an entrepreneur’s abilities to improve a firm’s performance all compose a critical business model. The results showed that there were an increasing number of owners of waste recycling businesses developing and adapting to new business models. Detailed comparisons are reported and discussed in the article to shed light on managerial and policy implications.
The comparison of social skill levels of team sports athletes and individual sport athletes
Directory of Open Access Journals (Sweden)
Fatma Çepikkurt
2017-06-01
Full Text Available Aim: The study is to compare the level of social skills scores of undergraduate students at Mersin University School of Physical Education and Sports according to sport types, gender and class levels. Material and Methods: To test the main hypothesis, a total of 112 student- athletes (47 female and 65 male, performing individual and team sports from the Mersin University School of Physical Education and Sports were involved in this study. Data were collected by ‘Social Skills Inventory” developed by Riggio (1986, 1989 and adapted to Turkish by Yüksel (1998. Results: T -test results showed that the mean scores of 6 sub-dimensions of social skills scale does not change with regard to types of sports. But, there were significant differences of mean scores of social control changes with respect to gender and this score was higher for female athletes compared to male counterparts. Moreover, the results of Kruskal Wallis Analysis indicated that there was a significant difference in all sub dimensions except emotional awareness subscale compared to class level. First year students had the highest scores in terms of emotional expressivity, emotional control, social expressivity, social awareness, and social control. Conclusion: It could be stated that women are more successful in social skills, although the level of social skills of student-athletes does not differ according to sport.
A Social Model of Loneliness: The Roles of Disability, Social Resources, and Cognitive Impairment.
Burholt, Vanessa; Windle, Gill; Morgan, Deborah J
2017-11-10
We consider the points at which cognitive impairment may impact on the pathway to loneliness for older people, through impeding social interaction with family and friends, or by interfering with judgments concerning satisfaction with relationships. We conceptualize a mediation model anticipating that social resources (LSNS-6) will mediate the pathway between disability (Townsend Disability Scale) and loneliness (De Jong Gierveld 6-item scale) and a moderated-mediation model in which we hypothesize that cognitive impairment (MMSE) will moderate the association between disability and social resources and between social resources and loneliness. To validate the hypothesized pathways, we draw on the CFAS Wales data set (N = 3,593) which is a nationally representative study of community-dwelling people aged 65 and older in Wales. Disability had a significant indirect effect on loneliness through the mediating variable social resources. Cognitive impairment was significantly associated with social resources, but did not moderate the relationship between disability and social resources. Cognitive impairment had a significant impact on loneliness, and moderated the effect of social resources on loneliness. Social structures can (dis)empower people with cognitive impairment and lead to exclusion from social resources or impact on the social construction of aging, cognitive impairment, and dementia. The sense of self for an older person with cognitive impairment may be influenced by social norms and stereotypes, or through a temporal social comparison with an "earlier" sense of self. We conclude that loneliness interventions should be theoretically informed to identify key areas for modification. © The Author 2016. Published by Oxford University Press on behalf of The Gerontological Society of America.
Directory of Open Access Journals (Sweden)
Masoud Etemadifar
2012-01-01
Full Text Available Background. Multiple Sclerosis (MS and Guillain Barre Syndrome (GBS are autoimmune demyelinating disorders of Central and Peripheral Nervous system, respectively. The coexistence of these two syndromes in an individual's life span is rare. Objectives. To inspect throughout Isfahan MS society (IMSS records for MS cases who had history of documented GBS whether before the onset of MS or after it. Methods. This retrospective survey was carried out by analyzing the clinical records of 3,522 MS patients who were registered with IMSS, from April 2003 to July 2010. Eligible cases were requested to attend to IMSS for final clinical/paraclinical examinations. Results. Among 3,522 (2,716 women and 806 men MS subjects, we could identify seven patients (six females and one male with documented diagnosis of GBS. Six patients (five women and one man had developed MS within 6.5±7.0 (range: 1–16 years after being diagnosed with GBS and one (a woman had developed GBS three years after the diagnosis of MS. Conclusion. It seems that the development of MS in individuals with history of GBS is more than a simple incidental event.
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available yme, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 145 ... Query: 7 ... IALMRLTADLKTMLTDPP...VGISSGPIDESNLYFWQATIAGPENSPFEGGLFELRLTFSDE 66 ... IALMRLTADLKTMLTDPPVGISSGPIDESNLYFWQATIAGPENSPF...EGGLFELRLTFSDE Sbjct: 1 ... IALMRLTADLKTMLTDPPVGISSGPIDESNLYFWQATIAGPENSPFEGGLFELRL
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available rotein, putative [Entamoeba histolytica ... HM-1:IMSS] ... Length = 204 ... Query: 7 ... QWQKAQETIFVDWIND...TLKPDIIISNLEEDLKTGVNLILLVEKLTNKHCSEKIIENPKFR 66 ... QWQKAQETIFVDWINDTLKPDIIISNLEEDLKTGVNLILLVEK...LTNKHCSEKIIENPKFR Sbjct: 1 ... QWQKAQETIFVDWINDTLKPDIIISNLEEDLKTGVNLILLVEKLTNKHCSEK
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available .t00007 [Entamoeba histolytica HM-1:IMSS] ... Length = 56 ... Query: 454 QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRT...KYGDLVDDFEKNQK 509 ... QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRTKYGDLVDDFEKNQK Sbjct: 1 ... QTFEVERIVRKKIVHGNTSYLVKWKNYSSKDNTWETEDDIRTKYGDLVDDFEKNQK 56
Social phenotypes of autism spectrum disorders and Williams syndrome: similarities and differences
Directory of Open Access Journals (Sweden)
Kosuke eAsada
2012-07-01
Full Text Available Autism spectrum disorders (ASD and Williams syndrome (WS both are neurodevelopmental disorders, each with a unique social phenotypic pattern. This review article aims to define the similarities and differences between the social phenotypes of ASD and WS. We review studies that have examined individuals with WS using diagnostic assessments such as the Autism Diagnostic Observation Schedule (ADOS, cross-syndrome direct comparison studies, and studies that have individually examined either disorder. We conclude that (1 Individuals with these disorders show quite contrasting phenotypes for face processing (i.e., preference to faces and eyes and sociability (i.e., interest in and motivation to interact with others, and (2 Although the ADOS and a direct comparison study on pragmatic language ability suggest more deficits in ASD, individuals with WS are similarly impaired on social cognition and communicative skills. In light of these results, we discuss how cross-syndrome comparisons between ASD and WS can contribute to developmental theory, cognitive neuroscience, and the development and choice of clinical treatments.
