WorldWideScience

Sample records for slate

  1. The Slate Garden

    CERN Multimedia

    Alexandre Pelletier and Anaïs Schaeffer

    2011-01-01

    On the patio of the Main Building, a new garden has been unveiled. Inspired by physicists themselves, the garden uses a clever combination of flower arrangements and slate slabs to create the shape of the CMS particle tracker.   Scribbling, crossing out, and writing over it again. In an age of digital "tablets", scientists have remained faithful to the traditional blackboard... the inspiration for the Slate Garden. Completed just a few days ago on the Main Building patio (Building 500), the garden was designed by landscape architect Laurent Essig – who also created the InGRID installation outside Building 33 – and is the perfect combination of organic and mineral materials. Composed of 100 pieces of slate laid across three concentric circles, the work recalls the elegant lines of the CMS particle tracker. The project was completed thanks to the collaboration of a number of CERN technical services, in particular the Green Spaces Service, the Transport Serv...

  2. Electra-slate. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Lane, M

    2004-09-15

    The aim of this project was to develop a photovoltaic (PV) roofing tile that could safely be installed by any roofer without additional training and supervision on a roof constructed using a traditional truss/rafter/felt/batten approach. It is hoped that such a tile, which would closely resemble conventional roofing tiles, would overcome the conservatism of the UK building industry to new ideas. The project involves improving on the design of 'Electra-Slate', a solar roof slate using thin film silicon that was originally produced in 2003 by ICP Solar Technologies and PV Systems. The overall aim is to design a slate that would be simple to install, robust for site handling, visually similar to standard slates and suitable for distribution through builders merchants. The design specification of the Electra-Slate has now been finalised and prototypes produced to prove the concept in terms of both installation and manufacturing. A laser system that replaces the need for four separate laser systems taking over 20 minutes processing time, a two-part connector (the female on the slate and the male on the wiring loom) and an effective system of mounting the Electra-Slate without the need to drill holes have been developed. ICP will now be able to undertake post qualification production of Electra-Slate and to seek collaborators for large-scale manufacture and launch of the product.

  3. Traditional application of slates in Uruguay

    Science.gov (United States)

    Morales Demarco, Manuela; Cardenes Van den Eynde, Víctor

    2017-04-01

    Commercial slates in Uruguay are represented by dolomitic and pelitic slates, which are known in the local market with the generic name of "piedra laja". The dolomitic slates, or more precisely the "slaty dolomitic semipelites" and "slaty dolomitic metacarbonate rocks" (following the nomenclature of the British Geological Survey for metamorphic rocks, Robertson 1999), dominates the production since 1960. The mining started in a quarry called "Libro Gigante", which means "giant book" in Spanish, as the slaty cleavage of these rocks is almost vertical, which resembles a book when looked from far away. These slates integrate the Lavalleja Group, a unit that comprises the schist belt of the Neoproterozoic Dom Feliciano Belt that crops out in south-eastern Uruguay. According to Morales Demarco et al (2013), there are two active slate mining districts in this region: the northern, called "Arroyo Minas Viejas Mining District", from where light grey, light and dark green and green-red slate varieties are mined, and the southern called "Arroyo Mataojo Mining District" and where only dark grey slates are extracted. Few kilometres eastern from these districts, and still in Lavalleja Group, a quarry of slaty dolomitic pelite is found with sporadic production. Far to the east, the slaty muscovitic pelites of Rocha Group are mined from one quarry in "Puntas del Chafalote". The traditional applications of these slates in the country are as façade cladding and floor slabs, both indoor and outdoor. The potential use of the dolomitic slates as roofing slates has been investigated and discarded by Morales Demarco et al (2013), as the slabs resulting from splitting are too thick (0.5 to 2 cm) and thus too heavy for this application. The parameter that controls the fissility of slates is the mass value (Bentz and Martini, 1968; DIN EN 12326-2, 2000) and is very important to determine their potential applications. It takes into account the number of mica layers per mm and the average

  4. Clean slate corrective action investigation plan

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-05-01

    The Clean Slate sites discussed in this report are situated in the central portion of the Tonopah Test Range (TTR), north of the Nevada Test Site (NTS) on the northwest portion of the Nellis Air Force Range (NAFR) which is approximately 390 kilometers (km) (240 miles [mi]) northwest of Las Vegas, Nevada. These sites were the locations for three of the four Operation Roller Coaster experiments. These experiments evaluated the dispersal of plutonium in the environment from the chemical explosion of a plutonium-bearing device. Although it was not a nuclear explosion, Operation Roller Coaster created some surface contamination which is now the subject of a corrective action strategy being implemented by the Nevada Environmental Restoration Project (NV ERP) for the U.S. Department of Energy (DOE). Corrective Action Investigation (CAI) activities will be conducted at three of the Operation Roller Coaster sites. These are Clean Slate 1 (CS-1), Clean Slate 2 (CS-2), and Clean Slate 3 (CS-3) sites, which are located on the TTR. The document that provides or references all of the specific information relative to the various investigative processes is called the Corrective Action Investigation Plan (CAIP). This CAIP has been prepared for the DOE Nevada Operations Office (DOE/NV) by IT Corporation (IT).

  5. Clean slate corrective action investigation plan

    International Nuclear Information System (INIS)

    1996-05-01

    The Clean Slate sites discussed in this report are situated in the central portion of the Tonopah Test Range (TTR), north of the Nevada Test Site (NTS) on the northwest portion of the Nellis Air Force Range (NAFR) which is approximately 390 kilometers (km) (240 miles [mi]) northwest of Las Vegas, Nevada. These sites were the locations for three of the four Operation Roller Coaster experiments. These experiments evaluated the dispersal of plutonium in the environment from the chemical explosion of a plutonium-bearing device. Although it was not a nuclear explosion, Operation Roller Coaster created some surface contamination which is now the subject of a corrective action strategy being implemented by the Nevada Environmental Restoration Project (NV ERP) for the U.S. Department of Energy (DOE). Corrective Action Investigation (CAI) activities will be conducted at three of the Operation Roller Coaster sites. These are Clean Slate 1 (CS-1), Clean Slate 2 (CS-2), and Clean Slate 3 (CS-3) sites, which are located on the TTR. The document that provides or references all of the specific information relative to the various investigative processes is called the Corrective Action Investigation Plan (CAIP). This CAIP has been prepared for the DOE Nevada Operations Office (DOE/NV) by IT Corporation (IT)

  6. Clean Slate 1 revegetation and monitoring plan

    International Nuclear Information System (INIS)

    1996-09-01

    This document is a reclamation plan for short-term and long-term stabilization of land disturbed by activities associated with interim cleanup of radionuclide-contaminated surface soil at the Clean Slate 1 site (located on the Tonopah Test Range). This document has been prepared to provide general reclamation practices and procedures that will be followed during restoration of the cleanup site. Reclamation demonstration plots were established near the Double Tracks cleanup site in the fall of 1994 to evaluate the performance of several native plant species and to evaluate different irrigation strategies. Results of that study, and the results from numerous other studies conducted at other sites (Area 11 and Area 19 of the Nevada Test Site), have been summarized and incorporated into this final reclamation plan for the cleanup of the Clean Slate 1 site. The plan also contains procedures for monitoring both short-term and long-term reclamation

  7. Clean Slate 2 Revegetation and Monitoring Plan

    International Nuclear Information System (INIS)

    David Anderson

    1998-01-01

    This document is a reclamation plan for short-term and long-term stabilization of land disturbed by activities associated with interim clean-up of radionuclide-contaminated surface soil at Clean Slate 2 located northwest of the Nevada Test Site on the Nellis Air Force Range. Surface soils at Clean Slate 2 were contaminated as a result of the detonation of a device containing plutonium and depleted uranium using chemical explosives. Excavation of contaminated soils at Clean Slate 2 will follow procedures similar to those used during the cleanup of the Double Tracks and Clean Slate 1 sites. A maximum of approximately 33 cm (12 in) of the surface soils will be excavated and removed from the site. Near ground zero, where contamination levels are highest, approximately 2 m (7 ft) of soil may be removed. The maximum area to be excavated is estimated to be 18.4 hectares (45.4) acres. In addition to the disturbance associated with soil excavation, approximately 2.0 hectares (5.0) acres will be disturbed by the construction of staging areas and placement of support facilities. Short term stabilization consists of an application of a chemical soil stabilizer and long-term stabilizations involves the establishment of a permanent vegetative cover using selective native plant species, site preparation techniques, increasing organic matter and water holding capacity, irrigation to ensure seed germination and plant establishment. The cleanup site will be monitored to ensure success of revegetation and resuspension of soil particles is within established limits

  8. Geotechnical design of underground slate mines

    International Nuclear Information System (INIS)

    Iglesias Comesaña, C.; Taboada Castro, J.; Arzúa Touriño, J.; Giráldez Pérez, E.; Martín Suárez, J.M.

    2017-01-01

    Slate is one of the most important natural materials in Spain, with a potent extractive and processing industry concentrated in the autonomous communities of Galicia, Castile and León. Thanks to its resistance to external agents, its impermeability and its excellent cleavability, slate is used as for roofing and tiling. Almost all the active exploitations in our country where this resource is extracted are open pit mines, where the exploitation ratios have nearly reached their economic limit, making it necessary to look for alternatives that will allow the mining works to be continued. Underground mining is a solution that offers low exploitation ratios, with low spoil generation. The room-and-pillar method with barrier pillars is usually applied for the exploitation of slate deposits. There are several factors to be taken into account when designing a mine (economic, logistical, geotechnical, technical, environmental…), especially for an underground mine. This study focuses on the geotechnical design process of a room-and-pillar underground mine, based on the tributary area theory, the analysis of the tensions in the ground with numerical methods and the choice of an appropriate reinforcement in view of the expected instabilities. This explanation is completed with an example of a design that includes the estimate exploitation rates and production. [es

  9. Characteristic roofing slates from Spain: Mormeau and Los Molinos

    Science.gov (United States)

    Cardenes Van den Eynde, Victor; Cnudde, Veerle; Cnudde, Jean Pierre

    2014-05-01

    Characteristic roofing slates from Spain: Mormeau and Los Molinos Cardenes1, V., Cnudde1, V., Cnudde1, J.P. 1 Department of Geology and Soil Science, Ghent University, Krijgslaan 281, S8, 9000 Ghent, Belgium. The world's major roofing slate outcrops are found in the NW of Spain, in the Ordovician terrains of the domain of the Truchas Syncline. In this remote area, slate was quarried since ancient times for the use of the inhabitants of the region. Half of a century ago, an industrialization process took place in this area, which began to produce high quality roofing slate for many buildings from Japan to the USA, and especially in Europe. Since then, Spanish slate roofing has been widely used for new buildings and also for restoration of historical buildings. This work revises the occurrence and characteristics of the two most representative grey slate varieties from the Truchas Syncline, Mormeau, a fine-grained slate, and Los Molinos, also a grey slate with a slightly coarser grain. Both slates have a very similar aspect, but Mormeau slate have some iron sulphides on its composition that sometimes forms oxidation spots. Mormeau beds are found at the Middle-Upper Ordovician age Casaio Formation, while Los Molinos beds are located at the Rozadais Formation, of age Upper Ordovician, defined as formation just for the Truchas Syncline domain. Both slates have a high degree of homogeneity on their constructive characteristics, with a typical composition of quartz, mica and chlorites, and a metamorphic degree corresponding to the green schists facies. This work revises the history and characteristics of both slates, that can be considered as lithotypes that can be used as a reference during the prospection of new slate outcrops worldwide. The presented varieties of slate are proposed for their inclusion as Global Heritage Stones.

  10. Clean Slate 1 revegetation and monitoring plan

    International Nuclear Information System (INIS)

    Anderson, D.C.; Hall, D.B.

    1997-07-01

    This document constitutes a reclamation plan for the short-term and long-term stabilization of land disturbed by activities associated with the cleanup of radionuclide contaminated surface soil at the Clean Slate 1 site. This document has been prepared to provide general reclamation practices and procedures that will be followed during restoration of the cleanup site. The results of reclamation trials at Area 11, Area 19 and more recently the reclamation demonstration plots at the Double Tracks cleanup site, have been summarized and incorporated into this reclamation and monitoring plan. The plan also contains procedures for monitoring both the effectiveness and success of short-term and long-term soil stabilization. The Clean Slate 1 site is located on the Tonopah Test Range. The surface soils were contaminated as a result of the detonation of a device containing plutonium and depleted uranium using chemical explosives. Short-term stabilization consists of the application of a chemical soil stabilizer that is applied immediately following excavation of the contaminated soils to minimize Pu resuspension. Long-term stabilization is accomplished by the establishment of a permanent vegetation

  11. Welsh Slate: A Candidate for Global Heritage Stone Status

    Science.gov (United States)

    Horak, Jana; Hughes, Terry; Lott, Graham

    2013-04-01

    Slate is the iconic stone of Wales, and has a temporal and geographic record of usage such that it is considered worthy of consideration for Global Heritage Stone status. The reputation of Welsh slate is built on the quality and durability of the stone, enabling it to be used in a wide range of contexts from industrial roofing, through domestic housing to higher prestige buildings. Although metamorphic slates are present in several across Wales, the highest quality roofing material was extracted from just two areas in north-west Wales; the Cambrian Slate Belt, around Bethesda to Nantlle, working purple and green slates of the Llanberis Slate Formation and a second area to the south around Blaenau Ffestiniog - the Ordovician Slate Belt - which works grey slates of the Nant Francon Supergroup. These two areas are considered to form the core of the Welsh Slate Province. Welsh slate has been extracted for at least 2000 years, as evidenced by their presence as roofing slates in Roman forts in North Wales dating from 77AD. Slates from medieval churches and castles in north Wales indicate extraction continued throughout this period. In the 16th century exportation of Welsh slate commenced, initially limited to Ireland and those parts of England where it could be transported by boat. The second half of 18th century saw the first major expansion of the industry, facilitated by improved road transportation and some mechanisation, and subsequently in the 1830s by repeal of punitive boat taxes: production increased substantially through the late 19th century supported by the introduction of steam railways, and both production and exports peaked around 1900. The industry is still active today, although on a much reduced scale, with an estimate of around 20% of output being exported. Considerable reserves of this high quality slate resource remain in North Wales and it is important to ensure that they are protected to maintain continuity of supply to the heritage sector and are

  12. SPARCHS: Symbiotic, Polymorphic, Automatic, Resilient, Clean-Slate, Host Security

    Science.gov (United States)

    2016-03-01

    SPARCHS: SYMBIOTIC , POLYMORPHIC, AUTOMATIC, RESILIENT, CLEAN-SLATE, HOST SECURITY COLUMBIA UNIVERSITY MARCH 2016 FINAL... SYMBIOTIC , POLYMORPHIC, AUTOTOMIC, RESILIENT, CLEAN-SLATE, HOST SECURITY 5a. CONTRACT NUMBER N/A 5b. GRANT NUMBER FA8750-10-2-0253 5c. PROGRAM...17 4.2.3 SYMBIOTIC EMBEDDED MACHINES

  13. Protocol to assess covering products for roofing slates

    Directory of Open Access Journals (Sweden)

    De la Horra, R.

    2008-06-01

    Full Text Available Spain is a world-wide leader in roofing slate production, quarriying more than 600,000 tons of slate of great quality and generating around 300 euros million in sales each year. However, an enormous quantity of slate plates is considered as a low quality product or discarded every year as waste. The application of protective products on roofing slate tiles helps to commercialise slate with higher oxidation rates, reducing wastes and environmental problems. The present protocol serves to evaluate the new protective products that are now used by slate producers. A combination of three technological tests is proposed here, along with a visual questionnaire to grant quality indices. Each test is oriented to clarify critical properties for the future use of the roofing slate, as follows: (i Thermal cycles were used to determine the oxidation rate of iron sulphides; (ii Slate behaviour in acid urban atmospheres was interpreted by exposition of slate tiles to SO2 gas; (iii Effectiveness of the protective layer under saline corrosion and solar radiation was obtained by exposition to saline fog and UV-irradiation. Physico-chemical tests have been performed in the Technological Centre of the Slate (Orense, Spain whereas the chemical-structural characterizations of natural, impregnated and altered slate plates were carried out by X-ray diffraction and optical and electronic microscopy in the University of Santiago de Compostela (NW Spain. The quantitative analyses of the alteration grades have been determined using a freeware program (IMAGEJ on the scanned images of roofing slate tiles. The protocol here presented has been experienced with the more important protective slate products nowadays, i.e., siloxanes, organic resins and polyurethanes.España es líder mundial en producción de pizarras de techar; la producción supera las 600.000 toneladas de pizarra de gran calidad, suponiendo mas de 300 millones euros. La aplicación de la pizarra con productos

  14. Conditions for the clean slate effect after success or failure.

    Science.gov (United States)

    Körner, Anita; Strack, Fritz

    2018-03-20

    The act of physically cleaning one's hands may reduce the impact of past experiences, termed clean-slate effect. Cleaning was found to affect negative, neutral, and mildly positive states. We extend this influence to success, a self-serving state. We manipulated success vs. failure and measured changes in optimism (Experiment 1) or self-esteem (Experiment 2). Moreover, we examined boundary conditions for the clean-slate effect. Experiment 1 indicates that the influence of performance on optimism diminishes if participants knew (compared to did not know) they were cleaning their hands. Experiment 2 indicates that the influence of performance on self-esteem diminishes if participants cleaned themselves (compared to an object). These results suggest that the clean-slate effect requires both awareness and self-reference of the cleaning act. Thus, the clean-slate effect seems to depend on both conscious inferences and automatic processes. A meta-analysis across the experiments confirms a moderate-sized clean-slate effect.

  15. Chronic obstructive pulmonary disease in Welsh slate miners.

    Science.gov (United States)

    Reynolds, C J; MacNeill, S J; Williams, J; Hodges, N G; Campbell, M J; Newman Taylor, A J; Cullinan, P

    2017-01-01

    Exposure to respirable crystalline silica (RCS) causes emphysema, airflow limitation and chronic obstructive pulmonary disease (COPD). Slate miners are exposed to slate dust containing RCS but their COPD risk has not previously been studied. To study the cumulative effect of mining on lung function and risk of COPD in a cohort of Welsh slate miners and whether these were independent of smoking and pneumoconiosis. The study was based on a secondary analysis of Medical Research Council (MRC) survey data. COPD was defined as forced expiratory volume in 1 s/forced vital capacity (FEV 1 /FVC) ratio association between mining and lung function after adjusting for age and smoking status. We used linear regression models for FEV 1 and FVC and logistic regression for COPD. In the original MRC study, 1255 men participated (726 slate miners, 529 unexposed non-miners). COPD was significantly more common in miners (n = 213, 33%) than non-miners (n = 120, 26%), P mining was associated with a reduction in %predicted FEV 1 [β coefficient = -3.97, 95% confidence interval (CI) -6.65, -1.29] and FVC (β coefficient = -2.32, 95% CI -4.31, -0.33) and increased risk of COPD (odds ratio: 1.38, 95% CI 1.06, 1.81). Slate mining may reduce lung function and increase the incidence of COPD independently of smoking and pneumoconiosis. © The Author 2016. Published by Oxford University Press on behalf of the Society of Occupational Medicine. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  16. Standard tests for the characterization of roofing slate pathologies

    Directory of Open Access Journals (Sweden)

    Cárdenes, V.

    2012-06-01

    Full Text Available The pathologies formed in slate roofs are mainly due to the presence of potentially unstable minerals (iron sulfides, carbonates and organic matter. These minerals may become altered by the effect of environmental agents, once the slate roof is finished. The pathologies are mainly associated with oxidation and gypsification processes of the cited mineral phases. In this work, the potential pathologies of several Spanish roofing slates are identified, using the tests defined in the European Norms EN 12326:2005, 14147:2004 and 11597:2007.

    Las patologías que se originan en pizarra para cubiertas son debidas fundamentalmente a la presencia de materiales alterables (sulfuros de hierro, carbonatos y materia orgánica. Estos minerales pueden llegar a alterarse por efecto de los agentes medioambientales, una vez que la pizarra es puesta en obra. Las patologías están principalmente asociadas a procesos de oxidación y yesificación de las citadas fases minerales. En este trabajo se determinan las patologías potenciales de varias pizarras para cubiertas españolas, utilizando los ensayos definidos en las normas UNE-EN 12326:2005, 14147:2004 y 11597:2007.

  17. Clean Slate transportation and human health risk assessment

    International Nuclear Information System (INIS)

    1997-02-01

    Public concern regarding activities involving radioactive material generally focuses on the human health risk associated with exposure to ionizing radiation. This report describes the results of a risk analysis conducted to evaluate risk for excavation, handling, and transport of soil contaminated with transuranics at the Clean Slate sites. Transportation risks were estimated for public transport routes from the Tonopah Test Range (TTR) to the Envirocore disposal facility or to the Area 3 Radioactive Waste Management Site (RWMS) at the Nevada Test Site (NTS) for both radiological risk and risk due to traffic accidents. Human health risks were evaluated for occupational and radiation-related health effects to workers. This report was generated to respond to this public concern, to provide an evaluation of the risk, and to assess feasibility of transport of the contaminated soil for disposal

  18. Electra-Slate proposal to develop an amorphous PV roofslate

    International Nuclear Information System (INIS)

    Bouverat, P.R.