An Investigation of the Cross-Cultural Comparability of Social Skills
ISHII, Hidetoki; SUGIMURA, Niwako; ZHANG, Yiping; WATANABE, Hiroshi
2009-01-01
The inclusion of the measurement of social skills in the PISA administered by OECD is currently under consideration. However, it is often argued that standards for evaluation of social skills are set within the framework of a given society and that any cross-cultural comparison beyond this framework is essentially impossible. In this study, an investigation was conducted in cities in the Asian region (Shanghai, Shenzhen, Yangon) whose cultures are comparatively closer to Japan's. The Social S...
SOCIAL COMPARISON, SELF-CONSISTENCY AND THE PRESENTATION OF SELF.
MORSE, STANLEY J.; GERGEN, KENNETH J.
TO DISCOVER HOW A PERSON'S (P) SELF-CONCEPT IS AFFECTED BY THE CHARACTERISTICS OF ANOTHER (O) WHO SUDDENLY APPEARS IN THE SAME SOCIAL ENVIRONMENT, SEVERAL QUESTIONNAIRES, INCLUDING THE GERGEN-MORSE (1967) SELF-CONSISTENCY SCALE AND HALF THE COOPERSMITH SELF-ESTEEM INVENTORY, WERE ADMINISTERED TO 78 UNDERGRADUATE MEN WHO HAD ANSWERED AN AD FOR WORK…
INFORMATION MODEL OF SOCIAL TRANSFORMATIONS
Directory of Open Access Journals (Sweden)
Мария Васильевна Комова
2013-09-01
Full Text Available The social transformation is considered as a process of qualitative changes of the society, creating a new level of organization in all areas of life, in different social formations, societies of different types of development. The purpose of the study is to create a universal model for studying social transformations based on their understanding as the consequence of the information exchange processes in the society. After defining the conceptual model of the study, the author uses the following methods: the descriptive method, analysis, synthesis, comparison.Information, objectively existing in all elements and systems of the material world, is an integral attribute of the society transformation as well. The information model of social transformations is based on the definition of the society transformation as the change in the information that functions in the society’s information space. The study of social transformations is the study of information flows circulating in the society and being characterized by different spatial, temporal, and structural states. Social transformations are a highly integrated system of social processes and phenomena, the nature, course and consequences of which are affected by the factors representing the whole complex of material objects. The integrated information model of social transformations foresees the interaction of the following components: social memory, information space, and the social ideal. To determine the dynamics and intensity of social transformations the author uses the notions of "information threshold of social transformations" and "information pressure".Thus, the universal nature of information leads to considering social transformations as a system of information exchange processes. Social transformations can be extended to any episteme actualized by social needs. The establishment of an information threshold allows to simulate the course of social development, to predict the
Understanding Members’ Attachment to Social Networking Sites
DEFF Research Database (Denmark)
Lim, Eric T. K.; Cyr, Dianne; Tan, Chee-Wee
2014-01-01
Social Networking Sites (SNSs) are pervasive phenomena in today’s society. With greater connectivity and interactivity enabled through emerging technologies, SNSs provide communication platforms for individuals to bridge spatial and temporal differences when making friends, sharing experiences......, socializing with others and much more. This study therefore endeavors to shed light on this growing trend by decomposing members’ motives for participating within SNSs into identity-based, bondbased and comparison-based attachments. Each of these forms of attachment in turn affects members’ cooperative...
Recommender systems for location-based social networks
Symeonidis, Panagiotis; Manolopoulos, Yannis
2014-01-01
Online social networks collect information from users' social contacts and their daily interactions (co-tagging of photos, co-rating of products etc.) to provide them with recommendations of new products or friends. Lately, technological progressions in mobile devices (i.e. smart phones) enabled the incorporation of geo-location data in the traditional web-based online social networks, bringing the new era of Social and Mobile Web. The goal of this book is to bring together important research in a new family of recommender systems aimed at serving Location-based Social Networks (LBSNs). The chapters introduce a wide variety of recent approaches, from the most basic to the state-of-the-art, for providing recommendations in LBSNs. The book is organized into three parts. Part 1 provides introductory material on recommender systems, online social networks and LBSNs. Part 2 presents a wide variety of recommendation algorithms, ranging from basic to cutting edge, as well as a comparison of the characteristics of t...
International Nuclear Information System (INIS)
Vanclay, Frank
2006-01-01
The 'International Principles for Social Impact Assessment' and the 'Principles and Guidelines for Social Impact Assessment in the USA', both developed under the auspices of the International Association for Impact Assessment and published in 2003, are compared. Major differences in the definition and approach to social impact assessment (SIA) are identified. The US Principles and Guidelines is shown to be positivist/technocratic while the International Principles is identified as being democratic, participatory and constructivist. Deficiencies in both documents are identified. The field of SIA is changing to go beyond the prevention of negative impacts, to include issues of building social capital, capacity building, good governance, community engagement and social inclusion
[Social representations of illness: Comparison of "expert" knowledge and "naïve" knowledge].
Jeoffrion, C; Dupont, P; Tripodi, D; Roland-Lévy, C
2016-06-01
The link between social practices and representations is now well known. But while many studies have focused on the social representation of mental illness, in various populations, few studies have focused on the notion of disease/illness by comparing professionals and non-professionals health workers representations. Indeed, the disease is both a reality described, explained and treated by medicine; for those who are affected by a disease, it is an individual experience with psychological, social and cultural impacts. The social representation is determined by the structure of the social groups in which it develops; therefore, it is a form of knowledge socially shaped and shared by the members of a social group. Several theoretical extensions have been elaborated and particularly, the structural approach and the central core theory. These approaches sustain the arguments of a hierarchical organization of a social representation with a central core surrounded by peripheral zones. The central core is common and shared by the majority of the members of a given group, whereas the peripheral zones provide space for the individualization of the social knowledge. The main goal of our study is to highlight the social representations of disease in health professionals (HP) and in non-health professionals (NHP). The group of HP has been differentiated into three subgroups: "medical doctors", "nurses" and "pharmacists", while that of NHP in two subgroups: those submitted to a "long period medical treatment" and those "without treatment". Our aim is to show that there are different social and professional Representations of disease. The professional representations are specific social representations related to professional contexts. We formulate the following assumptions (a) that the social representations of HP and NHP will be articulated around a common central core. Nevertheless, we expect to find specific peripheral elements related to professional status, based on
Self-referenced memory, social cognition, and symptom presentation in autism.