    2000-01-01

    The objective of this project has been to create a photovoltaic roofing product, the Electra-Slate, that appears physically and dimensionally to conform with a standard pattern, but is designed in a way that any roofer could install the device with total safety on an existing truss, rafter, felt and batten construction roof without additional training and supervision. This has been achieved by developing new concepts in high voltage Amorphous Silicon plate, with in built series connections, and by making an inboard parallel bus connection system, which is self connecting during normal roofing placement. The remaining barriers to be overcome are further reductions in cost and increased output. These two effects combine to form the barrier of installed cost/kilowatt. However it is clear that cost/m 2 is already more competitive for this type of product than for a 'PV' module type of product. (author)

  19. Variable effects of plant colonization on black slate uptake into microbial PLFAs

    Science.gov (United States)

    Seifert, Anne-Gret; Trumbore, Susan; Xu, Xiaomei; Zhang, Dachung; Gleixner, Gerd

    2013-04-01

    Microbial degradation of carbon derived from black shale and slate has been shown in vitro. However, in natural settings where other labile carbon sources are likely to exist, this has not been previously demonstrated. We investigated the uptake of ancient carbon derived from slate weathering and from recently photosynthesised organic matter by different groups of microorganisms. Therefore we isolated microbial biomarkers (phospholipid fatty acids, PLFAs) from black slates collected at a chronosequence of waste piles which differed in age and vegetation cover. We quantified the amount of PLFAs and performed stable isotope and radiocarbon measurements on individual or grouped PLFAs to quantify the fraction of slate derived carbon. We used black slate from a pile heaped in the 1950s with either uncovered black slate material (bare site) or material slightly colonized by small plants (greened site) and from a forested leaching pile (forested site) used for alum-mining in the 19th century. Colonization by plants influenced the amount and composition of the microbial community. Greater amounts of PLFAs (5410 ng PLFA/g dw) were extracted from slate sampled at the forested site as opposed to the bare site (960 ng PLFAs/g dw) or the greened (annual grasses and mosses) rock waste pile (1050 ng PLFAs/g dw). We found the highest proportion of PLFAs representing Gram-negative bacteria on the forested site and the highest proportion of PLFAs representing Gram-positive bacteria on the bare site. The fungal PLFA was most abundant at the greened site. Sites with less plant colonization (bare and greened site) tended to have more depleted δ13C values compared to the forested site. Radiocarbon measurements on PLFAs indicated that fungi and Gram-positive bacteria were best adapted to black slate carbon uptake. In the fungal PLFA (combined bare and greened waste pile sample) and in PLFAs of Gram-positive bacteria (greened site) we measured 39.7% and 28.9% ancient carbon uptake

  20. Clean Slate Environmental Remediation DSA for 10 CFR 830 Compliance

    International Nuclear Information System (INIS)

    James L. Traynor, Stephen L. Nicolosi, Michael L. Space, Louis F. Restrepo

    2006-01-01

    Clean Slate Sites II and III are scheduled for environmental remediation (ER) to remove elevated levels of radionuclides in soil. These sites are contaminated with legacy remains of non-nuclear yield nuclear weapons experiments at the Nevada Test Site, that involved high explosive, fissile, and related materials. The sites may also hold unexploded ordnance (UXO) from military training activities in the area over the intervening years. Regulation 10 CFR 830 (Ref. 1) identifies DOE-STD-1120-98 (Ref. 2) and 29 CFR 1910.120 (Ref. 3) as the safe harbor methodologies for performing these remediation operations. Of these methodologies, DOE-STD-1120-98 has been superseded by DOE-STD-1120-2005 (Ref. 4). The project adopted DOE-STD-1120-2005, which includes an approach for ER projects, in combination with 29 CFR 1910.120, as the basis documents for preparing the documented safety analysis (DSA). To securely implement the safe harbor methodologies, we applied DOE-STD-1027-92 (Ref. 5) and DOE-STD-3009-94 (Ref. 6), as needed, to develop a robust hazard classification and hazards analysis that addresses non-standard hazards such as radionuclides and UXO. The hazard analyses provided the basis for identifying Technical Safety Requirements (TSR) level controls. The DOE-STD-1186-2004 (Ref. 7) methodology showed that some controls warranted elevation to Specific Administrative Control (SAC) status. In addition to the Evaluation Guideline (EG) of DOE-STD-3009-94, we also applied the DOE G 420.1 (Ref. 8) annual, radiological dose, siting criterion to define a controlled area around the operation to protect the maximally exposed offsite individual (MOI)

  1. Radon exhalation rates from slate stone samples in Aravali Range in Haryana

    International Nuclear Information System (INIS)

    Upadhyay, S.B.; Kant, K.; Chakarvarti, S.K.

    2012-01-01

    The slate stone tiles are very popular in covering the walls of the rooms. Radon is released into ambient air from slate stones due to ubiquitous uranium and radium in them, thus increasing the airborne radon concentration. The radioactivity in slates stones is related to radioactivity in the rocks from which the slate stone tiles are formed. In the present investigation, the radon emanated from slate stone samples collected from different slate mines in Aravali range of hills in the Haryana state of Northern India has been estimated. For the measurement of radon concentration emanated from these samples, alpha-sensitive LR-115 type II plastic track detectors have been used. The alpha particles emitted from the radon form tracks in these detectors. After chemical etching the track density of registered tracks is used to calculate radon concentration and exhalation rates of radon using required formulae. The measurements indicate normal to some higher levels of radon concentration emanated from the slat stone samples collected from Aravali range of hills in north India. The results will be discussed in full paper. (author)

  2. Characterization of slate ornaments from Teotihuacan by nuclear and conventional techniques

    International Nuclear Information System (INIS)

    Villa-Cordoba, T.; Lopez-Palacios, J.A.; Jimenez-Reyes, M.; Tenorio, D.

    2012-01-01

    Several ornaments named tezcacuitlapilli (coccyx-mirrors) are described and chemical analyses of raw materials (slate and pigments) were carried out by neutron activation, X-ray diffraction, scanning electron microscopy and radiography. Elemental and statistical analyses revealed that three different kinds of slate were used in their manufacture. The white pigment contains gypsum while ochre, yellow and red pigments contain iron oxide. These ornaments were identified as coming from the Cave of the Sun Pyramid of Teotihuacan. An attempt was undertaken to reconstruct the contexts of their manufacture and symbolic interpretation. (author)

  3. Utilization of X-ray computed micro-tomography to evaluate iron sulphide distribution in roofing slates

    Czech Academy of Sciences Publication Activity Database

    Vavro, Martin; Souček, Kamil; Daněk, T.; Matýsek, D.; Georgiovská, Lucie; Zajícová, Vendula

    (2018) ISSN 1470-9236 R&D Projects: GA MŠk(CZ) LO1406 Institutional support: RVO:68145535 Keywords : roofing slate * iron sulphides * X-ray CT * slate pathologies * dimension stone Subject RIV: JN - Civil Engineering Impact factor: 1.102, year: 2016 http://qjegh.lyellcollection.org/

  4. 76 FR 29227 - Funding Down Slate; Indian Education Professional Development Program

    Science.gov (United States)

    2011-05-20

    ... Development Program AGENCY: Office of Elementary and Secondary Education, Department of Education. ACTION... use the existing slate of applications from the FY 2010 competition for the Professional Development... you use a telecommunications device for the deaf (TDD), call the Federal Relay Service (FRS), toll...

  5. A Low Temperature Detoxification Method for Treatment of Chrysotile-Containing Waste Roofing Slate

    Directory of Open Access Journals (Sweden)

    Hwanju Jo

    2017-08-01

    Full Text Available In this study, we evaluated a two-step process for detoxification of waste roofing slate, involving cement hydrate removal and low temperature detoxification using oxalic acid. These treatments were conducted on raw material and intermediate product, respectively. Cement hydrate removal effectively eliminated most Ca-containing cement hydrate components from the raw material under the following conditions: HCl to solid ratio: 0.456 g/g, reaction time: 2 h, and solid to liquid ratio: 0.124 g/mL. Following low temperature (~100 °C detoxification of intermediate product obtained after cement hydrate removal, chrysotile in waste roofing slate was effectively transformed to Mg-oxalate under conditions of oxalic acid to solid ratio of >0.67 g/g.

  6. Comparison of lattice preferred orientation and magnetic fabric of a chloritoid-bearing slate

    Science.gov (United States)

    Haerinck, Tom; Wenk, Hans-Rudolf; Debacker, Timothy N.; Sintubin, Manuel

    2014-05-01

    A regional analysis of the anisotropy of the magnetic susceptibility (AMS) on chloritoid-bearing slates of the Paleozoic Plougastel Formation in the low-grade metamorphic conditions (epizonal) of the Monts d'Arrée slate belt in Central Armorica (Brittany, France) reveals very high values for the degree of anisotropy (PJ), up to 1.43 (Haerinck et al. 2013a). In contrast, stratigraphically equivalent slates free of chloritoid, in the very low-grade metamorphic conditions (anchizonal) of the Crozon fold-and-thrust belt, show a lower degree of anisotropy, with PJ values up to 1.27. Classically, very strong magnetic fabrics (i.e. those with PJ above 1.35) are attributed to a contribution of ferromagnetic (s.l.) minerals. Nonetheless, high-field torque magnetometry indicates that the magnetic fabric of the chloritoid-bearing slates is dominantly paramagnetic. The ferromagnetic (sensu lato) contribution to the AMS is less than 10%. Based on these observations, it would seem that chloritoid has an intrinsic magnetic anisotropy that is significantly higher than that of most paramagnetic silicates and the frequently used upper limit for the paramagnetic contribution to the AMS. Using two independent approaches, i.e. (a) directional magnetic hysteresis measurements, and (b) torque magnetometry, on a collection of single chloritoid crystals, collected from different tectonometamorphic settings worldwide, the magnetocrystalline anisotropy of monoclinic chloritoid has been determined (Haerinck et al. 2013b). The determined paramagnetic high-field AMS ellipsoids have a highly oblate shape with the minimum susceptibility direction subparallel to the crystallographic c-axis of chloritoid and the degree of anisotropy of chloritoid is found to be 1.47 ± 0.06. The obtained very high magnetocrystalline degree of anisotropy suggests that chloritoid-bearing slates with a pronounced mineral alignment can have a high degree of anisotropy (PJ) without the need of invoking a significant

  7. Process of producing fuels from slates or bituminous shales. [distillation at incandescent heat

    Energy Technology Data Exchange (ETDEWEB)

    Huppenbauer, M

    1902-07-31

    A process of producing a fuel from slates or bituminous shales by saturating or impregnating them after preliminary distillation with the vapors of tars, resins, oils, etc., is given. The process is characterized by the bituminous shale being submitted in the form of fragments to distillation at incandescent heat to make the shale porous and able to absorb the vapors of the substances already mentioned.

  8. Clean Slate 1 corrective action decision document, Corrective Action Unit No. 412. Revision 1

    International Nuclear Information System (INIS)

    1997-04-01

    A Corrective Action Investigation has been completed at the Clean Slate 1 (CS-1) Site, located in the central portion of the Tonopah Test Range. The purpose of this CADD is to identify and evaluate potential correct action alternatives at the CS-1 Site and to evaluate these alternatives with respect to their technical, human health, and environmental benefits and to their cost. Base on this evaluation a corrective action will be recommended for implementation at the CS-1 Site

  9. Fracture propagation in sandstone and slate – Laboratory experiments, acoustic emissions and fracture mechanics

    Directory of Open Access Journals (Sweden)

    Ferdinand Stoeckhert

    2015-06-01

    Full Text Available Fracturing of highly anisotropic rocks is a problem often encountered in the stimulation of unconventional hydrocarbon or geothermal reservoirs by hydraulic fracturing. Fracture propagation in isotropic material is well understood but strictly isotropic rocks are rarely found in nature. This study aims at the examination of fracture initiation and propagation processes in a highly anisotropic rock, specifically slate. We performed a series of tensile fracturing laboratory experiments under uniaxial as well as triaxial loading. Cubic specimens with edge lengths of 150 mm and a central borehole with a diameter of 13 mm were prepared from Fredeburg slate. An experiment using the rather isotropic Bebertal sandstone as a rather isotropic rock was also performed for comparison. Tensile fractures were generated using the sleeve fracturing technique, in which a polymer tube placed inside the borehole is pressurized to generate tensile fractures emanating from the borehole. In the uniaxial test series, the loading was varied in order to observe the transition from strength-dominated fracture propagation at low loading magnitudes to stress-dominated fracture propagation at high loading magnitudes.

  10. Breeding biology and natural history of the Slate-throated Whitestart in Venezuela

    Science.gov (United States)

    Ruggera, R.A.; Martin, T.E.

    2010-01-01

    We provide details on the breeding biology of the Slate-throated Whitestart (Myioborus miniatus) from 126 nests found during seven breeding seasons, 2002-2008, at Yacamb?? National Park, Venezuela. Nesting activity peaked in late April and May. Only the female built the nest and incubated the eggs. Males rarely visited the nest during these stages. Mean clutch size (2.1 ?? 0.04 eggs, n = 93) was the smallest recorded for the Slate-throated Whitestart. Incubation and nestling period lengths were 15.3 ?? 0.31 (n = 21) and 10.8 ?? 0.24 (n = 7) days, respectively. Attentiveness (% of time on the nest) during incubation (59 ?? 1.6%, n = 52) was similar to other tropical warblers and much lower than northern relatives. This caused a relatively low egg temperature (34.40 ?? 0.33u C, n = ?? nests, 20 days) compared with north temperate birds. Both parents fed nestlings and increased their provisioning rates with nestling age. Growth rate based on nestling mass (k = 0.521 ?? 0.015) was faster than for other tropical passerines but slower than northern relatives. Predation was the main cause of nesting failure and rate of predation increased with age of the nest. An estimated 15% of nests were successful based on an overall Mayfield daily predation rate of 0.053 ?? 0.007. This study confirms a strong latitudinal variation in life history traits of warblers. ?? 2010 by the Wilson Ornithological Society.

  11. Remedial actions of nuclear safety shot sites: Double Tracks and Clean Slates

    International Nuclear Information System (INIS)

    Sanchez, M.; Shotton, M.; Lyons, C.

    1998-03-01

    Remedial actions of plutonium (Pu)-contaminated soils are in the preliminary stages of development at the Nevada Test Site (NTS). Interim clean-up actions were completed at the Double Tracks and Clean Slate 1 safety shot sites in 1996 and 1997, respectively. Soil at both sites, with a total transuranic activity greater than 20 picoCuries per gram (pCi/g), was excavated and shipped to the NTS for disposal. Characterization and assessment efforts were initiated at the Double Tracks site in 1995, and the clean-up of this site as an interim action was completed in 1996. Clean-up of this site consisted of taking site-specific data and applying rationale for dose and risk calculations in selecting parameter values for the interim corrective action level. The remediation process included excavating and stockpiling the contaminated soil and loading the soil into supersacks with approximately 1,513 cubic meters (53,500 cubic feet) being shipped to the NTS for disposal. In 1997, remediation began on the Clean Slate 1 site on which characterization had already been completed using a very similar approach; however, the site incorporated lessons learned, cost efficiencies, and significant improvements to the process. This paper focuses on those factors and the progress that has been made in cleaning up the sites. The application of a technically reasonable remediation method, as well as the cost factors that supported transport and disposal of the low-level waste in bulk are discussed

  12. Properties of slate mining wastes incubated with grape marc compost under laboratory conditions.

    Science.gov (United States)

    Paradelo, Remigio; Moldes, Ana Belén; Barral, María Teresa

    2009-02-01

    The effect of the addition of spent grape marc compost (GMC) and vermicompost (GMV) as amendments to slate mining wastes was evaluated in a laboratory incubation experiment. Mixtures of slate processing fines (SPF), with three doses of each amendment (4%, 8% and 16% compost, dry weight), plus a control were incubated at 25 degrees C in the laboratory for 90 days. The changes in the chemical and biological properties of the mixtures (pH, total C, total N, inorganic N, available nutrients, microbial biomass carbon and dehydrogenase activity) were investigated during the incubation period, and once it was finished, the phytotoxicity of the mixtures was determined by the germination of Lolium multiflorum Lam. seeds. The addition of the amendments significantly increased the nutrient concentrations of the SPF and enhanced biological activity by increasing microbial biomass and enzymatic activity. Results improved with higher doses; within the composts, GMV showed a better performance than GMC. These results prove the suitability of grape marc-derived amendments for the biochemical amelioration of mining wastes, and highlight the benefits of organic amendment in restoration projects.

  13. Structural and textural characteristics of slate and its response to the point load test

    Directory of Open Access Journals (Sweden)

    Ana Mladenovič

    2006-12-01

    Full Text Available From the geomechanical point of view slate is considered to be one of more trying rock varieties. The results of research have shown close relationship between structural, textural and mineralogical characteristics on the one hand, and its strength and resistance to point loads on the other hand. Its weakened zones are the result of anisotropy. They develop mainly due to dynamo-metamorphosis of the primary mudstone, resulting in the formation of the secondary slaty cleavage, with a pronounced preferred orientation of the hyllosilicates. Low strength is the consequence of the weak Van der Waals chemical bond between individual packets of the internal crystal structure of the sheet minerals, particularly sericite. Bedding and microfolds with a crenulated structure and partial preferred orientation of sheet minerals, as well as directions that are weakened with sigmoidal shear deformations as the predecessors of microfaults, also result in significant but less problematicanisotropy. Thin lepidoblastic lamina, in apparently massive sandy metasiltstone beds in the slate represent discontinuities, which have a decisive influence on the reduction of their strength.

  14. PV/T slates - Laboratory measurements; PV/T-Schiefer. Labormessungen

    Energy Technology Data Exchange (ETDEWEB)

    Kropf, S.

    2003-07-01

    This comprehensive, illustrated report for the Swiss Federal Office of Energy (SFOE) is one a series of five reports dealing with increasing the overall efficiency of photovoltaic (PV) installations by also using the heat collected by the dark-coloured PV panels. The work reported on addresses open questions on the use of the heat and its optimal use. This report deals with an experimental outdoor set-up and reviews in-situ measurements made on a prototype of a ventilated PV-tile system (PV/T-Slates). The report describes the configuration and construction of the experimental PV-tiled roof and the measurement system used to measure its electrical and thermal performance. The results of the measurements made are presented in detail in graphical form. The influence of various factors such as air-slit width and mounting angle are discussed.

  15. PV/T slates - Pilot project in Steinhausen; PV/T-Schiefer. Pilotprojekt Steinhausen

    Energy Technology Data Exchange (ETDEWEB)

    Kropf, S.

    2003-07-01

    This comprehensive, illustrated report for the Swiss Federal Office of Energy (SFOE) is one a series of five reports dealing with increasing the overall efficiency of photovoltaic (PV) installations by also using the heat collected by the dark-coloured PV panels. The work reported on addresses open questions on the use of the heat and its optimal use. This report deals with a ventilated PV-tile system (PV/T-Slates) mounted on a garden shed in Steinhausen, Switzerland. The installation provides power and heat to the main house. The report describes the construction and operation of this pilot project and the results of measurements made on its electrical and thermal performance. The results of measurements made are presented in detail in graphical form and compared with the results of simulation. Suggestions are made for the optimisation of the system. Figures are presented on energy production and energy flows in graphical form.

  16. Pinite-cordierite from spotted slate of the Brajkovac contact metamorphic aureole (Dudovica locality, central Serbia

    Directory of Open Access Journals (Sweden)

    Vasković Nada

    2013-01-01

    Full Text Available The Paleozoic very low to low-grade metamorphic rocks of the Bukulja-Lazarevac Unit designated as Drina, Golija and Birač formations are contact metamorphosed by the intrusion of the Tertiary Brajkovac granodiorite into spotted slates and hornfelses. In some parts, they are slightly migmatized at the contact. In addition to their outcrops found at the western, eastern and northern parts of the formation, these rocks are also found in boreholes near Dudovica at about 8 km south-west from the pluton. There, at a depth of 110 m, the spotted slates comprise oval to ellipsoid pinite-rich spots which can be regarded as incipient cordierite porphyroblasts (up to 5 mm in diameter overgrowing the existing regional foliation. They are composed of cryptocrystalline mixture of a very fine sericitic material ± light glassy orange „film“ (some kind of an amorphous gel-like material often mixed with limonite matter and are abundant in inclusions: minute quartz and dusty ore minerals (magnetite prevail. In addition, within some spots an increased number of xenotime and monazite inclusions are noted. Minute flakes of neobiotite are formed at the expense of quartz-sericite-chlorite matrix. The secondary chlorite occurring as overgrowths on pinite-cordierite spots shows variable composition (brunsvigite to diabandite. The Mg/Fe+Mg ratio of cryptocrystalline pinitic mixture ranges from 0.14-0.67. The Si vs AlIV+AlVI relations deviate from the ideal muscovite-phengite join due to Tschermak substitution towards chloritic composition or a more complex mixture, including clay minerals (which reflected a decrease of Altot and Si with increase of Fe2+. Obtained data indicates that the cordierite-pinite spots can be related to contact metamorphic processes that occurred within the temperature range 300-450°C. [Projekat Ministarstva nauke Republike Srbije, br. 176019 i br. 176016

  17. Determination of iron sulphides in roofing slates from the north west of Spain

    Directory of Open Access Journals (Sweden)

    García-Guinea, J.

    2002-06-01

    Full Text Available The most important production of roofing slates in the world is quarried from the Ordovician formations of the Truchas Syncline, which have the largest amount of working quarries. Roofing slates, sometimes, have crystallized iron sulphides such as pyrite, pyrrhotite and other minerals. These iron sulphides oxidise and stain the tiles when are exposed to atmospheric conditions, so much oxidized how much more inclined is the roof. Galician quarrymen distinguish between harmless pyrite (i.e., resistant cubes of pyrite and damaging pyrite (i.e., other alterable metallic minerals such as pyrrhotite, chalcopyrite, marcasite and arsenopyirite. An improved identification method is proposed using both methods (a chemical element ratios of samples under electron microprobes and (b quantitative determination of the iron sulphides in the slate measuring the oxidized areas by digital camera. The analysed Fe/S ratios, in an XY plot, of seventy metallic samples, define three separated zones: pyrite, pyrrhotite and iron oxi-hydroxides. Quantitative determination of iron sulphides in the slate tile were performed by sinking the tile horizontally for six hours in oxygen peroxide (3% diluted and capturing the oxidation areas with a magnetic camera and analysing the bitmap images with Sigma-Scan 5 software. The proposed method is faster than the Spanish UNE norm (UNE-EN- 12326-2 Sept.2000, which requires thermal strike cycles for a month. The necessary use of heavy analytical equipment such as electron microprobes can be facilitated by installing it in the Slate Technological Centre of Sobradelo de Valdeorras (Orense or by using a simple optical stereoscopic zoom microscope to classify the iron minerals.

    Las formaciones ordovícicas del Sinclinal de Duchas concentran la mayor producción mundial de pizarra para cubiertas y el mayor número de canteras en producción. Las pizarras para cubiertas muchas veces contienen sulfuros de hierro cristalizados en forma

  18. Mineralogy and microstructure of roofing slate: thermo-optical behaviour and fissility

    Directory of Open Access Journals (Sweden)

    García-Guinea, J.

    1998-09-01

    Full Text Available The mineralogy and microstructure, which affect the slaty cleavage, are linked with the strong preferred orientation of phyllosilicates and this enables the rock to be split into large, thin, flat sheets. Roofing slate samples with different commercial fissilities have been analyzed by radioluminescence (RL, thermoluminescence (3DTL, by X-ray diffraction (XRD, by scanning electron microscopy (SEM using the back-scattered mode (BSEI and by electron microprobe (EMP. They are made up of white micas, chlorite, quartz, detrital feldspars, ilmenite, pyrite, rutile apatite and tourmaline. Texturally, all consist of silt-sized clasts of detrital quartz, feldspars, chlorite-mica stacks, muscovite and ilmenite in a recrystalline, lepidoblastic matrix of white micas and chlorite with quartz lenses, all showing a very strong preferred orientation. The luminescence emission centers are a low broad blue band around the 400 nm spectra positions linked with alkali losses and formation of [AlO4]º defects; a peak at 473 nm interpreted as a the first thermal step (150-300ºC of a non-isothermal dehydroxylation of the slate phyllosilicates; and a 568 nm peak which agrees with Mn2+ point defects in aluminosilicate lattices. The studies on the slaty cleavage could be significant because Spain is the largest producer of roofing slate tiles in the world (87% of world production.

    La exfoliación de las pizarras depende fundamentalmente de su mineralogía y microestructura, especialmente de la fuerte orientación de los filosilicatos. Esta propiedad permite hendir o abrir las pizarras de techar en láminas muy grandes, delgadas y planas. Se han analizado varias pizarras de techar con diferentes calidades comerciales, correspondientes a diferentes grados de físibilidad, por radioluminiscencia (RL, termoluminiscencia espectral (TL3D, difracción de rayos X (DRX, microscopía electrónica de barrido (MEB utilizando el modo backscattered (BSEI

  19. Structural analysis of sheath folds in the Sylacauga Marble Group, Talladega slate belt, southern Appalachians

    Science.gov (United States)

    Mies, J.W.

    1993-01-01

    Remnant blocks of marble from the Moretti-Harrah dimension-stone quarry provide excellent exposure of meter-scale sheath folds. Tubular structures with elliptical cross-sections (4 ???Ryz ??? 5) are the most common expression of the folds. The tubes are elongate subparallel to stretching lineation and are defined by centimeter-scale layers of schist. Eccentrically nested elliptical patterns and opposing asymmetry of folds ('S' and 'Z') are consistent with the sheath-fold interpretation. Sheath folds are locally numerous in the Moretti-Harrah quarry but are not widely distributed in the Sylacauga Marble Group; reconnaissance in neighboring quarries provided no additional observations. The presence of sheath folds in part of the Talladega slate belt indicates a local history of plastic, non-coaxial deformation. Such a history of deformation is substantiated by petrographic study of an extracted hinge from the Moretti-Harrah quarry. The sheath folds are modeled as due to passive amplification of initial structures during simple shear, using both analytic geometry and graphic simulation. As indicated by these models, relatively large shear strains (y ??? 9) and longitudinal initial structures are required. The shear strain presumably relates to NW-directed displacement of overlying crystalline rocks during late Paleozoic orogeny. ?? 1993.

  20. Geology of Reskajeage Farm Quarry (Nirex research site on Cornish slate)

    International Nuclear Information System (INIS)

    Hancock, P.L.; North, C.P.

    1989-08-01

    Convection with any water flow is the most likely way in which any radionuclides escaping from deep disposal of radioactive waste in hard fractured rock could return to the surface. Hence the interest in water flow and mass transport through fractures for establishing the safety of such disposal. Earlier work on this subject was carried out in granite at Troon in Cornwall. This work provided statistical data about individual fractures and helped with the development of realistic modelling of flow and transport (Bourke 1985 and 1988). Validation of this modelling was however impractical. Access was obtained to another site with a much smaller separation between fractures in slate to allow measurement of flow and transport through representative volumes of 10m dimensions. Individual fracture statistics are being determined so that modelling predictions can be theoretically made for experimental proving. The programme at the site was begun with a geological investigation. The main findings are that the somewhat heterogeneous hard rock consists mostly of siltstone with some sandstone layers, that it is not untypically broken by many fractures and that a comparatively major (3m wide) fault with slip of about a metre between its faces crossing part of the site. These findings are described in detail in the report. (author)

  1. Serious Gaming for Test & Evaluation of Clean-Slate (Ab Initio) National Airspace System (NAS) Designs

    Science.gov (United States)

    Allen, B. Danette; Alexandrov, Natalia

    2016-01-01

    Incremental approaches to air transportation system development inherit current architectural constraints, which, in turn, place hard bounds on system capacity, efficiency of performance, and complexity. To enable airspace operations of the future, a clean-slate (ab initio) airspace design(s) must be considered. This ab initio National Airspace System (NAS) must be capable of accommodating increased traffic density, a broader diversity of aircraft, and on-demand mobility. System and subsystem designs should scale to accommodate the inevitable demand for airspace services that include large numbers of autonomous Unmanned Aerial Vehicles and a paradigm shift in general aviation (e.g., personal air vehicles) in addition to more traditional aerial vehicles such as commercial jetliners and weather balloons. The complex and adaptive nature of ab initio designs for the future NAS requires new approaches to validation, adding a significant physical experimentation component to analytical and simulation tools. In addition to software modeling and simulation, the ability to exercise system solutions in a flight environment will be an essential aspect of validation. The NASA Langley Research Center (LaRC) Autonomy Incubator seeks to develop a flight simulation infrastructure for ab initio modeling and simulation that assumes no specific NAS architecture and models vehicle-to-vehicle behavior to examine interactions and emergent behaviors among hundreds of intelligent aerial agents exhibiting collaborative, cooperative, coordinative, selfish, and malicious behaviors. The air transportation system of the future will be a complex adaptive system (CAS) characterized by complex and sometimes unpredictable (or unpredicted) behaviors that result from temporal and spatial interactions among large numbers of participants. A CAS not only evolves with a changing environment and adapts to it, it is closely coupled to all systems that constitute the environment. Thus, the ecosystem that

  2. Radiological dose assessment for residual radioactive material in soil at the clean slate sites 1, 2, and 3, Tonopah Test Range

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-06-01

    A radiological dose assessment has been performed for Clean Slate Sites 1, 2, and 3 at the Tonopah Test Range, approximately 390 kilometers (240 miles) northwest of Las Vegas, Nevada. The assessment demonstrated that the calculated dose to hypothetical individuals who may reside or work on the Clean Slate sites, subsequent to remediation, does not exceed the limits established by the US Department of Energy for protection of members of the public and the environment. The sites became contaminated as a result of Project Roller Coaster experiments conducted in 1963 in support of the US Atomic Energy Commission (Shreve, 1964). Remediation of Clean Slate Sites 1, 2, and 3 is being performed to ensure that the 50-year committed effective dose equivalent to a hypothetical individual who lives or works on a Clean Slate site should not exceed 100 millirems per year. The DOE residual radioactive material guideline (RESRAD) computer code was used to assess the dose. RESRAD implements the methodology described in the DOE manual for establishing residual radioactive material guidelines (Yu et al., 1993a). In May and June of 1963, experiments were conducted at Clean Slate Sites 1, 2, and 3 to study the effectiveness of earth-covered structures for reducing the dispersion of nuclear weapons material as a result of nonnuclear explosions. The experiments required the detonation of various simulated weapons using conventional chemical explosives (Shreve, 1964). The residual radioactive contamination in the surface soil consists of weapons grade plutonium, depleted uranium, and their radioactive decay products.

  3. Radiological dose assessment for residual radioactive material in soil at the clean slate sites 1, 2, and 3, Tonopah Test Range

    International Nuclear Information System (INIS)

    1997-06-01

    A radiological dose assessment has been performed for Clean Slate Sites 1, 2, and 3 at the Tonopah Test Range, approximately 390 kilometers (240 miles) northwest of Las Vegas, Nevada. The assessment demonstrated that the calculated dose to hypothetical individuals who may reside or work on the Clean Slate sites, subsequent to remediation, does not exceed the limits established by the US Department of Energy for protection of members of the public and the environment. The sites became contaminated as a result of Project Roller Coaster experiments conducted in 1963 in support of the US Atomic Energy Commission (Shreve, 1964). Remediation of Clean Slate Sites 1, 2, and 3 is being performed to ensure that the 50-year committed effective dose equivalent to a hypothetical individual who lives or works on a Clean Slate site should not exceed 100 millirems per year. The DOE residual radioactive material guideline (RESRAD) computer code was used to assess the dose. RESRAD implements the methodology described in the DOE manual for establishing residual radioactive material guidelines (Yu et al., 1993a). In May and June of 1963, experiments were conducted at Clean Slate Sites 1, 2, and 3 to study the effectiveness of earth-covered structures for reducing the dispersion of nuclear weapons material as a result of nonnuclear explosions. The experiments required the detonation of various simulated weapons using conventional chemical explosives (Shreve, 1964). The residual radioactive contamination in the surface soil consists of weapons grade plutonium, depleted uranium, and their radioactive decay products

  4. An in situ survey of Clean Slate 1, 2, and 3, Tonopah Test Range, Central Nevada. Date of survey: September--November 1993

    International Nuclear Information System (INIS)

    1995-08-01

    A ground-based in situ radiological survey was conducted downwind of the Clean Slate 1, 2, and 3 nuclear safety test sites at the Tonopah Test Range in central Nevada from September through November 1993. The purpose of the study was to corroborate the americium-241 ( 241 Am) soil concentrations that were derived from the aerial radiological survey of the Clean Slate areas, which was conducted from August through October 1993. The presence of 241 Am was detected at 140 of the 190 locations, with unrecoverable or lost data accounting for fifteen (15) of the sampling points. Good agreement was obtained between the aerial and in situ results

  5. A clean slate. For a future of possibilities; Schonelei. Voor een toekomst van mogelijkheden

    Energy Technology Data Exchange (ETDEWEB)

    Luttik, P.; Boosten, G. [Stichting DoTank, Bussum (Netherlands); Smit, H.; Tersteeg, J. [WING Proces Consultancy, Wageningen UR, Wageningen (Netherlands)

    2006-12-15

    a situation must be created that is aimed at renewal and innovation. A stimulating environment with guarantees for result driven investments, instead of a system of subsidies that is incomprehensible. We also have to look for new co-operation partners, not based on contracts and demands for specific results, but based on transparency, trust and shared ambitions. Everything has to be directed at the creation of new values. At this moment in time a number of results of the Clean Slate project are being elaborated. [Dutch] De landbouw staat in Nederland onder druk. Ondanks de inspanningen van velen om de agrarische sector in Nederland te laten floreren, is het niet ondenkbaar dat op een termijn van 30-50 jaar (delen van de) landbouw uit (delen van) Nederland zijn verdwenen. Het nadenken over de consequenties van deze ontwikkeling is zeker in agrarische kringen nog taboe. Dit belemmert niet alleen het zicht op nieuwe kansen die door het verdwijnen van landbouw ontstaan, het blokkeert ook de bewustwording ten aanzien van het kostbare dat dan verloren gaat. Het project 'Schonelei' concentreert zich op de kansenkant. Uitgangspunt is een viertal extreme scenario's voor het verdwijnen van de grondgebonden landbouw uit ons land. Die scenario's dienden als inspiratie voor de ontwikkeling van nieuwe concepten of aanzetten daartoe. Dat heeft een rijke oogst opgeleverd. Een negental concepten wordt in het rapport verder uitgewerkt, namelijk: Zeelandbouw (landbouw in zee); Bioport (Nederland niet meer als draaischijf voor fossiele energie, maar voor biomassa); Vraaggestuurde microketens (in tegenstelling tot aanbodgerichte bulkketens); Lokale autonomie (in plaats van centrale voorzieningen); Overbruggend eten (eten als manier om mensen nader tot elkaar te brengen); Nature at your fingertips (natuur aantrekkelijker maken door haar deels te virtualiseren); Waardevol sterven (over een nieuwe beleving van de laatste levensfase); Waardegedreven financiele

  6. Closure Report for Corrective Action Unit 412: Clean Slate I Plutonium Dispersion (TTR) Tonopah Test Range, Nevada, Revision 0

    International Nuclear Information System (INIS)

    Matthews, Patrick

    2016-01-01

    This Closure Report (CR) presents information supporting the clean closure of Corrective Action Unit (CAU) 412: Clean Slate I Plutonium Dispersion (TTR), located on the Tonopah Test Range, Nevada. CAU 412 consists of a release of radionuclides to the surrounding soil from a storage-transportation test conducted on May 25, 1963. Corrective action investigation (CAI) activities were performed in April and May 2015, as set forth in the Streamlined Approach for Environmental Restoration (SAFER) Plan for Corrective Action Unit 412: Clean Slate I Plutonium Dispersion (TTR), Tonopah Test Range, Nevada; and in accordance with the Soils Activity Quality Assurance Plan. The purpose of the CAI was to fulfill data needs as defined during the data quality objectives process. The CAU 412 dataset of investigation results was evaluated based on a data quality assessment. This assessment demonstrated the dataset is complete and acceptable for use in fulfilling the data needs identified by the data quality objectives process. This CR provides documentation and justification for the clean closure of CAU 412 under the FFACO without further corrective action. This justification is based on historical knowledge of the site, previous site investigations, implementation of the 1997 interim corrective action, and the results of the CAI. The corrective action of clean closure was confirmed as appropriate for closure of CAU 412 based on achievement of the following closure objectives: Radiological contamination at the site is less than the final action level using the ground troops exposure scenario (i.e., the radiological dose is less than the final action level): Removable alpha contamination is less than the high contamination area criterion: No potential source material is present at the site, and any impacted soil associated with potential source material has been removed so that remaining soil contains contaminants at concentrations less than the final action levels: and There is

  7. Closure Report for Corrective Action Unit 412: Clean Slate I Plutonium Dispersion (TTR) Tonopah Test Range, Nevada, Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Matthews, Patrick [Navarro, Las Vegas, NV (United States)

    2016-08-22

    This Closure Report (CR) presents information supporting the clean closure of Corrective Action Unit (CAU) 412: Clean Slate I Plutonium Dispersion (TTR), located on the Tonopah Test Range, Nevada. CAU 412 consists of a release of radionuclides to the surrounding soil from a storage–transportation test conducted on May 25, 1963. Corrective action investigation (CAI) activities were performed in April and May 2015, as set forth in the Streamlined Approach for Environmental Restoration (SAFER) Plan for Corrective Action Unit 412: Clean Slate I Plutonium Dispersion (TTR), Tonopah Test Range, Nevada; and in accordance with the Soils Activity Quality Assurance Plan. The purpose of the CAI was to fulfill data needs as defined during the data quality objectives process. The CAU 412 dataset of investigation results was evaluated based on a data quality assessment. This assessment demonstrated the dataset is complete and acceptable for use in fulfilling the data needs identified by the data quality objectives process. This CR provides documentation and justification for the clean closure of CAU 412 under the FFACO without further corrective action. This justification is based on historical knowledge of the site, previous site investigations, implementation of the 1997 interim corrective action, and the results of the CAI. The corrective action of clean closure was confirmed as appropriate for closure of CAU 412 based on achievement of the following closure objectives: Radiological contamination at the site is less than the final action level using the ground troops exposure scenario (i.e., the radiological dose is less than the final action level): Removable alpha contamination is less than the high contamination area criterion: No potential source material is present at the site, and any impacted soil associated with potential source material has been removed so that remaining soil contains contaminants at concentrations less than the final action levels: and There is

  8. An aerial radiological survey of the Tonopah Test Range including Clean Slate 1,2,3, Roller Coaster, decontamination area, Cactus Springs Ranch target areas. Central Nevada

    International Nuclear Information System (INIS)

    Proctor, A.E.; Hendricks, T.J.

    1995-08-01

    An aerial radiological survey was conducted of major sections of the Tonopah Test Range (TTR) in central Nevada from August through October 1993. The survey consisted of aerial measurements of both natural and man-made gamma radiation emanating from the terrestrial surface. The initial purpose of the survey was to locate depleted uranium (detecting 238 U) from projectiles which had impacted on the TTR. The examination of areas near Cactus Springs Ranch (located near the western boundary of the TTR) and an animal burial area near the Double Track site were secondary objectives. When more widespread than expected 241 Am contamination was found around the Clean Slates sites, the survey was expanded to cover the area surrounding the Clean Slates and also the Double Track site. Results are reported as radiation isopleths superimposed on aerial photographs of the area

  9. Recycling method of rubbish glass, wasted slate and oyster shell; Gan Ca haizai wo riyosuru kenzaiyo glass kuzu oyobi senshoseki kuzu no recycle

    Energy Technology Data Exchange (ETDEWEB)

    Okawa, A.; Omi, M. [Tohoku University, Sendai (Japan). Institute for Advanced Materials Processing

    1996-03-29

    Examination was made about the method of recycling rubbish glass and Gensho-stone slate, left after the use of construction materials, and oyster shells. In the experiment, quartz powder having the highest softening temperature was used instead of rubbish glass powder, and H3PO4 was used as the additive agent. The Gensho-stone slate was ground in a ball mill into power smaller than 100 mesh. The main constituent of the oyster shell, CaCO3, was subjected to thermolysis for conversion into CaO; and calcium phosphate was used as animal bone powder. The above-said materials as the starting materials were subjected to pressure-forming, and heating was done in the air at 1173K for 7.2ks for the production of sintered pellets. The sintered bodies were left in the air for 30 days and examined for geometrical changes, and it was found that the Gensho-stone slate was the best specimen, with the oyster shell occupying the second place, and that the sintered bodies of bone powder and SiO2 absorbed moisture indicating they were short of serviceability. As for the use of sintered bodies, Gensho stone may be used as material for landscape building while CaO may be used as a Ca ion source in the sea for cultivating seashells. 5 refs., 5 figs., 3 tabs.

  10. Hillslope response to sprinkling and natural rainfall using velocity and celerity estimates in a slate-bedrock catchment

    Science.gov (United States)

    Scaini, Anna; Hissler, Christophe; Fenicia, Fabrizio; Juilleret, Jérôme; Iffly, Jean François; Pfister, Laurent; Beven, Keith

    2018-03-01

    Subsurface flow is often recognized as a dominant runoff generation process. However, observing subsurface properties, and understanding how they control flow pathways, remains challenging. This paper investigates how surface slope and bedrock cleavage control subsurface flow pathways in a slate bedrock headwater catchment in Luxembourg, characterised by a double-peak streamflow response. We use a range of experimental techniques, including field observations of soil and bedrock characteristics, and a sprinkling experiment at a site located 40 m upslope from the stream channel. The sprinkling experiment uses Br- as a tracer, which is measured at a well downslope from the plot and at various locations along the stream, together with well and stream hydrometric responses. The sprinkling experiment is used to estimate velocities and celerities, which in turn are used to infer flow pathways. Our results indicate that the single or first peak of double-peak events is rainfall-driven (controlled by rainfall) while the second peak is storage-driven (controlled by storage). The comparison between velocity and celerity estimates suggests a fast flowpath component connecting the hillslope to the stream, but velocity information was too scarce to fully support such a hypothesis. In addition, different estimates of celerities suggest a seasonal influence of both rainfall intensity rate and residual water storage on the celerity responses at the hillslope scale. At the catchment outlet, the estimated of the total mass of Br- recovered in the stream was about 2.5% of the application. Further downstream, the estimate mass of Br- was about 4.0% of the application. This demonstrates that flowpaths do not appear to align with the slope gradient. In contrast, they appear to follow the strike of the bedrock cleavage. Our results have expanded our understanding of the importance of the subsurface, in particular the underlying bedrock systems, and the importance of cleavage orientation

  11. A Combined Remote Sensing-Numerical Modelling Approach to the Stability Analysis of Delabole Slate Quarry, Cornwall, UK

    Science.gov (United States)

    Havaej, Mohsen; Coggan, John; Stead, Doug; Elmo, Davide

    2016-04-01

    Rock slope geometry and discontinuity properties are among the most important factors in realistic rock slope analysis yet they are often oversimplified in numerical simulations. This is primarily due to the difficulties in obtaining accurate structural and geometrical data as well as the stochastic representation of discontinuities. Recent improvements in both digital data acquisition and incorporation of discrete fracture network data into numerical modelling software have provided better tools to capture rock mass characteristics, slope geometries and digital terrain models allowing more effective modelling of rock slopes. Advantages of using improved data acquisition technology include safer and faster data collection, greater areal coverage, and accurate data geo-referencing far exceed limitations due to orientation bias and occlusion. A key benefit of a detailed point cloud dataset is the ability to measure and evaluate discontinuity characteristics such as orientation, spacing/intensity and persistence. This data can be used to develop a discrete fracture network which can be imported into the numerical simulations to study the influence of the stochastic nature of the discontinuities on the failure mechanism. We demonstrate the application of digital terrestrial photogrammetry in discontinuity characterization and distinct element simulations within a slate quarry. An accurately geo-referenced photogrammetry model is used to derive the slope geometry and to characterize geological structures. We first show how a discontinuity dataset, obtained from a photogrammetry model can be used to characterize discontinuities and to develop discrete fracture networks. A deterministic three-dimensional distinct element model is then used to investigate the effect of some key input parameters (friction angle, spacing and persistence) on the stability of the quarry slope model. Finally, adopting a stochastic approach, discrete fracture networks are used as input for 3D

  12. RESEARCH OF PROCESSES OF FORMATION OF STRUCTURE AND THE PENO-SILIKAT-NATRIEVYH MAIN PROPERTIES OF COMPOSITIONS WITH USE OF THE DEHYDRATED SLATE CLAYS

    Directory of Open Access Journals (Sweden)

    N. K. Akaev

    2015-01-01

    Full Text Available In this article we review the results of theoretical and experimental researches for revealing the possibility of using local dehydrated slate clay as a temperature- resistant component in the process of making of foam-silicate-sodium compositions. The influence of silicate-block’s module, dispersion and the heating temperatures of the mixture on its solubility have been studied for this purpose. Besides here there were brought the results of research work concerning the influence of the heat treatment temperature and anhydrous silicate of sodium content on shrinking processes of foam compositions with the addition of small porous filler or without it.