Henderson, Heather A; Zahka, Nicole E; Kojkowski, Nicole M; Inge, Anne P; Schwartz, Caley B; Hileman, Camilla M; Coman, Drew C; Mundy, Peter C
2009-07-01
We examined performance on a self-referenced memory (SRM) task for higher-functioning children with autism (HFA) and a matched comparison group. SRM performance was examined in relation to symptom severity and social cognitive tests of mentalizing. Sixty-two children (31 HFA, 31 comparison; 8-16 years) completed a SRM task in which they read a list of words and decided whether the word described something about them, something about Harry Potter, or contained a certain number of letters. They then identified words that were familiar from a longer list. Dependent measures were memory performance (d') in each of the three encoding conditions as well as a self-memory bias score (d' self-d' other). Children completed The Strange Stories Task and The Children's Eyes Test as measures of social cognition. Parents completed the SCQ and ASSQ as measures of symptom severity. Children in the comparison sample showed the standard SRM effect in which they recognized significantly more self-referenced words relative to words in the other-referenced and letter conditions. In contrast, HFA children showed comparable rates of recognition for self- and other-referenced words. For all children, SRM performance improved with age and enhanced SRM performance was related to lower levels of social problems. These associations were not accounted for by performance on the mentalizing tasks. Children with HFA did not show the standard enhanced processing of self- vs. other-relevant information. Individual differences in the tendency to preferentially process self-relevant information may be associated with social cognitive processes that serve to modify the expression of social symptoms in children with autism.
Dubey, Indu; Ropar, Danielle; de C. Hamilton, Antonia F.
2017-01-01
The recently proposed Social Motivation theory (Chevallier et al., Trends in cognitive sciences 16(4):231-239, 2012) suggests that social difficulties in Autism Spectrum Condition (ASC) might be caused by a difference in the motivation to engage with other people. Here we compared adolescents with (N = 31) and without (N = 37) ASC on the…
Maternal health among working women: A case study in the Mexican-U.S. border
Directory of Open Access Journals (Sweden)
Norma Ojeda de la Peña
1996-01-01
Full Text Available This work is a description of the differences in maternal health among women of the wage-earning class along the Mexican/United States border in Tijuana, Baja California. The study analyzes the specific case of women using the services of the Mexican Institute of Social Security (IMSS, breaking up the sample according to their employment and level of physical labor on the job in industrial, business, and service sectors. The study is based on information from a survey titled, "Social Conditions of Women and Reproductive Health in Tijuana".This was a post-partum survey administered to a total of 2,596 obstetrical patients seen at the Gynecology-. Obstetrics hospital of the Tijuana IMSSoffice during the spring of 1993.The results indicate differing maternal health oonditions among workers, in relation to some of the factors considered risks for infant and maternal health.
Le Blanc, Allura L; Bruce, Laura C; Heimberg, Richard G; Hope, Debra A; Blanco, Carlos; Schneier, Franklin R; Liebowitz, Michael R
2014-06-01
The Social Interaction Anxiety Scale and Social Phobia Scale are widely used measures of social anxiety. Using data from individuals with social anxiety disorder (n = 435) and nonanxious controls (n = 86), we assessed the psychometric properties of two independently developed short forms of these scales. Indices of convergent and discriminant validity, diagnostic specificity, sensitivity to treatment, and readability were examined. Comparisons of the two sets of short forms to each other and the original long forms were conducted. Both sets of scales demonstrated adequate internal consistency in the patient sample, showed expected patterns of correlation with measures of related and unrelated constructs, adequately discriminated individuals with social anxiety disorder from those without, and showed decreases in scores over the course of cognitive-behavioral therapy and/or pharmacotherapy. However, some significant differences in scale performance were noted. Implications for the clinical assessment of social anxiety are discussed. © The Author(s) 2014.
Directory of Open Access Journals (Sweden)
Rascón-Pacheco Ramón Alberto
2000-01-01
Full Text Available OBJETIVO: Presentar un instrumento que permita llevar a cabo la vigilancia epidemiológica y evaluar la calidad de la atención a la diabetes mellitus en el primer nivel de atención. MATERIAL Y MÉTODOS: Este estudio se realizó del 1 de enero de 1998 al 30 de junio de 1999, en la Unidad de Investigación Epidemiológica y en Servicios de Salud, del Instituto Mexicano del Seguro Social (IMSS, en Hermosillo, Sonora. Se diseñó un formato único de reporte compuesto por los diferentes elementos que integran el sistema para la atención del paciente diabético en una Unidad de Medicina Familiar del IMSS. RESULTADOS: Se desarrolló e implementó un paquete de computación (software que permite la captura de los datos de dicho formato y la generación de reportes, de tipo individual y grupal, sobre el cumplimiento de citas, antecedentes personales patológicos y no patológicos, evolución de signos y síntomas, exámenes de laboratorio y el manejo terapéutico. CONCLUSIONES: La sistematización de datos en forma electrónica favorece la obtención de información confiable y permanente para la vigilancia de los procesos en la atención integral del paciente diabético.
Gamma radiation sterilized amnion: use in ophthalmology
Energy Technology Data Exchange (ETDEWEB)
Martinez P, M. E. [ININ, Carretera Mexico-Toluca s/n, Ocoyoacac 52750, Estado de Mexico (Mexico); Leon T, Y. [Hospital General Regional 220, IMSS, Paseo Tollocan No. 620, Col. Vertice, Toluca 50150, Estado de Mexico (Mexico); Vazquez M, L., E-mail: esther.martinez@inin.gob.m [Hospital General de Mexico, Dr. Balmis 148, Col. Doctores, 06720 Mexico D. F. (Mexico)
2010-10-15
Amnion processed at the Radio sterilized Tissue Bank at the National Institute of Nuclear Research, sterilized with {sup 60}Co gamma radiation, have been used in Mexico since 2005 either as a graft to replace the damaged ocular surface, or as a patch to prevent unwanted inflammatory reactions. Patients from the Hospital General de Mexico (HGM) and Instituto Mexicano del Seguro Social (IMSS), suffering diverse pathologies such as keratoconjunctivitis; recurrent pterygium associated with symblepharon; corneal neuro trophic ulcers, chemical and thermal burns, and corneal thinning s, had been successfully treated with irradiated amnion. In the HGM, a clinical prospective study on lesions of the ocular surface of 17 eyes from 15 patients, affected with the above mentioned pathologies, was successful in 88.2%. The results have proven to be excellent as much for cosmetic purposes as for functional ones. Without the treatment, the patients could have suffered a healing after-effect or loss of sight. At IMSS, a controlled clinical randomized trial with 108 eyes from 100 patients, affected with primary nasal pterygium, was performed in 2009. These eyes were treated with radio sterilized amnion and intraoperative mitomycin C to prevent recurrence after excision of the primary pterygium. The preliminary results do not shown adverse reaction, inflammation and pain were significantly reduced radio sterilized amnion also offer security because they do no express antigens HLA-A, B or Dr and the sterile irradiated tissue do not provoke rejection or transmit an infective disease. (Author)
Gamma radiation sterilized amnion: use in ophthalmology
International Nuclear Information System (INIS)
Martinez P, M. E.; Leon T, Y.; Vazquez M, L.