  13. Nomograms to calculate stability in slate and granite spoil heaps; Abacos para el calculo de estabilidad en escombreras de pizarra y granito

    Energy Technology Data Exchange (ETDEWEB)

    Paz Freire, M.; Taboada Castro, J.; Rivas Brea, T.; Giraldez Perez, E.; Araujo Fernandez, M.

    2011-07-01

    One of the main problems involved in the mining of slate and ornamental granite is the unavoidable generation of waste rock, which must be stored in spoil heaps under suitably integrated, secure and stable conditions. Our work here focuses on this last point. To study the risk of instability within spoil heaps we have analysed the performance of a wide number of models with regard to circular slope failure, taking into account the different degrees of compactness of the material, the characteristics of the material itself, the effect of water pressure and the geometry of the heap. From this analysis we obtained more than 300 safety criteria, which were then used to draw up a series of nomograms to allow us to determine the risk of sliding in any granite or slate spoil heap. Thus, nomograms prove themselves to be suitable, quick, easy-to-use tools for preliminary studies of new structures, for periodic analyses of existing structures and to investigate structures that are due to be modified. (Author) 24 refs.

  14. Radiological and Environmental Monitoring at the Clean Slate I and III Sites, Tonopah Test Range, Nevada, With Emphasis on the Implications for Off-site Transport

    Energy Technology Data Exchange (ETDEWEB)

    Mizell, Steve A [Desert Research Inst. (DRI), Las Vegas, NV (United States); Etyemezian, Vic [Desert Research Inst. (DRI), Las Vegas, NV (United States); McCurdy, Greg [Desert Research Inst. (DRI), Las Vegas, NV (United States); Nikolich, George [Desert Research Inst. (DRI), Las Vegas, NV (United States); Shadel, Craig [Desert Research Inst. (DRI), Las Vegas, NV (United States); Miller, Julianne J [Desert Research Inst. (DRI), Las Vegas, NV (United States)

    2014-09-01

    In 1963, the U.S. Department of Energy (DOE) (formerly the Atomic Energy Commission [AEC]) implemented Operation Roller Coaster on the Tonopah Test Range (TTR) and an adjacent area of the Nevada Test and Training Range (NTTR) (formerly the Nellis Air Force Range [NAFR]). Operation Roller Coaster consisted of four tests in which chemical explosions were detonated in the presence of nuclear devices to assess the dispersal of radionuclides and evaluate the effectiveness of storage structures to contain the ejected radionuclides. These tests resulted in the dispersal of plutonium over the ground surface downwind of the test ground zero (GZ). Three tests—Clean Slate I, II, and III—were conducted on the TTR in Cactus Flat. The fourth, Double Tracks, was conducted in Stonewall Flat on the NTTR. The Desert Research Institute (DRI) installed two monitoring stations in 2008, Station 400 at the Sandia National Laboratories (SNL) Range Operations Center (ROC) and Station 401 at Clean Slate III. Station 402 was installed at Clean Slate I in 2011 to measure radiological, meteorological, and dust conditions. The monitoring activity was implemented to determine if radionuclide contamination in the soil at the Clean Slate sites was being transported beyond the contamination area boundaries. Some of the data collected also permits comparison of radiological exposure at the TTR monitoring stations to conditions observed at Community Environmental Monitoring Program (CEMP) stations around the NTTR. Annual average gross alpha values from the TTR monitoring stations are higher than values from the surrounding CEMP stations. Annual average gross beta values from the TTR monitoring stations are generally lower than values observed for the surrounding CEMP stations. This may be due to use of sample filters with larger pore space because when glass-fiber filters began to be used at TTR Station 400, gross beta values increased. Gamma spectroscopy typically identified only naturally

  15. Simplified clinical algorithm for identifying patients eligible for immediate initiation of antiretroviral therapy for HIV (SLATE): protocol for a randomised evaluation.

    Science.gov (United States)

    Rosen, Sydney; Fox, Matthew P; Larson, Bruce A; Brennan, Alana T; Maskew, Mhairi; Tsikhutsu, Isaac; Bii, Margaret; Ehrenkranz, Peter D; Venter, Wd Francois

    2017-05-28

    African countries are rapidly adopting guidelines to offer antiretroviral therapy (ART) to all HIV-infected individuals, regardless of CD4 count. For this policy of 'treat all' to succeed, millions of new patients must be initiated on ART as efficiently as possible. Studies have documented high losses of treatment-eligible patients from care before they receive their first dose of antiretrovirals (ARVs), due in part to a cumbersome, resource-intensive process for treatment initiation, requiring multiple clinic visits over a several-week period. The Simplified Algorithm for Treatment Eligibility (SLATE) study is an individually randomised evaluation of a simplified clinical algorithm for clinicians to reliably determine a patient's eligibility for immediate ART initiation without waiting for laboratory results or additional clinic visits. SLATE will enrol and randomise (1:1) 960 adult, HIV-positive patients who present for HIV testing or care and are not yet on ART in South Africa and Kenya. Patients randomised to the standard arm will receive routine, standard of care ART initiation from clinic staff. Patients randomised to the intervention arm will be administered a symptom report, medical history, brief physical exam and readiness assessment. Patients who have positive (satisfactory) results for all four components of SLATE will be dispensed ARVs immediately, at the same clinic visit. Patients who have any negative results will be referred for further clinical investigation, counselling, tests or other services prior to being dispensed ARVs. After the initial visit, follow-up will be by passive medical record review. The primary outcomes will be ART initiation ≤28 days and retention in care 8 months after study enrolment. Ethics approval has been provided by the Boston University Institutional Review Board, the University of the Witwatersrand Human Research Ethics Committee (Medical) and the KEMRI Scientific and Ethics Review Unit. Results will be published in

  16. The transformation sequence of cement-asbestos slates up to 1200 deg. C and safe recycling of the reaction product in stoneware tile mixtures

    International Nuclear Information System (INIS)

    Gualtieri, A.F.; Cavenati, C.; Zanatto, I.; Meloni, M.; Elmi, G.; Gualtieri, M. Lassinantti

    2008-01-01

    Cement-asbestos is the main asbestos containing material still found in most of the European countries such as Italy. Man- and weathering-induced degradation of the cement-asbestos slates makes them a source of dispersion of asbestos fibres and represents a priority cause of concern. This concern is the main prompt for the actual policy of abatement and disposal of asbestos containing materials in controlled wastes. An alternative solution to the disposal in dumping sites is the direct temperature-induced transformation of the cement-asbestos slates into non-hazardous mineral phases. This patented process avoids the stage of mechanical milling of the material before the treatment, which improves the reactivity of the materials but may be critical for the dispersion of asbestos fibres in working and life environment. For the first time, this paper reports the description of the reaction path taking place during the firing of cement-asbestos slates up to the complete transformation temperature, 1200 deg. C. The reaction sequence was investigated using different experimental techniques such as optical and electron microscopy, in situ and ex situ quali-quantitative X-ray powder diffraction. The understanding of the complex reaction path is of basic importance for the optimization of industrial heating processes leading to a safe recycling of the transformed product. For the recycling of asbestos containing materials, the Italian laws require that the product of the crystal chemical transformation of asbestos containing materials must be entirely asbestos-free, and should not contain more than 0.1 wt% fraction of the carcinogenic substances such as cristobalite. Moreover, if fibrous phases other than asbestos (with length to diameter ratio >3) are found, they must have a geometrical diameter larger than 3 μm. We have demonstrated that using an interplay of different experimental techniques, it is possible to safely verify the complete transformation of asbestos

  17. Geotechnical design of underground slate mines; Diseño geotécnico de minas subterráneas de pizarra

    Energy Technology Data Exchange (ETDEWEB)

    Iglesias Comesaña, C.; Taboada Castro, J.; Arzúa Touriño, J.; Giráldez Pérez, E.; Martín Suárez, J.M.

    2017-09-01

    Slate is one of the most important natural materials in Spain, with a potent extractive and processing industry concentrated in the autonomous communities of Galicia, Castile and León. Thanks to its resistance to external agents, its impermeability and its excellent cleavability, slate is used as for roofing and tiling. Almost all the active exploitations in our country where this resource is extracted are open pit mines, where the exploitation ratios have nearly reached their economic limit, making it necessary to look for alternatives that will allow the mining works to be continued. Underground mining is a solution that offers low exploitation ratios, with low spoil generation. The room-and-pillar method with barrier pillars is usually applied for the exploitation of slate deposits. There are several factors to be taken into account when designing a mine (economic, logistical, geotechnical, technical, environmental…), especially for an underground mine. This study focuses on the geotechnical design process of a room-and-pillar underground mine, based on the tributary area theory, the analysis of the tensions in the ground with numerical methods and the choice of an appropriate reinforcement in view of the expected instabilities. This explanation is completed with an example of a design that includes the estimate exploitation rates and production. [Spanish] La pizarra es uno de los materiales naturales más importantes de España, con una potente industria extractiva y de elaboración concentrada en las comunidades autónomas de Galicia y Castilla y León. Gracias a su resistencia a los agentes externos, a su impermeabilidad y a su excelente fisilidad, la pizarra es utilizada como elemento para techar y para solados. La práctica totalidad de las explotaciones activas en nuestro país extraen este recurso en minas a cielo abierto, cuyos ratios se aproximan al ratio límite económico, haciendo necesaria la búsqueda de una alternativa que permita continuar las

  18. Corrective Action Decision Document/Corrective Action Plan for Corrective Action Unit 413: Clean Slate II Plutonium Dispersion (TTR) Tonopah Test Range, Nevada. Revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Matthews, Patrick [Navarro, Las Vegas, NV (United States)

    2017-05-01

    This Corrective Action Decision Document/Corrective Action Plan provides the rationale and supporting information for the selection and implementation of corrective actions at Corrective Action Unit (CAU) 413, Clean Slate II Plutonium Dispersion (TTR). CAU 413 is located on the Tonopah Test Range and includes one corrective action site, TA-23-02CS. CAU 413 consists of the release of radionuclides to the surface and shallow subsurface from the Clean Slate II (CSII) storage–transportation test conducted on May 31, 1963. The CSII test was a non-nuclear detonation of a nuclear device located inside a concrete bunker covered with 2 feet of soil. To facilitate site investigation and the evaluation of data quality objectives decisions, the releases at CAU 413 were divided into seven study groups: 1 Undisturbed Areas 2 Disturbed Areas 3 Sedimentation Areas 4 Former Staging Area 5 Buried Debris 6 Potential Source Material 7 Soil Mounds Corrective action investigation (CAI) activities, as set forth in the CAU 413 Corrective Action Investigation Plan, were performed from June 2015 through May 2016. Radionuclides detected in samples collected during the CAI were used to estimate total effective dose using the Construction Worker exposure scenario. Corrective action was required for areas where total effective dose exceeded, or was assumed to exceed, the radiological final action level (FAL) of 25 millirem per year. The results of the CAI and the assumptions made in the data quality objectives resulted in the following conclusions: The FAL is exceeded in surface soil in SG1, Undisturbed Areas; The FAL is assumed to be exceeded in SG5, Buried Debris, where contaminated debris and soil were buried after the CSII test; The FAL is not exceeded at SG2, SG3, SG4, SG6, or SG7. Because the FAL is exceeded at CAU 413, corrective action is required and corrective action alternatives (CAAs) must be evaluated. For CAU 413, three CAAs were evaluated: no further action, clean closure, and

  19. A Case Study of the Activity Gravitational Deformation Slate Slope on One Newly Rebuild Highway Bridge in Taitung Longitudinal Valley of Taiwan

    Science.gov (United States)

    Hsieh, Pei-Chen; Weng, Cheng-Hsueh; Lu, An; Lin, Ming-Lang

    2017-04-01

    There are many landslide hazards induced by typhoon and earthquake in Taiwan because Taiwan is located in active orogen zone, where the Taitung Longitudinal Valley is the plate boundary, and also many typhoons hit Taiwan and bring much precipitation. In Japan, where also is located in orogen zone, the 2016 Kumamoto Earthquake caused a large landslide which destroyed the Great Aso Bridge. It shows that landslides might have huge influence on the safety of bridges. In Sep. 2016, Typhoon No.14 (Meranti) hit Taiwan and caused a slate slope failure which located in Taitung Longitudinal Valley. It cut the approach road of a highway bridge called Songfeng Bridge and the maximum displacement is about 2 meters. The landslide body might include the bridge, and if this landslide continued move the bridge structure might be destroyed. The attitude of cleavage and joints measured in site investigation are complex and confused, it imply that this landslide event is not only controlled by gravitational deformation, but also affected by release joint and river erosion because the site is located on confluence of two river. The target of site investigation in this research includes finding the border of failure surface and the measurement of cleavage and joints. In this research, we compare the result of site investigation and numerical model to find the mechanism of failure, and try to analysis the possible influence on the bridge structure.

  20. Corrective Action Investigation Plan for Corrective Action Unit 414: Clean Slate III Plutonium Dispersion (TTR) Tonopah Test Range, Nevada, Revision 1

    International Nuclear Information System (INIS)

    Matthews, Patrick

    2016-01-01

    Corrective Action Unit (CAU) 414 is located on the Tonopah Test Range, which is approximately 130 miles northwest of Las Vegas, Nevada, and approximately 40 miles southeast of Tonopah, Nevada. The CAU 414 site consists of the release of radionuclides to the surface and shallow subsurface from the conduct of the Clean Slate III (CSIII) storage transportation test conducted on June 9, 1963. CAU 414 includes one corrective action site (CAS), TA-23-03CS (Pu Contaminated Soil). The known releases at CAU 414 are the result of the atmospheric dispersal of contamination from the 1963 CSIII test. The CSIII test was a nonnuclear detonation of a nuclear device located inside a reinforced concrete bunker covered with 8 feet of soil. This test dispersed radionuclides, primarily uranium and plutonium, on the ground surface. The presence and nature of contamination at CAU 414 will be evaluated based on information collected from a corrective action investigation (CAI). The investigation is based on the data quality objectives (DQOs) developed on June 7, 2016, by representatives of the Nevada Division of Environmental Protection; the U.S. Air Force; and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Field Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective action alternatives for CAU 414.

  1. Corrective Action Investigation Plan for Corrective Action Unit 414: Clean Slate III Plutonium Dispersion (TTR) Tonopah Test Range, Nevada, Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Matthews, Patrick [Navarro, Las Vegas, NV (United States)

    2016-09-01

    Corrective Action Unit (CAU) 414 is located on the Tonopah Test Range, which is approximately 130 miles northwest of Las Vegas, Nevada, and approximately 40 miles southeast of Tonopah, Nevada. The CAU 414 site consists of the release of radionuclides to the surface and shallow subsurface from the conduct of the Clean Slate III (CSIII) storage–transportation test conducted on June 9, 1963. CAU 414 includes one corrective action site (CAS), TA-23-03CS (Pu Contaminated Soil). The known releases at CAU 414 are the result of the atmospheric dispersal of contamination from the 1963 CSIII test. The CSIII test was a nonnuclear detonation of a nuclear device located inside a reinforced concrete bunker covered with 8 feet of soil. This test dispersed radionuclides, primarily uranium and plutonium, on the ground surface. The presence and nature of contamination at CAU 414 will be evaluated based on information collected from a corrective action investigation (CAI). The investigation is based on the data quality objectives (DQOs) developed on June 7, 2016, by representatives of the Nevada Division of Environmental Protection; the U.S. Air Force; and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Field Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective action alternatives for CAU 414.

  2. Estimated probabilities, volumes, and inundation areas depths of potential postwildfire debris flows from Carbonate, Slate, Raspberry, and Milton Creeks, near Marble, Gunnison County, Colorado

    Science.gov (United States)

    Stevens, Michael R.; Flynn, Jennifer L.; Stephens, Verlin C.; Verdin, Kristine L.

    2011-01-01

    During 2009, the U.S. Geological Survey, in cooperation with Gunnison County, initiated a study to estimate the potential for postwildfire debris flows to occur in the drainage basins occupied by Carbonate, Slate, Raspberry, and Milton Creeks near Marble, Colorado. Currently (2010), these drainage basins are unburned but could be burned by a future wildfire. Empirical models derived from statistical evaluation of data collected from recently burned basins throughout the intermountain western United States were used to estimate the probability of postwildfire debris-flow occurrence and debris-flow volumes for drainage basins occupied by Carbonate, Slate, Raspberry, and Milton Creeks near Marble. Data for the postwildfire debris-flow models included drainage basin area; area burned and burn severity; percentage of burned area; soil properties; rainfall total and intensity for the 5- and 25-year-recurrence, 1-hour-duration-rainfall; and topographic and soil property characteristics of the drainage basins occupied by the four creeks. A quasi-two-dimensional floodplain computer model (FLO-2D) was used to estimate the spatial distribution and the maximum instantaneous depth of the postwildfire debris-flow material during debris flow on the existing debris-flow fans that issue from the outlets of the four major drainage basins. The postwildfire debris-flow probabilities at the outlet of each drainage basin range from 1 to 19 percent for the 5-year-recurrence, 1-hour-duration rainfall, and from 3 to 35 percent for 25-year-recurrence, 1-hour-duration rainfall. The largest probabilities for postwildfire debris flow are estimated for Raspberry Creek (19 and 35 percent), whereas estimated debris-flow probabilities for the three other creeks range from 1 to 6 percent. The estimated postwildfire debris-flow volumes at the outlet of each creek range from 7,500 to 101,000 cubic meters for the 5-year-recurrence, 1-hour-duration rainfall, and from 9,400 to 126,000 cubic meters for

  3. Changes of porosity due to weathering in quartzites and slates of a Raña profile (Montes de Toledo, Central Spain

    Directory of Open Access Journals (Sweden)

    Molina Ballesteros, E.

    2013-12-01

    Full Text Available Rañas are alluvial fan deposits of Plio-Pleistocene age that form the piedmont platforms around the mountains in the interior of the Iberian Peninsula. They are composed of cobbles, pebbles and gravels of quartzite and some quartz, all embedded within a clayey matrix displaying striking changes in hues due to hydromorphism. Beneath these platforms, the Hercynian basement is consistently deeply weathered. In the profile of the Raña, the quartzite stones located into the clayey horizon have a weathering rind that is whitish to ochre in colour, in contrast to the dark reddish hue of those located within the leaching horizon, just below the land surface. These differences are related to changes in the physical properties (e.g., bulk density and porosity, mineralogy (presence of oxyhydroxides and weathering processes that have taken place in the profile. Such processes have led to the corrosion and replacement of the quartz grains by the iron oxyhydroxides. The main cause is the dramatic changes in the water regime occurring in the pores at the surfaces of the quartzite stones. Due to weathering the slates outcropping beneath the Raña have undergone important release of matter (ca. 30%, together with changes in the mineral association, with a progressive reduction in the component of the unweathered slates and an increase in new minerals (smectites, kaolinite and iron oxyhydroxides upwards.Las Rañas son depósitos de abanicos aluviales del Plio-Pleistoceno que forman plataformas de piedemonte alrededor de las montanas del interior de la Peninsula Iberica. Estan formadas de bloques, cantos y gravas de cuarcita dominantes y algún cuarzo engastados en una matriz arcillosa que muestra importantes contrastes de color causados por hidromorfismo. Bajo estas plataformas, el zocalo hercinico se encuentra profundamente alterado. En un perfil de Rana se distinguen dos tipos de horizontes: i el superior, de pocos decimetros de grosor, rico en cantos, gravas

  4. Corrective Action Investigation Plan for Corrective Action Unit 413: Clean Slate II Plutonium Dispersion (TTR) Tonopah Test Range, Nevada, Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    Matthews, Patrick; Burmeister, Mark; Gallo, Patricia

    2016-04-21

    Corrective Action Unit (CAU) 413 is located on the Tonopah Test Range, which is approximately 130 miles northwest of Las Vegas, Nevada, and approximately 40 miles southeast of Tonopah, Nevada. The CAU 413 site consists of the release of radionuclides to the surface and shallow subsurface from the conduct of the Clean Slate II (CSII) storage–transportation test conducted on May 31, 1963. CAU 413 includes one corrective action site (CAS), TA-23-02CS (Pu Contaminated Soil). The known releases at CAU 413 are the result of the atmospheric deposition of contamination from the 1963 CSII test. The CSII test was a non-nuclear detonation of a nuclear device located inside a reinforced concrete bunker covered with 2 feet of soil. This test dispersed radionuclides, primarily plutonium, on the ground surface. The presence and nature of contamination at CAU 413 will be evaluated based on information collected from a corrective action investigation (CAI). The investigation is based on the data quality objectives (DQOs) developed on June 17, 2015, by representatives of the Nevada Division of Environmental Protection; the U.S. Air Force; and the U.S. Department of Energy (DOE), National Nuclear Security Administration Nevada Field Office. The DQO process was used to identify and define the type, amount, and quality of data needed to develop and evaluate appropriate corrective actions for CAU 413. The CAI will include radiological surveys, geophysical surveys, collection and analyses of soil samples, and assessment of investigation results. The collection of soil samples will be accomplished using both probabilistic and judgmental sampling approaches. To facilitate site investigation and the evaluation of DQO decisions, the releases at CAU 413 have been divided into seven study groups.