2010-10-01
Amnion processed at the Radio sterilized Tissue Bank at the National Institute of Nuclear Research, sterilized with 60 Co gamma radiation, have been used in Mexico since 2005 either as a graft to replace the damaged ocular surface, or as a patch to prevent unwanted inflammatory reactions. Patients from the Hospital General de Mexico (HGM) and Instituto Mexicano del Seguro Social (IMSS), suffering diverse pathologies such as keratoconjunctivitis; recurrent pterygium associated with symblepharon; corneal neuro trophic ulcers, chemical and thermal burns, and corneal thinning s, had been successfully treated with irradiated amnion. In the HGM, a clinical prospective study on lesions of the ocular surface of 17 eyes from 15 patients, affected with the above mentioned pathologies, was successful in 88.2%. The results have proven to be excellent as much for cosmetic purposes as for functional ones. Without the treatment, the patients could have suffered a healing after-effect or loss of sight. At IMSS, a controlled clinical randomized trial with 108 eyes from 100 patients, affected with primary nasal pterygium, was performed in 2009. These eyes were treated with radio sterilized amnion and intraoperative mitomycin C to prevent recurrence after excision of the primary pterygium. The preliminary results do not shown adverse reaction, inflammation and pain were significantly reduced radio sterilized amnion also offer security because they do no express antigens HLA-A, B or Dr and the sterile irradiated tissue do not provoke rejection or transmit an infective disease. (Author)
Directory of Open Access Journals (Sweden)
Nili Ahmadabady Zahra
2014-08-01
Full Text Available Purpose: The purpose of this study was to comparison mental health, Physical symptoms, Anxiety and sleeping disorders and Disorders in social function among male and female athletes and non-athletes students. Methods: The target population consisted entirely male of female athletes and non-athletes students in University of Guilan. After translate of standard General Health Questionnaires (GHQ, and adjust of some question, questionnaires were evaluated by professors of faculty of physical education and sport sciences. The reliability guided Cronbach Alpha value of (0.83. Among them 90 male athlete and 90 male non-athlete with mean. The collected data was analyzed by t-test, one-way ANOVA. Result: There were significant difference mean scores between in four mental health scales, physical symptoms, anxiety and sleep disorders and impaired social functioning athlete and non-athlete in both groups. Conclusion: Therefore, with fewer psychological problems in an athlete, physical activity can be purpose strategies as appropriate, easy and inexpensive to improve mental health among male and female non- athlete students.
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available GVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 78 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYA...KLD Sbjct: 1 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVNGVPLDLINPPVLRIKVFEPLFIVGKENYAKLD 60 ... Query... putative [Entamoeba histolytica HM-1:IMSS] ... Length = 139 ... Query: 19 ... KSVQVFGKKKTAIAVCLCKEGKGMIRVN
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 0063 [Entamoeba histolytica HM-1:IMSS] ... Length = 201 ... Query: 34 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNV...IINFYIPICVIAIISIYQKNIEKGLTV 93 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNVIINFYIPICVIAIISIYQKNIEKGLTV Sbjct...: 8 ... VGFIPTHQEIPYKEDPNYMFSKLNDVIPRTMNVIINFYIPICVIAIISIYQKNIEKGLTV 67 ... Query: 154
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 170 ... Query: 24 ... VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVI...ISNNVSCSRKQCSI 83 ... VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVIISNNVSCSRKQCSI Sbjct: 21 ... ...VDAPTQKLRKPSVWATLRADDGGVITVLQLSKDKYTIGRSGNNDVIISNNVSCSRKQCSI 80 ... Query: 144 YSIIK
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available Entamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTSVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEG
A COMPARISON OF SOCIAL SKILLS OF STUDENTS WITH VISUAL IMPAIRMENTS AND TYPICALLY DEVELOPING STUDENTS
Demir, Fatih Emrah; Ozdemir, Selda
2016-01-01
The purpose of this study was to compare the social skills of students with visual impairments with social skills of typically developing students. The study groups consisted of 64 students with visual impairments and 68 typically developing students from the first to fourth grade. The Social Skills Rating System (SSRS) Teacher Form was used to evaluate the social skills of both groups. The results of the study indicated that cooperation, assertiveness, and self-control sub-scale scores and o...
Social networks and alcohol use among older adults: a comparison with middle-aged adults.
Kim, Seungyoun; Spilman, Samantha L; Liao, Diana H; Sacco, Paul; Moore, Alison A
2018-04-01
This study compared the association between social networks and alcohol consumption among middle-aged (MA) and older adults (OA) to better understand the nature of the relationship between those two factors among OA and MA. We examined Wave 2 of the National Epidemiologic Survey on Alcohol and Related Conditions. Current drinkers aged over 50 were subdivided into two age groups: MA (50-64, n = 5214) and OA (65 and older, n = 3070). Each age group was stratified into drinking levels (low-risk vs. at-risk) based on alcohol consumption. The size and diversity of social networks were measured. Logistic regression models were used to examine age differences in the association between the social networks (size and diversity) and the probability of at-risk drinking among two age groups. A significant association between the social networks diversity and lower odds of at-risk drinking was found among MA and OA. However, the relationship between the diversity of social networks and the likelihood of at-risk drinking was weaker for OA than for MA. The association between social networks size and at-risk drinking was not significant among MA and OA. The current study suggests that the association between social networks diversity and alcohol use among OA differs from the association among MA, and few social networks were associated with alcohol use among OA. In the future, research should consider an in-depth exploration of the nature of social networks and alcohol consumption by using longitudinal designs and advanced methods of exploring drinking networks.
The social impacts of dams: A new framework for scholarly analysis
International Nuclear Information System (INIS)
Kirchherr, Julian; Charles, Katrina J.
2016-01-01
No commonly used framework exists in the scholarly study of the social impacts of dams. This hinders comparisons of analyses and thus the accumulation of knowledge. The aim of this paper is to unify scholarly understanding of dams' social impacts via the analysis and aggregation of the various frameworks currently used in the scholarly literature. For this purpose, we have systematically analyzed and aggregated 27 frameworks employed by academics analyzing dams' social impacts (found in a set of 217 articles). A key finding of the analysis is that currently used frameworks are often not specific to dams and thus omit key impacts associated with them. The result of our analysis and aggregation is a new framework for scholarly analysis (which we call ‘matrix framework’) specifically on dams' social impacts, with space, time and value as its key dimensions as well as infrastructure, community and livelihood as its key components. Building on the scholarly understanding of this topic enables us to conceptualize the inherently complex and multidimensional issues of dams' social impacts in a holistic manner. If commonly employed in academia (and possibly in practice), this framework would enable more transparent assessment and comparison of projects.
Fardouly, Jasmine; Vartanian, Lenny R
2015-01-01
Use of social media, such as Facebook, is pervasive among young women. Body dissatisfaction is also highly prevalent in this demographic. The present study examined the relationship between Facebook usage and body image concerns among female university students (N=227), and tested whether appearance comparisons on Facebook in general, or comparisons to specific female target groups (family members, close friends, distant peers [women one may know but do not regularly socialize with], celebrities) mediated this relationship. Results showed a positive relationship between Facebook usage and body image concerns, which was mediated by appearance comparisons in general, frequency of comparisons to close friends and distant peers, and by upward comparisons (judging one's own appearance to be worse) to distant peers and celebrities. Thus, young women who spend more time on Facebook may feel more concerned about their body because they compare their appearance to others (especially to peers) on Facebook. Copyright © 2014 Elsevier Ltd. All rights reserved.
The publics and the government of life in social networks
Saulo Mota
2012-01-01
The goal of this study is an analysis of the relationship between the publics, analyzed by Gabriel Tarde and the government of practices of life, studied by Michel Foucault in the context of social networks, making a comparison between the practices of this kind of social grouping in the early twentieth century with its update in the social networks context in the twenty-first century. Initially we investigate the relationship between a private company with its public, identifying the salient...
Influence and Dissemination Of Sentiments in Social Network Communication Patterns
DEFF Research Database (Denmark)
Hillmann, Robert; Trier, Matthias
2013-01-01
Previous research suggests the existence of sentiments in online social networks. In comparison to real life human interaction, in which sentiments have been shown to have an influence on human behaviour, it is not yet completely understood which mechanisms explain how sentiments influence users ...... that express the same sentiment polarization. We interpret these findings and suggest future research to advance our currently limited theories that assume perceived and generalized social influence to path-dependent social influence models that consider actual behaviour....
Justifications and comparisons in the division of household labor: the relevance of gender ideology.
Martínez, Carmen; Paterna, Consuelo; Yago, Carmen
2010-05-01
This study tests the direct relevance of justifications and social comparisons (predictors of perceptions of fairness) on different types of household labour distribution, and the importance of masculinity ideology and neosexism on these variables. The participants were heterosexual dual-earner couples. Our results showed that both men and women use more justifications when their housework distribution is not equal, but only women use social comparisons associated with the ways of distributing domestic work. In addition, we observe that, in both men and women, justifications are related to a traditional masculine ideology, but a different model appears in relation to comparisons which are associated with neosexism in men and with traditional masculine ideology in women. Implications and suggestions for future research are discussed.
Socialization Processes and Clergy Offenders.
Anderson, Jane
2016-01-01
This article uses feminist theory to investigate how the socialization processes used to maintain the clergy community in the Roman Catholic Church contributes to a vulnerability in some clergy for sexually abusing children. This vulnerability is identified first in an examination of the literature on the impact of socialization processes on clergy offenders between the 1960s and 1980s. A comparison is then made with the implications of the apostolic exhortation, Pastores Dabo Vobis, which provides a theological basis to clergy formation. The article argues that the document works to ensure a continuity of socialization processes that not only have been shown to create a vulnerability for committing child sexual abuse but compound existing vulnerabilities. The article concludes that constraints produced by the preservation of a hegemonic masculinity and patriarchy retain a threat of violence against children and require recommended reforms.
Daneshvar, Sabrina D; Charlop, Marjorie H; Berry Malmberg, Debra
2018-05-21
To compare the efficacy of two procedures, a photo activity schedule intervention and Social Stories, to teach social skills to four children diagnosed with Autism Spectrum Disorder (ASD). An adapted alternating treatments design with an additional multiple baseline control was used, and two social skills were targeted for each of the four participants, one under each intervention condition. Results indicated that all four participants learned the target social behaviours with the photo activity schedule intervention, but did not learn target social behaviours with Social Stories. Findings support the use of a photo activity intervention for teaching social skillsto children with ASD; we discuss the implications of inconsistent findings of effectiveness of Social Stories.
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ve [Entamoeba histolytica HM-1:IMSS] ... Length = 179 ... Query: 8 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERN...AQKRLEMLKDIVGSLGENSCILP 67 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERNAQKRLEMLKDIVGSLGENSCILP Sbjct: ...1 ... ERSLMLNGKLYDSTVPELAHDRESCCEKIIDFNCERNAQKRLEMLKDIVGSLGENSCILP 60 ... Query: 128 E
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available tamoeba histolytica HM-1:IMSS] ... Length = 219 ... Query: 344 EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSN...DGNEI 403 ... EPAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI Sbjct: 1 ... E...PAQADPENTYADGEGVEKCDAGKGPVKFTIHCVNKVGTAVPVTGAKFKVIIRSNDGNEI 60 ... Query: 464 GVEGGV
CROSS-SECTORAL YOUTH POLICY: CONCEPT AND MODERN TECHNOLOGIES OF SOCIAL PARTNERSHIP
Directory of Open Access Journals (Sweden)
Angelina Vladimirovna Borodina
2016-01-01
As a result, prospects of social dialogue concerning youth lie in expansion of number of partners and expansion of area of the solved problems in comparison with traditional tripartite social-labor interaction; reformation of youth policy management from the subject-object form; the training of the culture of cross-sectoral partnership for partners.