  5. New steam generators slated for nuclear units

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    This article is a brief discussion of Duke Power's plans to replace steam generators at its McGuire and Catawba nuclear units. A letter of intent to purchase (from Babcock and Wilcox) the 12 Westinghouse steam generators has been signed, but no constructor has been selected at this time. This action is brought about by the failures of more than 3000 tubes in these units

  6. Venezuela slates second oil field revival round

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    This paper reports that Venezuela will accept bids under a second round next year from private foreign and domestic companies for production contracts to operate marginal active as well as inactive oil fields. The first such round came earlier this year, involving about 55 other marginal, inactive fields. It resulted in two contractors signed with domestic and foreign companies. It represented the first time since nationalization of the petroleum industry in Venezuela in 1976 that private companies were allowed to produce oil in the country. A public bid tender was expected at presstime last week

  7. PV/T slates - Energy-efficiency optimisation for buildings using simulation and measurement - Back-ventilated photovoltaics as an example; PV/T-Schiefer. Optimierung der Energieeffizienz von Gebaeuden durch gegenseitige Ergaenzung von Simulation und Messung am Beispiel der Hinterlueftung gebaeudeintegrierter Photovoltaik

    Energy Technology Data Exchange (ETDEWEB)

    Kropf, S.

    2003-07-01

    This report for the Swiss Federal Office of Energy (SFOE) is the introductory report to a series of five reports dealing with increasing the overall efficiency of photovoltaic (PV) installations by also using the heat collected by the dark-coloured PV panels. This introductory report summarises the findings of the project. The work reported on addresses open questions on the use of the heat and its optimal use. A mathematical model for the calculation of the dynamic gain is described. Reports 1 and 2 deal with an experimental outdoor set-up and in-situ measurements made on the prototype of a ventilated PV-tile system (PV/T-Slates). In report 3 the simulation model for the dynamic calculation of the heat gain from the PV/T-Slates using climatic data available is described in detail. Measured data from reports 1 and 2 are compared with the simulation results. In the yield atlas (report 4) the heat gain expected is subdivided into classes of temperature and presented for three locations in different Swiss climatic regions. In report 5 it is shown with the help of the yield-atlas how the degree of utilisation can be estimated. Two promising applications (domestic hot water preheating for a hotel in Lugano and seasonal ground heat storage for a Minergie low energy consumption house in Davos) are selected for detailed investigation using the new numerical model.

  8. 11 CFR 100.140 - Slate cards and sample ballots.

    Science.gov (United States)

    2010-01-01

    ... on broadcasting stations, or in newspapers, magazines, and similar types of general public political advertising such as billboards. But see 11 CFR 100.24, 104.17(a), and part 300, subpart B for exempt...

  9. 11 CFR 100.80 - Slate cards and sample ballots.

    Science.gov (United States)

    2010-01-01

    ... on broadcasting stations, or in newspapers, magazines, and similar types of general public political advertising such as billboards. But see 11 CFR 100.24, 104.17(a) and part 300, subpart B for exempt activities...

  10. Operation : motor city : Michigan's only refinery to handle an increased slate of heavy Canadian crude

    International Nuclear Information System (INIS)

    Jaremko, D.

    2008-01-01

    A planned $1.9 billion upgrade and expansion will see a Detroit, Michigan refinery producing nearly 100 per cent Canadian crude oil. The upgrade will have important social, economic, and environmental implications for the oil sands industry, and is being seen as an important step for the future of the entire energy industry. The site was selected after a consultation of pipeline routes in North America. The refinery's coking capacity will help to ease the market constraints that Canadian crude is currently facing in the United States. The Midwest downstream oil and gas industry is well-positioned to help maximize the value of Canada's bitumen resources. In addition to expanding processing facilities, the refinery will also add capacity of approximately 15,000 barrels per day, as well as a delayed coker, sulphur recovery complex, ultra-low nitrogen oxide (NO x ) burners, a 33,000 barrel-per-day distillate hydrotreater, and a hydrogen plant. It was concluded that construction of the refinery will be completed by 2010. 2 figs

  11. China's refiners face massive overhaul, expansion to meet demand growth, new crude slate

    International Nuclear Information System (INIS)

    Anon.

    1994-01-01

    China's refining industry has embarked on a massive overhaul and expansion to accommodate soaring domestic growth in refined products demand. Currently that growth in demand is being met by increasing imports of refined products, in recent years attaining triple digit growth rates and squeezing direly needed foreign exchange. The focus is on adding refining capacity of about 1.4 million b/d to the current capacity of about 3.2 million b/d by 2000. Priority for increasing capacity is being given to expanding existing refineries and participating in foreign joint venture grassroots refineries along China's booming coastal regions as well as hiking output. A major challenge for China's refineries is that country's reentry into the General Agreement on Tariffs and Trade (GATT), recently signed in Morocco by more than 100 nations. The accompanying reduction of tariffs on imported refined products will make it more difficult for China's marginal refineries to compete in the domestic market. The paper discusses imports and exports, LPG outlook, refining capacity, revamps needed, third party processing, China's first joint venture refinery, industry plans, and GATT challenges

  12. States Pass Diverse Slate of Mental Health Legislation in 2013. Mental Health: 2013 Legislative Session

    Science.gov (United States)

    Thomsen, Jennifer

    2014-01-01

    Recent violence in schools and on college campuses has brought into sharp focus the need to address mental health issues in educational settings. Getting students with mental health problems the help they need, without stigmatizing mental illness, may help prevent future tragedies. Children with mental health problems face a host of challenges,…

  13. Information Types in Nonmimetic Documents: A Review of Biddle's Wipe-Clean Slate (Understanding Documents).

    Science.gov (United States)

    Mosenthal, Peter B.; Kirsch, Irwin S.

    1991-01-01

    Describes how the 16 permanent lists used by a first grade reading teacher (and mother of 6) to manage the household represents the whole range of documents covered in the 3 major types of documents: matrix documents, graphic documents, and locative documents. Suggests class activities to clarify students' understanding of the information in…

  14. Semantically Aware Foundation Environment (SAFE) for Clean-Slate Design of Resilient, Adaptive Secure Hosts (CRASH)

    Science.gov (United States)

    2016-02-01

    any IFC policies and is simply a convenient technique used in Breeze application development. An example of a boxed channel is shown below: datatype ...server tutorial to implement requests. The sum server acts on a SumMessage, which has the form: datatype SumMessage = | SumRequest Int Int (Int

  15. Wiping the Slate Clean: A New Federalism for the 21st Century Student. State-Federal Partnerships in Postsecondary Education

    Science.gov (United States)

    Applegate, James L.; Fulton, Mary

    2016-01-01

    Substantial increases in federal support for higher education over the last decade or more have made the federal government the largest direct investor in U.S. higher education. That increase however, has not produced the expected level of increase in college educated people in the workforce. This is largely for two reasons. First the investment…

  16. Antioxidant Potential and DNA Damage Protection by the Slate Grey Saddle Mushroom, Helvella lacunosa (Ascomycetes), from Kashmir Himalaya (India).

    Science.gov (United States)

    Shameem, Nowsheen; Kamili, Azra N; Ahmad, Mushtaq; Masoodi, F A; Parray, Javid A

    2016-01-01

    This study pertains to the radical scavenging potential of and DNA protection by Helvella lacunosa, an edible mushroom from Kashmir Himalaya (India). Different solvents, on the basis of their polarities, were used to extract all solvent-soluble bioactive compounds. Seven different antioxidant methods were also used to determine extensive radical scavenging activity. The mushroom ethanol extract and butanol extract showed effective scavenging activity of radicals at 95% and 89%, respectively. At 800 µg/mg, the ethanol extract was potent enough to protect DNA from degradation by hydroxyl radicals. It is evident from these findings that the presence of antioxidant substances signifies the use of H. lacunosa as food in the mountainous valleys of the Himalayan region.

  17. The hydrological and economic importance of the Rhine, from its sources to its entry into the Rhenish Slate Mountains

    International Nuclear Information System (INIS)

    Calvis, H.

    1981-01-01

    Using example of Europe's most important river, investigations are carried out on the conditions and problems occurring where water- and energy economy are interacting, as well as on the different characteristics they assume in the various sections of the river. The influence of the hydroelectric power plants, the conventional thermal power plants and the nuclear power plants upon the water economy is reviewed. Moreover, the importance of these power plants within the total energy economy of the individual adjacent countries as well as the economic effects they cause to their site areas are considered. (HSCH) [de

  18. Geochemical study for primary dispersion of trace elements in uranium bearing black slates of the Ogcheon Group, Korea

    International Nuclear Information System (INIS)

    Kim, O.B.

    1980-01-01

    Total 145 boring core samples of Deogpyongri, Geosan and Mogsori, Geumsan in Ogcheon Group have been collected and analyzed for uranium and trace elements such as lead, zinc, copper, chromium, cadmium, vanadium and mloybdenium. All the data of the elments analyzed have been processed statistically by computer in order to estimate the correlation co-efficient between elements. The vertical distribution pattern of trace elements has been discussed. The results obtained are summarized as follows: Uranium has high correlation co-efficients with vanadium and molybdenium. And the last two can be used as indicator elements for the geochemical prospecting of uranium. The occurrence of uranium is closely related with the carbonaceous material in boring core of Ogcheon Group. Considering the vertical distribution pattern of uranium, it can't be said that the epigenetic uranium absorption to the carbonaceous material is in progress. The uranium minerals in the carbonanceous material must be correctly defined to resolve the genetic problems of uranium deposit in Ogcheon Group. (Author)

  19. Enhancing Enterprise 2.0 Ecosystems Using Semantic Web and Linked Data Technologies:The SemSLATES Approach

    Science.gov (United States)

    Passant, Alexandre; Laublet, Philippe; Breslin, John G.; Decker, Stefan

    During the past few years, various organisations embraced the Enterprise 2.0 paradigms, providing their employees with new means to enhance collaboration and knowledge sharing in the workplace. However, while tools such as blogs, wikis, and principles like free-tagging or content syndication allow user-generated content to be more easily created and shared in the enterprise, in spite of some social issues, these new practices lead to various problems in terms of knowledge management. In this chapter, we provide an approach based on Semantic Web and Linked Data technologies for (1) integrating heterogeneous data from distinct Enterprise 2.0 applications, and (2) bridging the gap between raw text and machine-readable Linked Data. We discuss the theoretical background of our proposal as well as a practical case-study in enterprise, focusing on the various add-ons that have been provided to the original information system, as well as presenting how public Linked Open Data from the Web can be used to enhance existing Enterprise 2.0 ecosystems.

  20. Simplified clinical algorithm for identifying patients eligible for immediate initiation of antiretroviral therapy for HIV (SLATE): protocol for a randomised evaluation

    OpenAIRE

    Rosen, Sydney; Fox, Matthew P; Larson, Bruce A; Brennan, Alana T; Maskew, Mhairi; Tsikhutsu, Isaac; Bii, Margaret; Ehrenkranz, Peter D; Venter, WD Francois

    2017-01-01

    Introduction African countries are rapidly adopting guidelines to offer antiretroviral therapy (ART) to all HIV-infected individuals, regardless of CD4 count. For this policy of ‘treat all’ to succeed, millions of new patients must be initiated on ART as efficiently as possible. Studies have documented high losses of treatment-eligible patients from care before they receive their first dose of antiretrovirals (ARVs), due in part to a cumbersome, resource-intensive process for treatment initia...

  1. A Running Start or a Clean Slate? How a History of Cooperation Affects the Ability of Cities to Cooperate on Environmental Governance

    Directory of Open Access Journals (Sweden)

    Rui Mu

    2018-06-01

    Full Text Available Since 2013, the Chinese central government has pushed cooperation on environmental governance in Urban Agglomerations (UAs. In some of these UAs, cities have previously been developing environmental governance activities autonomously, in the absence of inter-city cooperation, while on others, spontaneous cooperation has previously taken place. These differences in historical context provide us with an opportunity to study, in a comparative way, how a history of cooperation influences the effectiveness of inter-city cooperation on environmental governance. Our approach to carrying out this comparison is to reconstruct the trajectories of events that describe the evolution of environmental governance in two UAs (Beijing-Tianjin-Hebei and Yangtze River Delta, covering the period from the early 90s to 2016. The main findings of this study are that the trajectory of environmental governance in a historical context of prior spontaneous cooperation is more effective in achieving goal intertwinement than that in a historical context of no prior cooperation; and that informal forms of cooperation, along with decentralized coordination by local actors, are critical and more influential in bringing about more effective cooperation. On the other hand, in a historical context of no prior cooperation there is an opportunity to design a cooperative structure from scratch; in this process attention should be paid to the creation of an equal playing ground, with balanced costs and benefits for all partners. By contrast, cooperation on environmental governance in a context where there is a history of spontaneous cooperation the central government can still play a role in the further facilitation of cooperation.

  2. Streamlined approach for environmental restoration (SAFER) plan for corrective action unit 412: clean slate I plutonium dispersion (TTR) tonopah test range, Nevada, revision 0

    Energy Technology Data Exchange (ETDEWEB)

    Matthews, Patrick K.

    2015-04-01

    This Streamlined Approach for Environmental Restoration (SAFER) Plan addresses the actions needed to achieve closure for Corrective Action Unit (CAU) 412. CAU 412 is located on the Tonopah Test Range and consists of a single corrective action site (CAS), TA-23-01CS, Pu Contaminated Soil. There is sufficient information and historical documentation from previous investigations and the 1997 interim corrective action to recommend closure of CAU 412 using the SAFER process. Based on existing data, the presumed corrective action for CAU 412 is clean closure. However, additional data will be obtained during a field investigation to document and verify the adequacy of existing information and determine whether the CAU 412 closure objectives have been achieved. This SAFER Plan provides the methodology to gather the necessary information for closing the CAU.The following summarizes the SAFER activities that will support the closure of CAU 412:• Collect environmental samples from designated target populations to confirm or disprove the presence of contaminants of concern (COCs) as necessary to supplement existing information.• If no COCs are present, establish clean closure as the corrective action. • If COCs are present, the extent of contamination will be defined and further corrective actions will be evaluated with the stakeholders (NDEP, USAF).• Confirm the preferred closure option is sufficient to protect human health and the environment.

  3. Dicty_cDB: VFL542 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available slated Amino Acid sequence ---LXXPLNXXTKXMVNXESXEKXKXGVXIINVSKGALVXAXXAXVGLKSGKXXSLGXDX YEXETXYFXQXPXGSIXKXXNXXLLIS*pnvmips...SLGXDX YEXETXYFXQXPXGSIXKXXNXXLLIS*pnvmipsxxawdxkkalswxcgtsxqxfvdfr snxixkxnlvxxp

  4. One Family's Struggles with Rotavirus

    Medline Plus

    Full Text Available ... of formats and lengths for use by your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right- ...

  5. One Family's Struggles with Pertussis (Whooping Cough)

    Medline Plus

    Full Text Available ... of formats and lengths for use by your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right- ...

  6. One Family's Struggles with HPV (Human Papillomavirus)

    Medline Plus

    Full Text Available ... of formats and lengths for use by your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right- ...

  7. One Family's Struggles with Hepatitis B

    Medline Plus

    Full Text Available ... of formats and lengths for use by your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right- ...

  8. One Family's Struggle with Chickenpox

    Medline Plus

    Full Text Available ... of formats and lengths for use by your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right- ...

  9. One Family's Struggles with HPV (Human Papillomavirus)

    Medline Plus

    Full Text Available ... ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right-click any link to download to your computer. Audio PSAs :30-second branded MP3 :30-second ...

  10. One Family's Struggles with Hepatitis B

    Medline Plus

    Full Text Available ... ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right-click any link to download to your computer. Audio PSAs :30-second branded MP3 :30-second ...

  11. One Family's Struggles with Pertussis (Whooping Cough)

    Medline Plus

    Full Text Available ... ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right-click any link to download to your computer. Audio PSAs :30-second branded MP3 :30-second ...

  12. One Family's Struggles with Rotavirus

    Medline Plus

    Full Text Available ... ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right-click any link to download to your computer. Audio PSAs :30-second branded MP3 :30-second ...

  13. One Family's Struggle with Chickenpox

    Medline Plus

    Full Text Available ... ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right-click any link to download to your computer. Audio PSAs :30-second branded MP3 :30-second ...

  14. 40 CFR 60.671 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... following minerals: (1) Crushed and Broken Stone, including Limestone, Dolomite, Granite, Traprock, Sandstone, Quartz, Quartzite, Marl, Marble, Slate, Shale, Oil Shale, and Shell. (2) Sand and Gravel. (3...

  15. Dicty_cDB: VSF280 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available slated Amino Acid sequence qi*KHCIKLTFIKKK--- ---SNSKVVVIWING*hhlkfvillmvligksiemvvlllliviviqlplislilqlelv q...lf pvefksipliaitlghidttsadatgtnvyqqtrvdvqainvtx Frame B: snlktly*infy*kk--- ---SNSKVVVIWING*hhlkfvillmvligksiem

  16. French and US Army’s dilemma Between Athena and Ares: Keep a Sense of Humanity in a Technological Warfare?

    Science.gov (United States)

    2014-06-13

    insectes- cyborgs -attaquent (accessed 12 March 2014). 28Michael Walzer, Noncombattant Immunity and Military Necessity: Just and Unjust Wars (New-York...BIBLIOGRAPHY Allenby, Brad. La Guerre technologique. slate.fr, 11 June 2010. http://www.slate.fr/ story/22881/guerre-technologique-insectes- cyborgs

  17. One Family's Struggles with Hepatitis B

    Medline Plus

    Full Text Available ... your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right-click any link to download to your computer. ...

  18. One Family's Struggles with HPV (Human Papillomavirus)

    Medline Plus

    Full Text Available ... your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right-click any link to download to your computer. ...

  19. One Family's Struggles with Pertussis (Whooping Cough)

    Medline Plus

    Full Text Available ... your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right-click any link to download to your computer. ...

  20. One Family's Struggle with Chickenpox

    Medline Plus

    Full Text Available ... your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right-click any link to download to your computer. ...

  1. One Family's Struggles with Rotavirus

    Medline Plus

    Full Text Available ... your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations wishing to create their own end slates. Right-click any link to download to your computer. ...

  2. die ••zuidafrikaanse vliegeniers korps" : vliegtuie en personeel vir en ...

    African Journals Online (AJOL)

    found in order except that two under shaper slates on elevator were broken. Corporal Turnbull, under superintendance of Sergt. Buck, re- paired this by placing a small block of wood between the slates inside the elevator. I received telegram from Major Wallace to return to WALVIS on the 10th inst: At 4.30 I tested engine, ...

  3. Why Not Charter School Boards?

    Science.gov (United States)

    Schlechty, Phillip C.; Cole, Robert W.

    1993-01-01

    Claiming that individual school board members act in selfish ways, proposes electing entire school board as a slate. Board would collectively be held responsible for performance of the school system and all of its employees. State legislation would be required to specify how interested groups would select a slate and create a charter, which is the…

  4. 75 FR 22576 - Minority Science and Engineering Improvement Program

    Science.gov (United States)

    2010-04-29

    ... DEPARTMENT OF EDUCATION [CFDA No. 84.120A] Minority Science and Engineering Improvement Program... the fiscal year (FY) 2009 grant slate for the Minority Science and Engineering Improvement Program. SUMMARY: The Secretary intends to use the grant slate developed in FY 2009 for the Minority Science and...

  5. 76 FR 44000 - Environmental Impact Statements; Notice of Availability

    Science.gov (United States)

    2011-07-22

    ..., Review Period Ends: 08/15/2011, Contact: Charles J. O'Neill 615-781-5772. EIS No. 20110226, Draft EIS, USFS, ID, Little Slate Project, Proposes Watershed Improvement, Timber Harvest, Fuel Treatments, Soil Restoration and Access Changes in the Little Slate Creek, Salmon River Ranger District, Nez Perce National...

  6. 75 FR 58373 - Gaining Early Awareness and Readiness for Undergraduate Programs (GEAR UP)

    Science.gov (United States)

    2010-09-24

    ... Readiness for Undergraduate Programs (GEAR UP) AGENCY: Office of Postsecondary Education, Department of Education. ACTION: Notice of intent to fund down the fiscal year (FY) 2008 grant slate for the GEAR UP Program. SUMMARY: The Secretary intends to use the grant slate developed in FY 2008 for the GEAR UP...