Trends in Social Science: The Impact of Computational and Simulative Models
Conte, Rosaria; Paolucci, Mario; Cecconi, Federico
This paper discusses current progress in the computational social sciences. Specifically, it examines the following questions: Are the computational social sciences exhibiting positive or negative developments? What are the roles of agent-based models and simulation (ABM), network analysis, and other "computational" methods within this dynamic? (Conte, The necessity of intelligent agents in social simulation, Advances in Complex Systems, 3(01n04), 19-38, 2000; Conte 2010; Macy, Annual Review of Sociology, 143-166, 2002). Are there objective indicators of scientific growth that can be applied to different scientific areas, allowing for comparison among them? In this paper, some answers to these questions are presented and discussed. In particular, comparisons among different disciplines in the social and computational sciences are shown, taking into account their respective growth trends in the number of publication citations over the last few decades (culled from Google Scholar). After a short discussion of the methodology adopted, results of keyword-based queries are presented, unveiling some unexpected local impacts of simulation on the takeoff of traditionally poorly productive disciplines.
A genomic comparison of two termites with different social complexity.
Korb, Judith; Poulsen, Michael; Hu, Haofu; Li, Cai; Boomsma, Jacobus J; Zhang, Guojie; Liebig, Jürgen
2015-01-01
The termites evolved eusociality and complex societies before the ants, but have been studied much less. The recent publication of the first two termite genomes provides a unique comparative opportunity, particularly because the sequenced termites represent opposite ends of the social complexity spectrum. Zootermopsis nevadensis has simple colonies with totipotent workers that can develop into all castes (dispersing reproductives, nest-inheriting replacement reproductives, and soldiers). In contrast, the fungus-growing termite Macrotermes natalensis belongs to the higher termites and has very large and complex societies with morphologically distinct castes that are life-time sterile. Here we compare key characteristics of genomic architecture, focusing on genes involved in communication, immune defenses, mating biology and symbiosis that were likely important in termite social evolution. We discuss these in relation to what is known about these genes in the ants and outline hypothesis for further testing.
Xu, Qiong; Mocarski, Richard
2014-01-01
This survey of American and Chinese students at a state university in the southern United States measures Social Media (SM) use and attitudes toward SM. The purpose of this study was to investigate student perception and motivation of social media communication and the relationship between student cultural values and their social media…
Social phobia in coeliac disease.
Addolorato, Giovanni; Mirijello, Antonio; D'Angelo, Cristina; Leggio, Lorenzo; Ferrulli, Anna; Vonghia, Luisa; Cardone, Silvia; Leso, Veruscka; Miceli, Antonio; Gasbarrini, Giovanni
2008-01-01
A high prevalence of anxiety and depression has been reported in coeliac disease (CD). Although social phobia is included among the anxiety disorders, its presence in CD has never been investigated. The aim of the present study was to evaluate social phobia in CD patients. A total of 40 CD patients were consecutively enrolled in the study. Fifty healthy subjects were studied as controls. Social phobia was assessed by the Liebowitz Social Anxiety Scale (LSAS) and current depression by the modified version of the Zung Self-rating Depression Scale (M-SDS). The percentage of subjects with social phobia was significantly higher in CD patients than in controls (70% versus 16%; psocial phobia was not statistically different between newly diagnosed subjects and patients on a gluten free diet (73.3% versus 68%; p: NS), nor considering its generalized form (7.0% versus 20%; p: NS). Current depression was present in a significantly higher percentage of CD patients in comparison with controls (52.5% versus 8%; psocial phobia and current depression was found in CD patients (r=0.582; psocial phobia in CD patients compared with in healthy subjects. Future studies are needed to clarify the possible social phobia-induced risks such as school and/or work failure in CD patients.
Soltani, Batoul; Keyvanara, Mahmoud
2013-01-01
Iranian students vs. 47.6% for non-Iranians), motivational aspect (59.0% vs. 42.6%), behavioral aspect (31.8% vs. 41.2%) as well as social adaptability as the other variable in question ( 68.9% vs. 56.2%) (p<0.001). The comparison of the mean scores gained for meta-cognitive and motivational aspects of cultural intelligence as well as social adaptability in Iranian and non-Iranian students resided in the dormitories of Isfahan University of Medical Sciences revealed that the Iranian students had the higher rank. On the other hand, the mean score acquired for the behavioral aspect in Iranian and non-Iranian students were comparable, with non-Iranian students having the higher mean scores. Therefore, it can be said that the meta-cognitive and motivational aspects of cultural intelligence and social adaptability of non-Iranian students and the behavioral aspect of Iranian students' cultural intelligence may be promoted by educational planning, thereby, taking effective steps towards their achievement in contexts with inter-cultural interaction . In this way, their mental health will be enhanced, as well.
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available protein LSm2, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 69 ... Query: 5 ... SFFKTLIGKEVVVELKNDVI...ITGTLIAVDQMLNIKLNNLKCDATLFPQIQTMTDCFIRGN 64 ... SFFKTLIGKEVVVELKNDVIITGTLIAVDQMLNIKLNNLKC...DATLFPQIQTMTDCFIRGN Sbjct: 1 ... SFFKTLIGKEVVVELKNDVIITGTLIAVDQMLNIKLNNLKCDATLFPQIQTMTDCFIRGN 60 ...
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 248 KASKLTQSSECI...PLIEENVKLLEHARTITVGMNNVRKFIFMKNQSIENIIATAQTVSSNI 307 ... KASKLTQSSECIPLIEENVKLLEHARTITVGM...NNVRKFIFMKNQSIENIIATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM
Social capital across urban neighborhoods: A comparison of self-report and observational data
Hill, J.M.; Jobling, R.; Pollet, T.V.; Nettle, D.
2014-01-01
Previous self-report survey research has demonstrated significant variation in social trust and neighborhood social ties between two neighborhoods of contrasting socioeconomic fortunes within the same English city. Residents in a deprived neighborhood reported that they trusted their neighbors less
Social representations about cancer
Directory of Open Access Journals (Sweden)
Andreja Cirila Škufca
2003-09-01
Full Text Available In this article we are presenting the results of the comparison study on social representations and causal attributions about cancer. We compared a breast cancer survivors group and control group without own experience of cancer of their own. Although social representations about cancer differ in each group, they are closely related to the concept of suffering, dying and death. We found differences in causal attribution of cancer. In both groups we found a category of risky behavior, which attributes a responsibility for a disease to an individual. Besides these factors we found predominate stress and psychological influences in cancer survivors group. On the other hand control group indicated factors outside the ones control e.g. heredity and environmental factors. Representations about a disease inside person's social space are important in co-shaping the individual process of coping with own disease. Since these representations are not always coherent with the knowledge of modern medicine their knowledge and appreciation in the course of treatment is of great value. We find the findingss of applied social psychology important as starting points in the therapeutic work with patients.