  7. Combustion Mechanisms of Very High Burn Rate (VHBR) Propellant. Phase II.

    Science.gov (United States)

    1995-09-01

    potassium salt of B10H1 2-. The Kraton slate and the Hycar slate both contain RDX as the oxidizer, while the PEG slate contains HMX and TAGN in the... polyacrylate (Hycar), hydroxy-terminated polybutadiene, and a mixture of styrene and ethylene-butylene (Kraton). As might be expected, when all else is equal...proprietary formulations of Teledyne-McCormick-Selph (TMS), designated H498 and H466. In H498, a potassium cation is utilized, while in H466, an

  8. 75 FR 46918 - National Assessment Governing Board; Meeting

    Science.gov (United States)

    2010-08-04

    ... commence, the Board needs to act on the slate of nominees at the August 7, 2010 meeting. Therefore this... invasion of personal privacy. As such, the discussions are protected by exemptions 2 and 6 of section 552b...

  9. Comparison between different bio-treatments of a hydrocarbon ...

    African Journals Online (AJOL)

    Ramya

    2011-10-31

    Oct 31, 2011 ... We investigated the bio-remediation of a hydrocarbon contaminated soil pile that was slated for landfill ... soils, plants and in the food chain (Kipopoulou et al., ...... Scientific and Social Research, Putra Palace, Perlis, Malaysia.

  10. Štípatelné břidlice České republiky a petrografické metody pro hodnocení kvality jejich stavebního užití

    Czech Academy of Sciences Publication Activity Database

    Daněk, T.; Vavro, Martin; Moučka, L.

    2013-01-01

    Roč. 12, 1-2 (2013), s. 15-19 ISSN 1213-7308 Institutional support: RVO:68145535 Keywords : roofing slate * building use * quality * petrographic methods * mining history Subject RIV: JN - Civil Engineering

  11. One Family's Struggles with Rotavirus

    Medline Plus

    Full Text Available ... tb overview links & resources families advocacy about civil rights kids' rights sample school policies school letter someone you know ... organizations wishing to create their own end slates. Right-click any link to download to your computer. ...

  12. One Family's Struggle with Chickenpox

    Medline Plus

    Full Text Available ... tb overview links & resources families advocacy about civil rights kids' rights sample school policies school letter someone you know ... organizations wishing to create their own end slates. Right-click any link to download to your computer. ...

  13. One Family's Struggles with Pertussis (Whooping Cough)

    Medline Plus

    Full Text Available ... tb overview links & resources families advocacy about civil rights kids' rights sample school policies school letter someone you know ... organizations wishing to create their own end slates. Right-click any link to download to your computer. ...

  14. One Family's Struggles with HPV (Human Papillomavirus)

    Medline Plus

    Full Text Available ... tb overview links & resources families advocacy about civil rights kids' rights sample school policies school letter someone you know ... organizations wishing to create their own end slates. Right-click any link to download to your computer. ...

  15. One Family's Struggles with Hepatitis B

    Medline Plus

    Full Text Available ... tb overview links & resources families advocacy about civil rights kids' rights sample school policies school letter someone you know ... organizations wishing to create their own end slates. Right-click any link to download to your computer. ...

  16. One Family's Struggles with HPV (Human Papillomavirus)

    Medline Plus

    Full Text Available ... getvaxed about GETVAXED print ads go to GETVAXED.ORG cme Immunizations HPV (Human Papillomavirus) One family's struggles ... free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations ...

  17. One Family's Struggles with Hepatitis B

    Medline Plus

    Full Text Available ... getvaxed about GETVAXED print ads go to GETVAXED.ORG cme Immunizations Hepatitis B One family's struggles with ... free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations ...

  18. One Family's Struggles with Rotavirus

    Medline Plus

    Full Text Available ... getvaxed about GETVAXED print ads go to GETVAXED.ORG cme Immunizations Rotavirus One family's struggles with rotavirus ... free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations ...

  19. One Family's Struggles with Pertussis (Whooping Cough)

    Medline Plus

    Full Text Available ... getvaxed about GETVAXED print ads go to GETVAXED.ORG cme Immunizations Pertussis (Whooping Cough) One family's struggles ... free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations ...

  20. One Family's Struggle with Chickenpox

    Medline Plus

    Full Text Available ... getvaxed about GETVAXED print ads go to GETVAXED.ORG cme Immunizations Chickenpox (Varicella) One family's struggles with ... free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded videos are provided for organizations ...

  1. Tonopah Test Range Air Monitoring: CY2016 Meteorological, Radiological, and Wind Transported Particulate Observations

    Energy Technology Data Exchange (ETDEWEB)

    Chapman, Jenny [Desert Research Inst. (DRI), Las Vegas, NV (United States); Nikolich, George [Desert Research Inst. (DRI), Las Vegas, NV (United States); Shadel, Craig [Desert Research Inst. (DRI), Las Vegas, NV (United States); McCurdy, Greg [Desert Research Inst. (DRI), Las Vegas, NV (United States); Etyemezian, Vicken [Desert Research Inst. (DRI), Las Vegas, NV (United States); Miller, Julianne J [Desert Research Inst. (DRI), Las Vegas, NV (United States); Mizell, Steve [Desert Research Inst. (DRI), Las Vegas, NV (United States)

    2017-10-01

    In 1963, the U.S. Department of Energy (DOE) (formerly the Atomic Energy Commission [AEC]), implemented Operation Roller Coaster on the Tonopah Test Range (TTR) and an adjacent area of the Nevada Test and Training Range (NTTR) (formerly the Nellis Air Force Range). This operation resulted in radionuclide-contaminated soils at the Clean Slate I, II, and III sites. This report documents observations made during ongoing monitoring of radiological, meteorological, and dust conditions at stations installed adjacent to Clean Slate I and Clean Slate III, and at the TTR Sandia National Laboratories (SNL) Range Operations Control (ROC) center. The primary objective of the monitoring effort is to determine if wind blowing across the Clean Slate sites is transporting particles of radionuclide-contaminated soil beyond the physical and administrative boundaries of the sites.

  2. No Further Action Decision Under CERCLA, Study Area 14, Landfill No. 10, Fort Devens, Massachusetts

    National Research Council Canada - National Science Library

    1995-01-01

    .... Department of Defense as a potential site of contamination. SA 14 is an abandoned and flooded slate quarry approximately 1 acre in size, located on an unnamed dirt road in the north central portion of the South Post...

  3. Nuevos datos sobre estratigrafía del Ordovícico y estructura varisca en el Macizo de Santa María la Real de Nieva

    OpenAIRE

    Alonso, F.; Rubio, F. J.; Martín Parra, L. M.; Rodríguez Fernández, L. R.

    2004-01-01

    We present a new geological map of the lower Ordovician materials cropping out in the Santa Maria la Real de Nieva Massif. The Ordovician sequence, Fm. Capas de Domingo García, comprises two separate stratigraphic units. The lower unit contains conglomerate with clasts of felsic volcanic rocks at its base, slates, and quartzite with cruziana. The upper unit is composed by the quartzite and slate, which is considered a regional equivalent of the sequence at the base of the Armorica...

  4. Tonopah Test Range Air Monitoring: CY2015 Meteorological, Radiological, and Airborne Particulate Observations

    International Nuclear Information System (INIS)

    Nikolich, George; Shadel, Craig; Chapman, Jenny; McCurdy, Greg; Etyemezian, Vicken; Miller, Julianne J.; Mizell, Steve

    2016-01-01

    In 1963, the U.S. Department of Energy (DOE) (formerly the Atomic Energy Commission [AEC]), implemented Operation Roller Coaster on the Tonopah Test Range (TTR) and an adjacent area of the Nevada Test and Training Range (NTTR) (formerly the Nellis Air Force Range). The operation resulted in radionuclide-contaminated soils at the Clean Slate I, II, and III sites. This report documents observations made during ongoing monitoring of radiological, meteorological, and dust conditions at stations installed adjacent to Clean Slate I and Clean Slate III, and at the TTR Sandia National Laboratories (SNL) Range Operations Control (ROC) center. The primary objective of the monitoring effort is to determine if winds blowing across the Clean Slate sites are transporting particles of radionuclide-contaminated soil beyond the physical and administrative boundaries of the sites. Radionuclide assessment of airborne particulates in 2015 found the gross alpha and gross beta values of dust collected from the filters at the monitoring stations are consistent with background conditions. The meteorological and particle monitoring indicate that conditions for wind-borne contaminant movement exist at the Clean Slate sites and that, although the transport of radionuclide-contaminated soil by suspension has not been detected, movement by saltation is occurring.

  5. Tonopah Test Range Air Monitoring: CY2015 Meteorological, Radiological, and Airborne Particulate Observations

    Energy Technology Data Exchange (ETDEWEB)

    Nikolich, George [Nevada University, Reno, NV (United States). Desert Research Inst.; Shadel, Craig [Nevada University, Reno, NV (United States). Desert Research Inst.; Chapman, Jenny [Nevada University, Reno, NV (United States). Desert Research Inst.; McCurdy, Greg [Nevada University, Reno, NV (United States). Desert Research Inst.; Etyemezian, Vicken [Nevada University, Reno, NV (United States). Desert Research Inst.; Miller, Julianne J. [Nevada University, Reno, NV (United States). Desert Research Inst.; Mizell, Steve [Nevada University, Reno, NV (United States). Desert Research Inst.

    2016-09-01

    In 1963, the U.S. Department of Energy (DOE) (formerly the Atomic Energy Commission [AEC]), implemented Operation Roller Coaster on the Tonopah Test Range (TTR) and an adjacent area of the Nevada Test and Training Range (NTTR) (formerly the Nellis Air Force Range). The operation resulted in radionuclide-contaminated soils at the Clean Slate I, II, and III sites. This report documents observations made during ongoing monitoring of radiological, meteorological, and dust conditions at stations installed adjacent to Clean Slate I and Clean Slate III, and at the TTR Sandia National Laboratories (SNL) Range Operations Control (ROC) center. The primary objective of the monitoring effort is to determine if winds blowing across the Clean Slate sites are transporting particles of radionuclide-contaminated soil beyond the physical and administrative boundaries of the sites. Radionuclide assessment of airborne particulates in 2015 found the gross alpha and gross beta values of dust collected from the filters at the monitoring stations are consistent with background conditions. The meteorological and particle monitoring indicate that conditions for wind-borne contaminant movement exist at the Clean Slate sites and that, although the transport of radionuclide-contaminated soil by suspension has not been detected, movement by saltation is occurring.

  6. Role of complex utilization of mineral raw materials In geological research

    Energy Technology Data Exchange (ETDEWEB)

    Takacs, P.; Varju, G.

    1979-01-01

    Presents Hungarian research efforts on ways of utilizing the secondary raw materials alunite, pumice and slate coal from various mines. The slate coal is separated from brown coal and disposed of at spoil banks of brown coal mines, due to its high ash content (up to 56.8% under dry conditions), silicate content up to 58.2% and low calorific value between 1500 and 2780 kcal/kg. The research proposal for utilizing slate coal is directed at partial separation of the mineral and coal content by comminution, peptization and hydrocentrifugal separation. The larger part of the silicate content is held in the colloid suspension, which could be used for conditioning drilling mud or foundry sand. The produced coal concentrate has a reduced ash content and higher calorific value (between 500 and 800 kcal/kg) and could be employed in soil amelioration or combustion. (10 refs.) (In German)

  7. A remote-operating laser

    International Nuclear Information System (INIS)

    Anon.

    2000-01-01

    A laser has been developed into an efficient tool for remote cutting of metal parts, that will be used for dismantling nuclear installations. The YAG-type laser was chosen because it allows the transfer of power through optical fibers instead of mirrors. The feasibility of the cutting of pipes (diameter: 40 mm,thickness: 3 mm) and 40 mm thick steel slates has been proven at a distance of 1 meter by using a continuous 4 kW-laser. 2 lasers have been coupled to allow the contact cutting of 60 mm thick slates (speed: 40 mm/mn) by using an equivalent power of 6 kW. A 100 mm thick slate has been cut by an equivalent power of 7 kW with a speed of 3 mm/mn. (A.C.)

  8. Geological investigation of uranium deposits at southwest of Chungju area

    International Nuclear Information System (INIS)

    Kim, J.H.; Park, J.W.; Kim, J.T.; Kim, D.E.; Im, H.C.

    1982-01-01

    A geologic investigation has been carried out at the southwest of Chungju area for the exploration of uranium ore deposit. A trace element geochemistry was supplemented to study the genesis of uranium ore deposit. The uraniferous black slate is interbedded with meta-argillaceous rock formation correlative to the Munjuri formation of Ogcheon group. The uranium rich carbonaceous slate is distributed discontinuously in three places. The discontinuity of the slate is probably due to the deformation of Daebo Orogeny. The grade of the ore bodies is 396-495 ppm U 3 O 8 , Vanadium 1.47-0.48%V 2 O 5 and fixed carbon 18.16-8.54%. The width of outcrop is 10.3m-2.5m. The semiquantitative spectrographic analysis of 4 samples in the above ore zone revealed that the average of minor elements contents are Ba 3025, Be 1.5, Cd 131, Cu53, Co 12, Cr 155, Ga<10, Mo 83, Pb 66, Ni 183, Sr 22, and Zr 196 in ppm. Analysed the 33 major and trace elements in 20 samples including above are samples from drill-cores and trenched rocks from Ogcheon black slate indicates that the uranium has positive correlation with Fe(0.47), Mo (0.45) and Ba(0.38). In the uranium deposits of Ogcheon black slate, we can accept the theory of syngenitic origin where uranium occurs with unusually high content of minor elements in black slate. The elements were introduced at the same time with the mud deposition without significant later addition. Mechanism of emplacement might be fixation of living organisms and absorption of decaying organic matter from sea water. An intensive study is necessary for futher understanding of redistribution and recrystallization of uranium by metamorphism. (Author)

  9. New roof for an old building. PV system on a historical single-family home; Altes Haus kraftvoll eingedeckt. PV-Anlage auf historischem Einfamilienhaus

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2009-03-15

    For hundreds of years, slated roofs and walls were the characteristic feature of the Thuringian-Franconian boundary region, where the ''Schieferstrasse'' - the road of historical houses with slated roofs and walls - is a major tourist attraction. Today, owners of buildings are interested in technologies orientated towards the future. After restoration of a single-family home at Lehestenbuilt in 1650, modern solar modules installed on the roof and combined with traditionally-looking aluminium roof tiles by Prefa make an aesthetically pleasing picture. (orig.)

  10. A Cultural Resources Survey of Arlington Revetment and LSU Berm Levee Improvement Item, East Baton Rouge Parish Louisiana

    Science.gov (United States)

    1993-07-01

    Light gm Slas 14 14 Lis Smm pmlew aumk Simm Milk glass 1 Modern brown glass I Olive glass _ Tin cm key 11 Shotg cartridge 1 Slate 1 Mortar 1 1 Piece of...Parish, Louisiana. Anthropological Report No. 1. Archaeological Survey and Antiquities Commission, Department of Culture, Recreation and Tourism , Baton

  11. Software Reviews: Programs Worth a Second Look.

    Science.gov (United States)

    Olds, Henry F., Jr.; And Others

    1988-01-01

    Examines four software packages: (1) "Wordbench"--writing and word processing, grades 9-12 (IBM and Apple); (2) "Muppet Slate"--language arts, grades K-2 (Apple); (3) "Accu-Weather Forecaster"--weather analysis and forecasting, grades 3-12 (modem with IBM or Mac); and (4) "The Ripple That Changed American…

  12. «L'intera massa qualificata»:flaiano e l'Università Dilatata ...

    African Journals Online (AJOL)

    Flaiano produces biting criticism of social phenomena that characterised Italy as it strove to establish its identity in the post-war period of reconstruction rendered all the more complicated and ambitious by the advent of mass cinema and television. This contrarian arch-critic of the Italian “Dolce Vita” sarcastically slates both ...

  13. MANUAL: BEST MANAGEMENT PRACTICES FOR POLLUTION PREVENTION IN THE SLABSTOCK AND MOLDED FLEXIBLE POLYURETHANE FOAM INDUSTRY

    Science.gov (United States)

    The 1990 Clean Air Act Amendments require EPA to develop standards for major emission sources of 189 hazardous air pollutants (HAPs). EPA has identified the flexible polyurethane foam industry as a large emitter of HAPs and has slated the industry for regulation under Title III, ...

  14. The Holifield Radioactive Ion Beam Facility at Oak Ridge National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Garrett, J.D. [Oak Ridge National Lab., TN (United States)

    1996-12-31

    The status of the new Holifield Radioactive Ion Beam Facility at Oak Ridge National Laboratory (ORNL), which is slated to start its scientific program late this year is discussed, as is the new experimental equipment which is being constructed at this facility. Information on the early scientific program also is given.

  15. Periodicals Price Survey 2008: Embracing Openness

    Science.gov (United States)

    Van Orsdel, Lee C.; Born, Kathleen

    2008-01-01

    Evidence for open access as an emergent, global state of mind is everywhere. The "New York Times" went "open" last September, and the "Wall Street Journal" is slated to follow. Increasingly, scholarly communities are breaking with tradition and calling for the open sharing of research, software, and data. Amongst these global initiatives is the…

  16. High Hopes and Harsh Realities: The Real Challenges to Building a Diverse Workforce. Technical Appendix

    Science.gov (United States)

    Putman, Hannah; Hansen, Michael; Walsh, Kate; Quintero, Diana

    2016-01-01

    Public schools are suffering from a well-publicized diversity problem. Minority students make up nearly half of all public school students, yet minority teachers comprise just 18 percent of the teacher workforce. In an effort to address what Slate has described as "the one cause in education everyone supports," school districts across…

  17. High Hopes and Harsh Realities: The Real Challenges to Building a Diverse Workforce

    Science.gov (United States)

    Putman, Hannah; Hansen, Michael; Walsh, Kate; Quintero, Diana

    2016-01-01

    Public schools are suffering from a well-publicized diversity problem. Minority students make up nearly half of all public school students, yet minority teachers comprise just 18 percent of the teacher workforce. In an effort to address what Slate has described as "the one cause in education everyone supports," school districts across…

  18. Bounds on the Effect of Progressive Structural Degradation

    DEFF Research Database (Denmark)

    Achtziger, W.; Bendsøe, Martin P; Taylor, John E.

    1998-01-01

    Problem formulations are presented for the evaluation of upper and lower bounds on the effect of progressive structural degradation. For the purposes of this study, degradation effect is measured by an increase in global structural compliance (flexibility). Thus the slated bounds are given simply...

  19. The Holifield Radioactive Ion Beam Facility at Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    Garrett, J.D.

    1996-01-01

    The status of the new Holifield Radioactive Ion Beam Facility at Oak Ridge National Laboratory (ORNL), which is slated to start its scientific program late this year is discussed, as is the new experimental equipment which is being constructed at this facility. Information on the early scientific program also is given

  20. Contribution of a winter wheat cover crop to the maintenance of Pratylenchus penetrans populations in the raspberry production system with management considerations

    Science.gov (United States)

    One of the primary production challenges red raspberry growers in the Pacific Northwest confront is root lesion nematode (RLN; Pratylenchus penetrans). In this perennial production system, raspberry serves as a sustained host for RLN. When a raspberry planting is slated for removal in the fall, a ne...

  1. Temporal and spatial variability in North Carolina piedmont stream temperature

    Science.gov (United States)

    J.L. Boggs; G. Sun; S.G. McNulty; W. Swartley; Treasure E.; W. Summer

    2009-01-01

    Understanding temporal and spatial patterns of in-stream temperature can provide useful information to managing future impacts of climate change on these systems. This study will compare temporal patterns and spatial variability of headwater in-stream temperature in six catchments in the piedmont of North Carolina in two different geological regions, Carolina slate...

  2. Children's agenda-based regulation: The effects of prior performance and reward on elementary school children's study choices.

    Science.gov (United States)

    Lipowski, Stacy; Ariel, Robert; Tauber, Sarah K; Dunlosky, John

    2017-12-01

    The main goal of the current experiments was to examine the influence of monitoring and reward on elementary school children's study decisions. First and third graders studied names for 10 animals (e.g., "The elephant's name is Suzy") and then were given a cued recall test on which they were shown the animal and needed to recall the name. Next, they were given an opportunity to restudy the animal-name pairs, and some of these pairs were slated to earn a reward (a sticker) if correctly recalled. In Experiment 1, both groups of children were (a) more likely to restudy previously unrecalled pairs than previously recalled pairs and (b) more likely to restudy pairs that were slated to receive a reward. In Experiment 2, we further explored children's use of reward using a forced-choice selection task. Namely, during selection, pairs were presented in dyads where one pair was slated for a reward and the other pair was not, and the children could choose only one pair from each dyad for restudy. Both first and third graders chose to restudy pairs slated for a reward. Thus, even young elementary school children consider both rewards and performance monitoring when regulating their learning. Copyright © 2017 Elsevier Inc. All rights reserved.

  3. Seeking the Balance Between Government and Industry Interests in Software Acquisitions. Volume 1. A Basis for Reconciling DoD and Industry Needs for Rights in Software

    Science.gov (United States)

    1987-06-01

    Facilitator Robert Voss, Esq. Private Consultant, Honeywell, Inc. Institute for Defense Analyses Robert Adams , Esq. Naval Training Systems Center Mr...Systems Command Leonard Rawlcz, Esq. Skadden, Arps, Slate, Meagher & Flom Ansel Schwartz, Esq. Reed Smith Shaw & McClay Michael Yatsko, Esq

  4. Influence of polar solvents on the enhancement of light-ends in ...

    African Journals Online (AJOL)

    Crude oil 'micelle' can be dispersed into fuels, oil and resin/asphalthene components using some hydrocarbon solvents. This can be adapted towards influencing/enhancing its product slates during the processing of crude oils. This research was carried out to investigate the effect of polar solvents (ethanol and acetone) in ...

  5. 76 FR 56731 - Oral Rabies Vaccine Trial; Availability of an Environmental Assessment and Finding of No...

    Science.gov (United States)

    2011-09-14

    ...] Oral Rabies Vaccine Trial; Availability of an Environmental Assessment and Finding of No Significant... the Animal and Plant Health Inspection Service relative to an oral rabies vaccination field trial in... INFORMATION CONTACT: Dr. Dennis Slate, Rabies Program Coordinator, Wildlife Services, APHIS, 59 Chennell Drive...

  6. The Sirius Passet Lagerstätte: silica death masking opens the window on the earliest mat ground community of the Cambrian Explosion

    NARCIS (Netherlands)

    Strang, Katie M; Armstrong, Howard; Harper, David A. T.; Trabucho-Alexandre, João

    2016-01-01

    The Sirius Passet Lagerstätte (SP), Peary Land, North Greenland, occurs in black slates deposited at or just below storm wave base. It represents the earliest Cambrian microbial mat community with exceptional preservation, predating the Burgess Shale by 10 million years. Trilobites from the SP are

  7. Discussion 2: David Dobbs

    OpenAIRE

    Dobbs, David; Murray-Rust, Peter; Hatcher, Jordan; Pollock, Rufus

    2010-01-01

    David Dobbs writes on science, medicine and culture. He has contributed to a diversity of publications, including Scientific American, Slate magazine, Wired, Audubon, Atlantic Monthly, and the New York Times magazine. He has also authored a number of books. Other participants in this discussion were Peter Murray-Rust, Jordan Hatcher, and Rufus Pollock.

  8. Programs in Fortran language for reporting the results of the analyses by ICP emission spectroscopy; Programas en lenguaje Fortran para la informacion de los resultados de los analisis efectuados mediante Espectroscopia Optica de emision con fuente de plasma

    Energy Technology Data Exchange (ETDEWEB)

    Roca, M

    1985-07-01

    Three programs, written in FORTRAN IV language, for reporting the results of the analyses by ICP emission spectroscopy from data stored in files on floppy disks have been developed. They are intended, respectively, for the analyses of: 1) waters, 2) granites and slates, and 3) different kinds of geological materials. (Author) 8 refs.

  9. Folds in multilayered rocks of Proterozoic age, Rajasthan, India

    Indian Academy of Sciences (India)

    R. Narasimhan (Krishtel eMaging) 1461 1996 Oct 15 13:05:22

    Johnson and Johnson 2002 etc) shows that the fold shape modification may be brought about by buckling and flattening operating simultaneously throughout the development of fold. In the present paper a series of F1 folds devel- oped in slates with interlayered alternations with quartzite of Proterozoic age and unaffected ...

  10. One Family's Struggles with Pertussis (Whooping Cough)

    Medline Plus

    Full Text Available ... for use by your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded ... download to your computer. Audio PSAs :30-second branded MP3 :30-second unbranded MP3 :60-second branded ...

  11. One Family's Struggles with Rotavirus

    Medline Plus

    Full Text Available ... for use by your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded ... download to your computer. Audio PSAs :30-second branded MP3 :30-second unbranded MP3 :60-second branded ...

  12. One Family's Struggles with HPV (Human Papillomavirus)

    Medline Plus

    Full Text Available ... for use by your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded ... download to your computer. Audio PSAs :30-second branded MP3 :30-second unbranded MP3 :60-second branded ...

  13. One Family's Struggle with Chickenpox

    Medline Plus

    Full Text Available ... for use by your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded ... download to your computer. Audio PSAs :30-second branded MP3 :30-second unbranded MP3 :60-second branded ...

  14. One Family's Struggles with Hepatitis B

    Medline Plus

    Full Text Available ... for use by your organization free-of-charge. Branded videos contain the "PKIDs.ORG" end slate; unbranded ... download to your computer. Audio PSAs :30-second branded MP3 :30-second unbranded MP3 :60-second branded ...

  15. Publications | Page 267 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Through books, articles, research publications, and studies, we aim to widen the ... procedures for export of vegetables, as well as import of tires from Sri Lanka. ... the Las Bambas copper deposit in Peru (slated to be chosen on 23 July) had ...

  16. Look What the Cat Brought In.

    Science.gov (United States)

    Erslev, Carole

    1984-01-01

    The small, uneaten, slate-gray, pointed-nose animal that is distasteful to the cat because of foul-tasting scent glands is the shrew. Describes the short-tailed shrew's physical characteristics, lifespan, habitat, eating habits, and senses. (ERB)

  17. Programs in Fortran language for reporting the results of the analyses by ICP emission spectroscopy

    International Nuclear Information System (INIS)

    Roca, M.

    1985-01-01

    Three programs, written in FORTRAN IV language, for reporting the results of the analyses by ICP emission spectroscopy from data stored in files on floppy disks have been developed. They are intended, respectively, for the analyses of: 1) waters, 2) granites and slates, and 3) different kinds of geological materials. (Author) 8 refs

  18. A comparative study of Plecotus auritus and P. austriacus (Chiroptera, Vespertilionidae) inhabiting one roost

    NARCIS (Netherlands)

    Stebbings, R.E.

    1970-01-01

    This study began in November, 1960 and involved studies of all bats living within one large and complex roof. Furzebrook House, built in 1885, was of brick with hollow walls and a black slate roof. The roof consisted of 9 distinct sections comprising some 385 m³ of which 60 % was accessible for

  19. Whose College Readiness Is It Anyway? College Readiness, Cultural, Economic and Social Capital, and Access to Pre-College Transition Programs

    Science.gov (United States)

    Gray-Nicolas, Nakia Marissa

    2017-01-01

    In the United States, the majority of high school graduates are not academically prepared for the rigor of postsecondary education or equipped with the skills necessary to enter the workforce (American College Test [ACT], 2012; Barnes & Slate, 2010; Conley, 2007a, 2007b). Often blamed for this lack preparation are inconsistent linkages between…

  20. Postmodern Chapel Services for Generation X and Millennial Generation Soldiers

    Science.gov (United States)

    2008-06-13

    lives, joys, and sorrows of six Generation X friends living in Manhattan, had gone into syndication five years earlier in 2000. This provided a...Michale Kinsley, a New Republic columnist and later editor in chief for Slate.com, complained about Xers, “these kids today. They’re soft. They don’t

  1. Terrain and vegetation structural influences on local avian species richness in two mixed-conifer forests

    Science.gov (United States)

    Jody C. Vogeler; Andrew T. Hudak; Lee A. Vierling; Jeffrey Evans; Patricia Green; Kerri T. Vierling

    2014-01-01

    Using remotely-sensed metrics to identify regions containing high animal diversity and/or specific animal species or guilds can help prioritize forest management and conservation objectives across actively managed landscapes. We predicted avian species richness in two mixed conifer forests, Moscow Mountain and Slate Creek, containing different management contexts and...

  2. 49 CFR 1039.11 - Miscellaneous commodities exemptions.

    Science.gov (United States)

    2010-10-01

    ..., etc. 26 214 Wrapping paper, wrappers or coarse paper. 26 218 Sanitary tissue stock. 26 471 Sanitary... 30 111 Rubber pneumatic tires or parts. 31 ......do Leather or leather products. 32 ......do Clay... 32 952 15 Cinders, clay, shale expanded shale), slate or volcanic (not pumice stone), or haydrite. 33...

  3. The Joint Chiefs of Staff and the War in Vietnam, 1960-1968. Part 1

    Science.gov (United States)

    2011-01-01

    34 Furthermore, the general was "to evaluate what could be accomplished by the introduction of SE ATO or I hiited States forces into South Vietnam...Laotian Crisis, 1 Feb-31 Mar 61, pp. 42-43. See also Edward J. Marolda and Oscar P. Fitzgerald, The I hiited Slates Nary and the Yiclna in (’oiijlicl

  4. The American Odyssey of Maria Montessori.

    Science.gov (United States)

    Kornegay, William

    Dr. Maria Montessori's 1913 visit and lecture tour to the United SLates is described in detail with numerous citations from newspaper coverage of the event. The enthusiastic reception extended to the European physician and educator is reviewed, and her meetings, notably with Mr. and Mrs. Alexander Graham Bell, President and Mrs. Woodrow Wilson,…

  5. Using urban forest assessment tools to model bird habitat potential

    Science.gov (United States)

    Susannah B. Lerman; Keith H. Nislow; David J. Nowak; Stephen DeStefano; David I. King; D. Todd. Jones-Farrand

    2014-01-01

    The alteration of forest cover and the replacement of native vegetation with buildings, roads, exotic vegetation, and other urban features pose one of the greatest threats to global biodiversity. As more land becomes slated for urban development, identifying effective urban forest wildlife management tools becomes paramount to ensure the urban forest provides habitat...

  6. The 20 and 30 GHz MMIC technology for future space communication antenna system

    Science.gov (United States)

    Anzic, G.; Connolly, D. J.

    1984-10-01

    The development of fully monolithic gallium arsenide receive and transmit modules is described. These modules are slated for phased array antenna applications in future 30/20 gigahertz communications satellite systems. Performance goals and various approaches to achieve them are discussed. The latest design and performance results of components, submodules and modules are presented.

  7. Christopher Benfey's Flight of Fancy

    Science.gov (United States)

    Klein, Julia M.

    2008-01-01

    This article profiles Christopher Benfey, 53--an art critic for Slate, a poet, and a prolific literary essayist for such venues as "The New York Times Book Review, The New Republic," and "The New York Review of Books." His latest book, "A Summer of Hummingbirds: Love, Art, and Scandal in the Intersecting Worlds of Emily…

  8. 'Polished' cinema : Over de receptie van het werk van Andrzej Kondratiuk in Polen en het groteske

    NARCIS (Netherlands)

    Gusc, I.

    2012-01-01

    Despite being brutally slated at times, Andrzej Kondratiuk’s films were also often admired and praised by Polish film critics. Their inability to uniformly categorise and value Kondratiuk’s highly unconventional work has led to him being set aside, and labelled as, a ‘separate’ filmmaker in Polish

  9. Zen and the Art of Constructive Criticism

    Directory of Open Access Journals (Sweden)

    Erin Dorney

    2012-05-01

    Full Text Available Introduction If there were a single piece of advice I have for new professionals entering the field of librarianship, it would be to develop the skill of giving and receiving criticism. This isn’t something I’ve been able to find in an LIS course catalog, slate of webinar programming, or conference booklet (although it looks like [...

  10. Metamorphic history of the Central Pyrenees Part II, Valle de Arán, Sheet 4

    NARCIS (Netherlands)

    Zwart, H.J.

    1963-01-01

    The structural geology and metamorphic petrology of the Bosost area in the Valle de Arán (Central Pyrenees) is discussed. The rocks exposed in this area consist of Cambro-Ordovician mica-schists with numerous granite and pegmatite bodies, phyllites and limestones; Silurian slates and schists and

  11. Anechoic chamber in industrial plants. [construction materials and structural design

    Science.gov (United States)

    Halpert, E.; Juncu, O.; Lorian, R.; Marfievici, D.; Mararu, I.

    1974-01-01

    A light anechoic chamber for routine acoustical measurements in the machine building industry is reported. The outer housing of the chamber consists of modules cast in glass fiber reinforced polyester resin; the inner housing consists of pyramidal modules cut out of sound absorbing slates. The parameters of this anechoic chamber facilitate acoustical measurements according to ISO and CAEM recommendations.

  12. Bioremediation of Cd-DDT co-contaminated soil using the Cd-hyperaccumulator Sedum alfredii and DDT-degrading microbes

    Science.gov (United States)

    The development of an integrated strategy for the remediation of soil co-contaminated by heavy metals and persistent organic pollutants is a major research priority for the decontamination of soil slated for use in agricultural production. The objective of this study was to develop a bioremediation ...

  13. The S-LINK in the data sources for trigger demonstrators in the LHC environment

    International Nuclear Information System (INIS)

    Hajduk, Z.; Iwanski, W.; Korcyl, K.; Olszowska, J.; Bij, H.C. van der

    1998-01-01

    The hardware for the data sources to be used in the ATLAS trigger demonstrator program has been designed and built. As a basic element, the SLATE2 module has been used. The S-LINK protocol, as a transferring data standard, has been chosen. A cheap implementation of the S-LINK, the Parallel Electrical S-LINK, has been built. Featuring all the specification laid down in the standard it uses a parallel twisted pair copper cable as a physical layer. A standard SCSI cable has been used. Both the Source and Destination Cards have the same PCB layout. The link may receive 32-bit wide data words at max 40 MHz input rate. Running with 40 MHz link clock, it outputs 32-bit data at a rate of 20 MHz, giving a total a bandwidth of 80 MB/s. The authors report on main characteristics of these implementations. The SLATE2SLINK cad has been built to interface the SLATE motherboard to the S-LINK environment. This daughter card is capable to house and independently control 3 S-LINK sites. Running with the 25 MHz SLATE's clock and 32-bit data, it features a total bandwidth up to 300 MB/s

  14. Decoding designers' inspiration process

    NARCIS (Netherlands)

    Gonçalves, M.

    2016-01-01

    Every great invention, innovative design or visionary art piece ever created started in the same way: with a blank canvas. However, you never begin a new project with a completely clean slate: besides memories, past experiences and general knowledge, all of us are constantly surrounded by

  15. 29 CFR 570.53 - Coal-mine occupations (Order 3).

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Coal-mine occupations (Order 3). 570.53 Section 570.53... § 570.53 Coal-mine occupations (Order 3). (a) Finding and declaration of fact. All occupations in or about any coal mine, except the occupation of slate or other refuse picking at a picking table or...

  16. Strategic Management Accounting Corporate Objective and ...

    African Journals Online (AJOL)

    No organisation operates without a focus and this focus can be termed objective or goal; which should be clearly slated. This study therefore looked at Strategic Management Accounting Corporate Strategy and Production objectives. The study samples are selected manufacturing firms in Port Harcourt. Questionnaires were ...

  17. Geological mapping and analysis in determining resource recitivity limestone rocks in the village of Mersip and surrounding areas, district Limun, Sorolangun Regency, Jambi Province

    Science.gov (United States)

    Dona, Obie Mario; Ibrahim, Eddy; Susilo, Budhi Kuswan

    2017-11-01

    The research objective is to describe potential, to analyze the quality and quantity of limestone, and to know the limit distribution of rocks based on the value of resistivity, the pattern of distribution of rocks by drilling, the influence mineral growing on rock against resistivity values, the model deposition of limestone based on the value resistivity of rock and drilling, and the comparison between the interpretation resistivity values based on petrographic studies by drilling. Geologic Formations study area consists of assays consisting of altered sandstone, phyllite, slate, siltstone, grewake, and inset limestone. Local quartz sandstone, schist, genealogy, which is Member of Mersip Stylists Formation, consists of limestone that formed in shallow seas. Stylists Formation consists of slate, shale, siltstone and sandstone. This research methodology is quantitative using experimental observation by survey. This type of research methodology by its nature is descriptive analysis.

  18. Natural Stone in Spain: trends and perspectives

    International Nuclear Information System (INIS)

    Marchán Sanz, C.; Regueiro y González-Barros, M.; Delgado Arenas, P.

    2017-01-01

    The natural stone sector was severely affected by the national construction sector crisis. Production, both exworks and processed, has been also harshly affected dropping from 8Mt/y in 2007 to 3,49Mt/y in 2015, particularly in the marble and granite sectors, since slate has always been a mainly exporting sub-sector. In the latest times, thanks mainly to exports, production apparently has slowly started to recover. In this paper, we review the typology of the Spanish natural stone products and the production data of the main stone subsectors (marble, granite and slate) in the last 10 years and we review possible future trends in the framework of the first steps of the economic recovery. [es

  19. Las pizarras de la faja piritica Ibérica (zona sur-Portuguesa: geología, mineralogía y aplicaciones industriales

    Directory of Open Access Journals (Sweden)

    Galán, E.

    1991-12-01

    Full Text Available The geochemical, mineralogical and petrographical features of slates from the Iberian Pyrite Belt (SW Spain are studied. On the basis of these data, the origin and metamorphic conditions undergone by these materials are discussed. Finally, the infiuence of mineralogical, textural and microstructural factors on their use as industrial rocks (roofing slates is estimated.Se describen las características geoquímicas, mineralógicas y petrográficas de los materiales pizarrosos de un sector de la Faja Pirítica y, en base a estos datos, se discuten sus condiciones de formación y evolución durante el metamorfismo. Finalmente, se analiza la incidencia de la mineralogía y de los factores texturales y microestructurales en la calidad de las pizarras como rocas industriales.

  20. Iran’s Influence in Afghanistan: Implications for the U.S. Drawdown

    Science.gov (United States)

    2014-01-01

    Rouhani’s Response to Messages of Congratulations from Prime Minister of India, Head of Indonesian Parliament, and President of Montenegro ”], Khabar...Parliament, and President of Montenegro ,” 2013. 70 Meena Singh Roy, “India and Iran Relations: Sustaining the Momentum,” ISDA issue brief...slated to supply India with liquefied natural gas (LNG) for 25 years, is in limbo because the deal stipulates that India build an LNG plant in Iran

  1. Properties of vitrified rocky flats TRUW with different waste loadings

    International Nuclear Information System (INIS)

    Eddy, T.L.; Sears, J.W.; Grandy, J.D.; Miley, D.V.; Erickson, A.W.; Farnsworth, R.N.; Larsen, E.D.

    1994-01-01

    Leach rates, phase structures, and mechanical properties of simulated Rocky Flats Plant 1st and 2nd slate sludge vitrified in an arc melter are described as a function of waste to soil fraction and method of devitrification to produce the glass-ceramic waste form. Volatile, hazardous, and transuranic (TRU) surrogate metals were added to assess dissolution effects. Zirconia and titania were also added to confirm their ability as transuranic-surrogate getters

  2. CHIPS. Volume 29, Issue 2, April - June 2011

    Science.gov (United States)

    2011-06-01

    Integrated Targeting and Fire Control • Electromagnetic Warfare • Spectrum Usage CHIPS April – June 2011 9 plans. Think of them as vectors for their...Wireless Broadband Revolution.” Now, more than ever before, the use of electromagnetic spectrum, aka radio frequencies, is recognized as having...Receives Limited Production 2 Approval Terminals slated for Navy’s F/A-18E/F Super Hornet, Air Force’s EC-130H Compass Call and RC-135 Rivet Joint

  3. Innovative automation solutions applied to nuclear fuel production and inspection processes

    International Nuclear Information System (INIS)

    Vas, Ananth

    2012-01-01

    The nuclear industry in India is slated for fast paced growth in the coming years, with a great focus on increasing the capacity for producing, inspecting and finally reprocessing of nuclear fuel. Modern techniques of industrial automation such as robotics, machine vision and laser based systems have been deployed extensively to improve the productivity and output of existing and future installations, particularly for the fuel handling stages mentioned

  4. F/H area high level waste tank status report

    International Nuclear Information System (INIS)

    Hayes, C.R. Jr.; Wells, M.N.

    1997-03-01

    Section IX.E.3 of the SRS Federal Facility Agreement requires the DOE to submit to EPA and SCDHEC, an annual report on the status of tanks being removed from service. Tanks that are slated for removal from service either do not meet secondary containment standards or have leak sites. The attached document is intended to meet this annual report requirement. An updated status of relevant portions of the Waste Removal Plan and Schedule is also included

  5. Demonstration of a Fractured Rock Geophysical Toolbox (FRGT) for Characterization and Monitoring of DNAPL Biodegradation in Fractured Rock Aquifers

    Science.gov (United States)

    2015-09-29

    is characterized by dark gray slate or phyllite, alternating with thin layers of light gray siltstone or sandstone . Table 1 summarizes the primary...sedimentary rocks of the Newark Basin. Competent rocks are primarily mudstones and sandstones of the Lockatong and Stockton Formations. Fill, weathered silt... sandstone , and characterized by water bearing bedding plane fractures. An array of open boreholes in the source area that were drilled for the 2002

  6. Nuclear Safeguards and the International Atomic Energy Agency

    Science.gov (United States)

    1995-04-01

    Hexapar- reactors were originally designed to use HEU, the tite safeguards agreement already in place for cen- RERTR (Reduced Enrichment for Research...See discussion below on the RERTR program.) partite agreement. Such short notice is possible in Some reactors, however, have yet to be converted, Europe...the fuel and compares them to those of 1994.21 alternate policies. The RERTR program has made significant Of the some 22,700 fuel elements slated for

  7. Federal role in resource recovery will focus on waste-to-energy R and D

    Energy Technology Data Exchange (ETDEWEB)

    Dawson, R.A.

    1981-05-01

    Virtually all of the federal programs created in recent years to sponsor resource recovery R and D have been slated for budget cuts or termination by the administration of President Ronald Reagan. The only programs that will survive revised fiscal budgets will be waste-to-energy R and D studies sponsored by DOE and EPA. Differing reactions to such cuts are apparent: the affected agencies are protesting, while private industry welcomes this hands-off policy.