Social Work Literature Searching: Current Issues with Databases and Online Search Engines
McGinn, Tony; Taylor, Brian; McColgan, Mary; McQuilkan, Janice
2016-01-01
Objectives: To compare the performance of a range of search facilities; and to illustrate the execution of a comprehensive literature search for qualitative evidence in social work. Context: Developments in literature search methods and comparisons of search facilities help facilitate access to the best available evidence for social workers.…
Directory of Open Access Journals (Sweden)
Arnoldo Rocha-García
2003-08-01
two hospitals of the Mexican Institute of Social Security (Instituto Mexicano del Seguro Social -IMSS-. MATERIAL AND METHODS: A cross-sectional study was conducted in Mexico City and Leon, Guanajato, Mexico in 1997. The study population consisted of the parents of 51 children under 15 years of age diagnosed with leukemia, who were hospitalized for the first time in two IMSS hospitals. A questionnaire was applied to participants to obtain direct and indirect expenditures during that period. Consumer price indexes (1997-2002 were used to estimate expenditure prices for 2002. Average expenditures and catastrophic expenditures were estimated. Factors associated with expenditures were analyzed using a linear regression model in which the dependent variable was the total household expenditures during hospitalization. RESULTS: The average household cost per hospitalization was 7 318 pesos, 86% of which corresponded to medical care and 14% to indirect costs. Catastrophic expenditures occurred in 14% of households. In 47% of household expenditures exceeded 100% of the total household income during the hospitalization period. Expenditures during hospitalization were associated with place of residence, income level, and type of medical insurance. CONCLUSIONS: Being an IMSS policyholder decreased out-of-pocket expenditures, but not complementary expenditures, which may still be unaffordable for a large segment of the population. For more than a half of the households studied, continuity of care was compromised, as expenditures during the first hospitalization entailed using up savings, going into debt, and/or selling household property.
Effectiveness of two rehabilitation strategies provided by nurses for stroke patients in Mexico.
Torres-Arreola, Laura del Pilar; Doubova Dubova, Svetlana Vladislavovna; Hernandez, Sergio F; Torres-Valdez, Laura E; Constantino-Casas, Norma P; Garcia-Contreras, Fernando; Torres-Castro, Sara
2009-11-01
Rehabilitation strategies have been developed to improve functional state in stroke patients. The main objective of this study was to evaluate the effectiveness of the early rehabilitation at hospital and its continuity at home provided by nurses, on the functional recovery of basic and social activities in stroke patients compared with conventional care. A randomised clinical trial was carried out in three general hospitals of the Mexican Institute of Social Security (IMSS) in Mexico City between April 2003-May 2004. Stroke patients. Two rehabilitation strategies provided by nurses for stroke patients were compared: physiotherapy plus caregiver education in rehabilitation (strategy 1, S1) vs. education alone (strategy 2, S2). The main outcome variables were the basic (Barthel index) and social (Frenchay activities index) activities of daily living, of each patient. Age, sex, morbidity, stroke symptoms, complications, neurological damage (Canadian Scale), cognitive state (mini-mental state examination questionnaire) and duration of hospitalisation were defined as the control variables. Patients were evaluated at baseline and months one, three and six thereafter. One hundred and ten patients with ischaemic stroke were enrolled and randomised; 59 were assigned to S1 and 51 to S2. Comparison of the outcome variables showed that patients improved significantly over time, but no differences were observed between groups. We observed no significant difference in strategy performance with regard to the basic and instrumental activities of daily living. Participants who received physiotherapy with additional caregiver education benefit no more than those whose caregivers received education alone. Those countries that do not have integral rehabilitation programmes for stroke patients should understand their importance and budget resources for them. Meanwhile, both caregiver education and nurses trained in specific care and physiotherapy are alternatives that benefit these
Current use of Social Media in Neurosurgery in Spain.
Mata-Gómez, Jacinto; Gilete-Tejero, Ignacio Javier; Rico-Cotelo, María; Royano-Sánchez, Manuel; Ortega-Martínez, Marta
To analyze the current situation in Spain of the use of Social Media in Neurosurgery. We made an observational transversal study between February and March 2017, with a systematic search of the Facebook, Twitter and Youtube accounts from public and private neurosurgical units, scientific societies, peer-reviewed publications and patients groups in relation with Neurosurgical pathologies. We rank them according their popularity. According of our search only 5 public neurosurgical services have social media accounts, being their popularity inferior to the private units accounts. In relation with the scientific societies and neurosurgical publications their presence in social media is marginal, even more in comparison to the accounts of other medical specialities. The popularity of associations of patients and supporting groups is high, especially among patients, finding there more information about their disease. The use in Spain of Social Media about Neurosurgery is low in comparison to other medical specialities. There is a huge field to improve the popularity of the accounts, making in them promotion of health and extend the diffusion of the scientific society and the peer-reviewed publication Neurocirugía. Copyright © 2018 Sociedad Española de Neurocirugía. Publicado por Elsevier España, S.L.U. All rights reserved.
Consumers' perceptions of corporate social responsibilities : A cross-cultural comparison
Maignan, [No Value
Based on a consumer survey conducted in France, Germany, and the U.S., the study investigates consumers' readiness to support socially responsible organizations and examines their evaluations of the economic, legal, ethical, and philanthropic responsibilities of the firm. French and German consumers
International Nuclear Information System (INIS)
1997-01-01
The objective of the Intelligent Mobile Sensor System (IMSS) project is to develop an operational system for monitoring and inspection activities for waste storage facility operations at several DOE sites. Specifically, the product of this effort is a robotic device with enhanced intelligence and maneuverability capable of conducting routine inspection of stored waste drums. The system has an integrated sensor suite for problem-drum detection, and is linked to a site database both for inspection planning and for data correlation, updating, and report generation. The system is capable of departing on an assigned mission, collecting required data, recording which portions of its mission had to be aborted or modified due to environmental constraints, and reporting back when the mission is complete. Successful identification of more than 96% of drum defects has been demonstrated in a high fidelity waste storage facility mockup. Identified anomalies included rust spots, rust streaks, areas of corrosion, dents, and tilted drums. All drums were positively identified and correlated with the site database. This development effort is separated into three phases of which phase two is now complete. The second phase demonstrated a prototype system appropriate for operational use in an actual storage facility. The prototype provides an integrated design that considers operational requirements, hardware costs, maintenance, safety, and robustness. The final phase will demonstrate commercial viability using the prototype vehicle in a pilot waste operations and inspection project. This report summarizes the design and evaluation of the new IMSS Phase 2 system and vehicle. Several parts of the IMSS Phase 1 Topical (Final) Report, which describes the requirements, design guidelines, and detailed design of the Phase 1 IMSS vehicle, are incorporated here, with modifications to reflect the changes in the design and the new elements added during the Phase 2 work
A genomic comparison of two termites with different social complexity
Directory of Open Access Journals (Sweden)
Judith eKorb
2015-03-01
Full Text Available The termites evolved eusociality and complex societies before the ants, but have been studied much less. The recent publication of the first two termite genomes provides a unique comparative opportunity, particularly because the sequenced termites represent opposite ends of the social complexity spectrum. Zootermopsis nevadensis has simple colonies with totipotent workers that can develop into all castes (dispersing reproductives, nest-inheriting replacement reproductives, and soldiers. In contrast, the fungus-growing termite Macrotermes natalensis belongs to the higher termites and has very large and complex societies with morphologically distinct castes that are life-time sterile. Here we compare key characteristics of genomic architecture, focusing on genes involved in communication, immune defenses, mating biology and symbiosis that were likely important in termite social evolution. We discuss these in relation to what is known about these genes in the ants and outline hypotheses for further testing.
Fusing Recommendations for Social Bookmarking Websites
DEFF Research Database (Denmark)
Bogers, Toine; van den Bosch, Antal
2011-01-01
Social bookmarking websites are rapidly growing in popularity. Recommender systems, a promising remedy to the information overload accompanying the explosive growth in content, are designed to identify which unseen content might be of interest to a particular user, based on his or her past...... that use tag overlap and metadata provide better results for social bookmarking data sets than the transaction patterns that are used traditionally in recommender systems research. In addition, we investigate how to fuse different recommendation approaches to further improve recommendation accuracy. We...... preferences. Most previous work in recommendation for social bookmarking suffers from a lack of comparisons between the different available approaches. In this article, we address this issue by comparing and evaluating eight recommendation approaches on four data sets from two domains. We find that approaches...
Similar and contrasting dimensions of social cognition in schizophrenia and healthy subjects.
Mehta, Urvakhsh Meherwan; Thirthalli, Jagadisha; Bhagyavathi, H D; Keshav Kumar, J; Subbakrishna, D K; Gangadhar, Bangalore N; Eack, Shaun M; Keshavan, Matcheri S
2014-08-01
Schizophrenia patients experience substantial impairments in social cognition (SC) and these deficits are associated with their poor functional outcome. Though SC is consistently shown to emerge as a cognitive dimension distinct from neurocognition, the dimensionality of SC is poorly understood. Moreover, comparing the components of SC between schizophrenia patients and healthy comparison subjects would provide specific insights on the construct validity of SC. We conducted principal component analyses of eight SC test scores (representing four domains of SC, namely, theory of mind, emotion processing, social perception and attributional bias) independently in 170 remitted schizophrenia patients and 111 matched healthy comparison subjects. We also conducted regression analyses to evaluate the relative contribution of individual SC components to other symptom dimensions, which are important clinical determinants of functional outcome (i.e., neurocognition, negative symptoms, motivational deficits and insight) in schizophrenia. A three-factor solution representing socio-emotional processing, social-inferential ability and external attribution components emerged in the patient group that accounted for 64.43% of the variance. In contrast, a two-factor solution representing socio-emotional processing and social-inferential ability was derived in the healthy comparison group that explained 56.5% of the variance. In the patient group, the social-inferential component predicted negative symptoms and motivational deficits. Our results suggest the presence of a multidimensional SC construct. The dimensionality of SC observed across the two groups, though not identical, displayed important parallels. Individual components also demonstrated distinct patterns of association with other symptom dimensions, thus supporting their external validity. Copyright © 2014 Elsevier B.V. All rights reserved.
Lead poisoning and marginalization in newborns of Morelos, Mexico
Directory of Open Access Journals (Sweden)
Martha María Téllez-Rojo
2017-05-01
Full Text Available Objective. To determine the prevalence of lead (Pb poi- soning at birth in Morelos, analyze its distribution by social marginalization level, and estimate the association with the use of lead glazed ceramics (LGC. Materials and methods. Blood lead level (BLL in umbilical cord was measured in a representative sample of 300 randomly selected births at the Morelos Health Services and state IMSS. Results. The prevalence of Pb poisoning at birth (BLL> 5µg/dL was 14.7%(95%CI: 11.1, 19.3 and 22.2% (95%CI: 14.4, 32.5 in the most socially marginalized municipalities. 57.1% (95%CI: 51.3, 62.7of the mothers used LGC during pregnancy, and the frequency of use was significantly associated with BLL. Conclusion. This is the first study to document the proportion of new- borns with Pb poisoning who are at risk of experiencing the related adverse effects. It is recommended to monitor BLL at birth and take action to reduce this exposure, especially in socially marginalized populations.
ORF Alignment: EHA1 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available 2B delta subunit, putative [Entamoeba ... histolytica HM-1:IMSS] ... Length = 249 ... Query: 363 KASKLTQSSECI...PL------------------------XXXXXXXXXXXXATAQTVSSNI 398 ... KASKLTQSSECIPL ... ... ... ATAQTVSSNI Sbjct: 1 ... KASKLTQSSECIPLIEENVKLLEHARTITVGMNNVRKFIFM
The social distance theory of power.
Magee, Joe C; Smith, Pamela K
2013-05-01
We propose that asymmetric dependence between individuals (i.e., power) produces asymmetric social distance, with high-power individuals feeling more distant than low-power individuals. From this insight, we articulate predictions about how power affects (a) social comparison, (b) susceptibility to influence, (c) mental state inference and responsiveness, and (d) emotions. We then explain how high-power individuals' greater experienced social distance leads them to engage in more abstract mental representation. This mediating process of construal level generates predictions about how power affects (a) goal selection and pursuit, (b) attention to desirability and feasibility concerns, (c) subjective certainty, (d) value-behavior correspondence, (e) self-control, and (f) person perception. We also reassess the approach/inhibition theory of power, noting limitations both in what it can predict and in the evidence directly supporting its proposed mechanisms. Finally, we discuss moderators and methodological recommendations for the study of power from a social distance perspective.