  8. OPMS (Officer Personnel Management System), MILPERCEN and the Corps: A Commentary.

    Science.gov (United States)

    1983-06-01

    report moderate to severe dissatisfaction over the slating subset which seams to be the man current concern. Bad timing, too abort notification...Mlehado - Berka re-3Wad 19T 2, US Department or the ArnW, DA Parpb1. 360-81i6. "OpuS status Fleport," Wkahington, 15 NMW 19T9, P. 1. 3. Xdhard C. M~er

  9. Supervisory Control Information Management Research (SCIMR)

    Science.gov (United States)

    2013-06-01

    signal was a truck icon that was slightly larger than the non-critical signal (110 pixels vs . 100 pixels). All signals occurred in one of 6 fixed...joint terminal area controller (JTAC) who was equipped with a small hand-held computer (similar to an Apple iPad) that can only consume one video at a...desktop monitor and mouse, this study will be conducted on the mobile, touch-operated Samsung Slate. Discussion The hypothesis for this experiment

  10. Savannah River Laboratory quarterly report, October--December 1975. Hydrogeochemical and stream sediment reconnaissance: eastern United States. National Uranium Resource Evaluation program

    International Nuclear Information System (INIS)

    1975-01-01

    Orientation studies were completed in six states. Areas sampled included the Texas Coastal Plain; Georgia Piedmont; North and South Carolina Blue Ridge; North Carolina Inner Piedmont, Slate Belt, Triassic Basin, and Coastal Plain; and Pennsylvania and Tennessee Plateaus. The sample preparation and neutron activation analyses are on a routine basis. No data is, however, reported. Programming and input for data management, analysis, and interpretation are reported

  11. Science You Can Use Bulletin: Slash from the past: Rehabilitating pile burn scars

    Science.gov (United States)

    Sue Miller; Chuck Rhoades; Liz Schnackenberg; Paula Fornwalt; Eric Schroder

    2015-01-01

    In the National Forests of northern Colorado, there is a backlog of over 140,000 slash piles slated to be burned, most of them coming from post-mountain pine beetle salvage logging and hazard reduction treatments. Burning slash piles can create openings in the forest that remain treeless for over 50 years, and can also have the short-term impacts of increasing nutrient...

  12. What could make 2017 the banner year for smart grids?

    International Nuclear Information System (INIS)

    Ortega, Florian

    2015-01-01

    With billings slated to reach 6 euros billion per year by 2020, intelligent networks, known as smart grids are an attractive proposition for many companies and will generate up to 25 000 jobs directly in France. While it seems, in light of all the commitments that have been made, that 2017 can considered as 'the year of the smart grids', there remain a number of uncertainties. (author)

  13. What's ahead in 1992

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    Upstream industry's current status, as well as what might be expected in 1992, continues to be ruled by a slate of financial, legislative, and political factors that are inextricably tied together. Short of some significant changes in attitude and actions by government and financial institutions, the shorten status of natural gas looks bleak. This paper reviews the outlook for the petroleum and natural gas industry in 1992

  14. ADVANCING TECHNOLOGY AND METHODOLOGY TO STREAMLINE ENVIRONMENTAL COMPLIANCE

    Energy Technology Data Exchange (ETDEWEB)

    Ben Grunewald; Paul Jehn

    2002-11-15

    By early 2000, fifteen oil and gas State Agencies were using RBDMS or a RBDMS utility to handle a significant amount or all of their data management needs. There are three additional State slated to begin implementation this year. There are an additional twelve State agencies that are not utilizing this technology that have proven to be very useful for so many other States. This project will allow for the base RBDMS install in all State oil and gas agency that desire it.

  15. Forecasting the demand for petroleum industrial equipment

    Energy Technology Data Exchange (ETDEWEB)

    Buvailo, I A; Koval' chuk, V M; Yakovlev, Yu D

    1977-01-01

    An examination is made of a broad method of future industrial planning which yields optimal results and is based on the fact that the need for new technology stems from the number of operations which must be completed within the period being analyzed and from the productivity of the machinery slated for use. Formulas are presented for determining the need for several types of new petroleum industrial machinery, and an analysis is made of the components of a mathematical model. 3 references.

  16. Chinese Engagement in Africa: Drivers, Reactions, and Implications for U.S. Policy

    Science.gov (United States)

    2014-01-01

    151. 15 Ed Cropley, “Zambia Opposition Slates China, Malaysia Investors,” Reuters, January 20, 2010. African Reactions to Chinese Engagement 59...creates severe resentment. In the wake of nationwide protests against Chinese merchants in Malawi, the Malawian government passed a law banning ...China and Africa play a larger role on the global media stage. Cai Fuchao, Minister of State Administration of Radio, Film and Television, said, “By

  17. Safety and Mission Assurance Knowledge Management Retention

    Science.gov (United States)

    Johnson, Teresa A.

    2006-01-01

    This viewgraph presentation reviews the issues surrounding the management of knowledge in regards to safety and mission assurance. The JSC workers who were hired in the 1960's are slated to retire in the next two to three years. The experiences and knowledge of these NASA workers must be identified, and disseminated. This paper reviews some of the strategies that the S&MA is developing to capture that valuable institutional knowledge.

  18. Fires. A Joint Publication for U.S. Artillery Professionals. March - April 2011

    Science.gov (United States)

    2011-03-01

    capability to integrate target acquisition sensors with intelligence collection, planning, and analysis to enhance operations and intelligence...heat. Infra-red sensors can detect a boosting ballistic missile’s heat plume from great distances away, especially from space, making such an...the Clementine I lunar -orbiter and ASTRID flight test programs of the early 1990s. The original cost to deploy 1,000 interceptors was slated to be

  19. The precipitation processes of Manaurite XM superalloy after 2000 hours of aging

    Directory of Open Access Journals (Sweden)

    W. Jasiński

    2008-03-01

    Full Text Available This papcr prcwnts thc results of invcsligations of rnicrostructurc and mcchnnicnl propcnics, In a slate of dclivcry. ancr 1000 anrl2(KKlh ofanncaling of supcralloy samples Manauritc XM ~akcnlr om a catalytic ccntrifugal cast pipc. Thc anncaling or rllc mntcrinl takcn fromcatal yric pipcs nt lhc tcmpcrarurc of 900 "C causes precipitation of intcrrnctallic phnscs in alloycd auacnitc matrix. Thcsc changcs afrcclthc pipcs' mcchnnical propcnies

  20. Where is the Internet heading to?

    International Nuclear Information System (INIS)

    Martin, Olivier

    2010-01-01

    A review of the state of the Internet in terms of traffic and services trends covering both the Research and Education and the Commercial Internet will first be given. The problematic behind the IPv4 to IPv6 migration will be explained shortly, a short review of the ongoing efforts to re-design the Internet in a clean-slate approach will then be made.

  1. Where is the Internet heading to?

    Energy Technology Data Exchange (ETDEWEB)

    Martin, Olivier, E-mail: Olivier.Martin@ictconsulting.c [ICT Consulting, CH-1276 Gingins (VD) (Switzerland)

    2010-04-01

    A review of the state of the Internet in terms of traffic and services trends covering both the Research and Education and the Commercial Internet will first be given. The problematic behind the IPv4 to IPv6 migration will be explained shortly, a short review of the ongoing efforts to re-design the Internet in a clean-slate approach will then be made.

  2. New Trends in Mobile Technology Leadership

    Directory of Open Access Journals (Sweden)

    Silviu Cojocaru

    2014-05-01

    Full Text Available The mobile device market proved one of the most dynamic, with the leader in intelligent phones changing at least four times during the last decade. At least one important acquisition was registered during 2013 (when Microsoft bought Nokia’s mobile phone division and this event is slated to induce major shifts within the structure of this market. With this story we aim to provide information related to trends foreseen for this market.

  3. Tonopah Test Range Air Monitoring. CY2014 Meteorological, Radiological, and Airborne Particulate Observations

    Energy Technology Data Exchange (ETDEWEB)

    Nikoloch, George [Desert Research Inst. (DRI), Las Vegas, NV (United States); Shadel, Craig [Desert Research Inst. (DRI), Las Vegas, NV (United States); Chapman, Jenny [Desert Research Inst. (DRI), Las Vegas, NV (United States); Mizell, Steve A. [Desert Research Inst. (DRI), Las Vegas, NV (United States); McCurdy, Greg [Desert Research Inst. (DRI), Las Vegas, NV (United States); Etyemezian, Vicken [Desert Research Inst. (DRI), Las Vegas, NV (United States); Miller, Julianne J. [Desert Research Inst. (DRI), Las Vegas, NV (United States)

    2015-10-01

    In 1963, the U.S. Department of Energy (DOE) (formerly the Atomic Energy Commission [AEC]), implemented Operation Roller Coaster on the Tonopah Test Range (TTR) and an adjacent area of the Nevada Test and Training Range (NTTR) (formerly the Nellis Air Force Range). This test resulted in radionuclide-contaminated soils at Clean Slate I, II, and III. This report documents observations made during ongoing monitoring of radiological, meteorological, and dust conditions at stations installed adjacent to Clean Slate I and Clean Slate III and at the TTR Range Operations Control center. The primary objective of the monitoring effort is to determine if winds blowing across the Clean Slate sites are transporting particles of radionuclide-contaminated soils beyond both the physical and administrative boundaries of the sites. Results for the calendar year (CY) 2014 monitoring are: (1) the gross alpha and gross beta values from the monitoring stations are approximately equivalent to the highest values observed during the CY2014 reporting at the surrounding Community Environmental Monitoring Program (CEMP) stations; (2) only naturally occurring radionuclides were identified in the gamma spectral analyses; (3) the ambient gamma radiation measurements indicate that the average annual gamma exposure is similar at all three monitoring stations and periodic intervals of increased gamma values appear to be associated with storm fronts passing through the area; and (4) the concentrations of both resuspended dust and saltated sand particles generally increase with increasing wind speed. Differences in the observed dust concentrations are likely the result of differences in the soil characteristics immediately adjacent to the monitoring stations. Neither the resuspended particulate radiological analyses nor the ambient gamma radiation measurements suggest wind transport of radionuclide-contaminated soils.

  4. Methodology for Identifying and Quantifying Metal Pollutant Sources in Storm Water Runoff

    Science.gov (United States)

    2015-02-01

    sanitary sewer are not viable options. In addition, visual inspections of the drainage areas have been insufficient in identifying and quantifying the...diverting the runoff into the sanitary sewer system, but the cost could exceed millions of dollars. Instead of capturing and treating all stormwater...Unknown Appears only if Building Siding is “metal” Roof Material roof_mat_d Built Up, Metal Panel, Asphalt, Fabric, Clay , Slate, Wood, Other

  5. New heavy crude oil flow improver increases delivery : application scenarios

    Energy Technology Data Exchange (ETDEWEB)

    Pierce, J.; Johnston, R.; Lauzon, P. [ConocoPhillips Specialty Products Inc., Houston, TX (United States)

    2009-07-01

    Flow improvers or drag reducing agents have been used for over 25 years as a method to increase fluid flow in hydrocarbon pipelines. The technology is effective in refined projects, light and medium crude oils. This paper presented a new development in flow improver technology that allows treatment of heavy crude oil slates. It discussed case studies of flow improver treatment of heavy oils in various pipeline system as well as factors that affect commercial success. tabs., figs.

  6. 片状岩のクリープ性大規模崩壊

    OpenAIRE

    岩松, 暉; 下川, 悦郎; Akira, IWAMATSU; Etsuro, SHIMOKAWA; 鹿児島大学理学部地学教室; 鹿児島大学農学部林学科; Institute of Earth Science, Faculty of Science, Kagoshima University; Department of Forestry, Faculty of Agriculture, Kagoshima University

    1986-01-01

    Large-scale landslides due to rock-creeping occur frequently in the tectonite zone of orogenic belts where well-cleaved argillaceous rocks such as slate, chert-laminite and slump breccia are widely distributed. These landslides are well observed in the Kyushu mountains. They can be detected by careful photo-interpretation because they have similar topographic features as follows. Double ridges (Doppelgraten), step eliffs and extension gashes are well developed in the top of the slide area. Cr...

  7. Tonopah Test Range Air Monitoring: CY2013 Meteorological, Radiological, and Airborne Particulate Observations

    Energy Technology Data Exchange (ETDEWEB)

    Mizell, Steve A [DRI; Nikolich, George [DRI; Shadel, Craig [DRI; McCurdy, Greg [DRI; Etyemezian, Vicken [DRI; Miller, Julianne J [DRI

    2014-10-01

    In 1963, the U.S. Department of Energy (DOE) (formerly the Atomic Energy Commission [AEC]), implemented Operation Roller Coaster on the Tonopah Test Range (TTR) and an adjacent area of the Nevada Test and Training Range (NTTR) (formerly the Nellis Air Force Range). This test resulted in radionuclide-contaminated soils at Clean Slate I, II, and III. This report documents observations made during on-going monitoring of radiological, meteorological, and dust conditions at stations installed adjacent to Clean Slate I and Clean Slate III and at the TTR Range Operations Control center. The primary objective of the monitoring effort is to determine if winds blowing across the Clean Slate sites are transporting particles of radionuclide-contaminated soils beyond both the physical and administrative boundaries of the sites. Results for the calendar year (CY) 2013 monitoring include: (1) the gross alpha and gross beta values from the monitoring stations are approximately equivalent to the highest values observed during the CY2012 reporting at the surrounding Community Environmental Monitoring Program (CEMP) stations (this was the latest documented data available at the time of this writing); (2) only naturally occurring radionuclides were identified in the gamma spectral analyses; (3) the ambient gamma radiation measurements indicate that the average annual gamma exposure is similar at all three monitoring stations and periodic intervals of increased gamma values appear to be associated with storm fronts passing through the area; and (4) the concentrations of both resuspended dust and saltated sand particles generally increase with increasing wind speed. However, differences in the observed dust concentrations are likely due to differences in the soil characteristics immediately adjacent to the monitoring stations. Neither the resuspended particulate radiological analyses nor the ambient gamma radiation measurements suggest wind transport of radionuclide-contaminated soils.

  8. Wartime Roles and Capabilities for the Unified Logistic Staffs

    Science.gov (United States)

    1989-02-01

    standard Army ammunition system SAPO Subarea Petroleum Office SCP service control point (fuels) SHAPE Supreme Headquarters, Allied Powers Europe SIDATH... SAPOs ). Communication exists between the operations and logistic staffs within the unified, component, Service, and JS levels. But between...daily. The JPOs/ SAPOs receive the short-term requirements and consoli- date them for resupply by submitting slates (how much, when, and where needed

  9. Reactividad álcali-sílice y álcali-silicato en pizarras

    Directory of Open Access Journals (Sweden)

    Campos, P.L.

    2010-06-01

    Full Text Available In this paper it is studied the reactivity of the slates with alkali hydroxides released by the cements in concretes and mortars. For this purpose several essays were performed under different conditions to a selection of slates of different origins and composition. It has been shown that all the tested slates are susceptible to alkali-silica and alkali-silicate reactivity with the alkalis of the cement and that not all the tests routinely performed to detect such reactions are reliable. Verified the reactivity of these rocks, the causes of observed behaviours and the possibilities to minimize or eliminate this reactivity are studied so that the slates could be in use in contact with cement in composite materials. The use of pozzolanic cements turns out to be effective for the elimination of this type of reactions.

    En este trabajo se ha estudiado la reactividad de las pizarras con los hidróxidos alcalinos liberados por los cementos en hormigones y morteros. Para ello se han realizado diferentes ensayos en distintas condiciones, a una selección de pizarras de distinto origen y composición. Se ha constatado que todas las pizarras ensayadas son susceptibles de sufrir reactividad álcali-sílice álcali-silicato con los álcalis de los cementos y que no todos los ensayos que se realizan de forma rutinaria para detectar este tipo de reacciones en los áridos son igual de fiables. Comprobada la reactividad de estas rocas se estudian las causas de los comportamientos observados y las posibilidades de minimizar o eliminar estas reactividades de tal manera que se puedan utilizar las pizarras en contacto con los cementos en materiales compuestos. El uso de cementos puzolánicos se revela como eficaz a la hora de eliminar este tipo de reacciones.

  10. The Nirex safety assessment research programme: annual report for 1986/87

    International Nuclear Information System (INIS)

    Cooper, M.J.; Hodgkinson, D.P.

    1987-05-01

    This report describes research relating to the underground disposal of low-level and intermediate-level radioactive wastes, to provide information for post-emplacement radiological safety assessment. Topics reported are solubility and sorption, organic degradation, microbial activity, leaching, the corrosion of containers, and radionuclide migration studies. Properties of clays, slates, colloids and uranium disequilibrium are studied. Mathematical modelling to support the safety assessment of radioactive waste disposal is also studied. (U.K.)

  11. Solvent. I. Extraction systems applied to uranium analysis. I. Extraction studies with Tributyl phosphate-Methyl-isobutyl-ketone

    International Nuclear Information System (INIS)

    Vera Palomino, J.; Palomares Delgado, F.; Petrement Eguiluz, J. C.

    1964-01-01

    A factorial study of the selective extraction of uranium with a mixture of TBP-MIC was carried out using 0,8 N nitric acid and different salting agents. We use the most suitable salting agent to develop new factorial experiments in order to get an equation involving the percent of extracted uranium, E, the concentration of the extraction agent in the organic phase, c, and the concentration of the slating agent in the aqueous phase, n. (Author) 3 refs

  12. Solvent. I. Extraction systems applied to uranium analysis. I. Extraction studies with Tributyl phosphate-Methyl-isobutyl-ketone; Metodos de extraccion don disolventes aplicados al analisis quimico del uranio. I. Estudio de la extraccion con fosfato de tributilo-metilisobutilcetano

    Energy Technology Data Exchange (ETDEWEB)

    Vera Palomino, J; Palomares Delgado, F; Petrement Eguiluz, J C

    1964-07-01

    A factorial study of the selective extraction of uranium with a mixture of TBP-MIC was carried out using 0,8 N nitric acid and different salting agents. We use the most suitable salting agent to develop new factorial experiments in order to get an equation involving the percent of extracted uranium, E, the concentration of the extraction agent in the organic phase, c, and the concentration of the slating agent in the aqueous phase, n. (Author) 3 refs.

  13. Phase 1 Environmental Baseline Survey for the Leasing of Nevada Test and Training Range, EC-South Range, Well Site ER-EC-11, for the Underground Test Area Pahute Mesa Phase 2 Drilling and Testing Program Nye County, Nevada

    Science.gov (United States)

    2009-05-01

    many areas by a variety of late Tertiary and Quaternary surficial deposits, including alluvium, colluvium, and basalt (Slate et al., 1999). Most...buried) ´ Claim Canyon Caldera marginPliocene & Quaternary basaltic rocks (1996) Source: NSTec, 2009 24 features in the PM-OV area are buried by...return it to the Fibers and Organics Branch. • Transformer Registration Form -I structions (E.QE)_ (1 pg, lOK) • Form 7720-12 (PDF) (1 pg, 13K

  14. Taladrado de pizarra mediante láser de Nd:Yag

    Directory of Open Access Journals (Sweden)

    Larosi, M. S.

    1998-04-01

    Full Text Available A serie of experiments to investigate the feasibility of using a Nd: YAG laser to process slate tiles and the influence of the processing parameters have been undertaken. The objective of this work is to investigate the capabilities of a Nd:YAG pulsed laser to drill tiny holes in slate tiles, in order to produce a better quality drilled slate tile in a reduced time. Part of the results obtained in a systematic study about the influence of the processing parameters, such as average power, pulse width, frequency, pressure and type of assisting gas is presented.

    Se ha desarrollado una serie de experimentos para investigar la viabilidad del uso de un láser de Nd: YAG para el procesamiento de piezas de pizarra, así como los parámetros que más afectan al proceso. El objetivo concreto de este trabajo es investigar la capacidad de un láser de Nd:YAG pulsado para taladrar orificios de pequeño diámetro en láminas de pizarra, con el fin de obtener mejor calidad de taladrado en un tiempo reducido. Se presenta parte de los resultados obtenidos en un estudio sistemático de la influencia de los parámetros de procesamiento en la forma del orificio, tales como, potencia, duración de pulso, frecuencia, presión y tipo de gas de aportación.

  15. Correlation between sub-micron surface roughness of iron oxide encrustations and trace element concentrations

    International Nuclear Information System (INIS)

    Fischer, Cornelius; Karius, Volker; Luettge, Andreas

    2009-01-01

    Iron oxide encrustations are formed on black slate surfaces during oxidative weathering of iron sulfide and phosphate bearing, organic matter-rich slates. Synchronously, trace elements are released during ongoing weathering. Laser ablation ICP-MS analyses of a weathered and encrusted slate showed that major portions of the V, Cu, As, Mo, Pb, Th, and U reside in the encrustation. Recently a potential relationship between several micrometer to 500 nm surface topography roughness of such encrustations and its uranium concentration was shown. Based on laser scanning microscopy measurements, the present study shows that this interrelation must be expanded to small submicron-sized half-pores with diameters between 100 nm and 500 nm. We demonstrate that the relationship is not limited to topography variations of a single encrustation in the hand-specimen scale. Surface topography and geochemical analyses of iron oxide encrustations from several locations but from the same geochemical environment and with similar weathering history showed that the concentrations of U, P, Cu, and Zn correlate inversely with the surface roughness parameter F. This parameter represents the total surface area and is - in this case - a proxy for the root-mean square surface roughness Rq. This study substantiates the environmental importance that micrometer- to submicrometer topography variations of fluid-rock interfaces govern the trapping of trace elements.

  16. Correlation between sub-micron surface roughness of iron oxide encrustations and trace element concentrations

    Energy Technology Data Exchange (ETDEWEB)

    Fischer, Cornelius, E-mail: cornelius@rice.edu [Department of Earth Science, MS-126, Rice University, 6100 Main Street, Houston, TX 77005 (United States); Geowissenschaftliches Zentrum der Universitaet Goettingen, Abt. Sedimentologie and Umweltgeologie, Goldschmidtstr. 3, D-37077 Goettingen (Germany); Karius, Volker [Geowissenschaftliches Zentrum der Universitaet Goettingen, Abt. Sedimentologie and Umweltgeologie, Goldschmidtstr. 3, D-37077 Goettingen (Germany); Luettge, Andreas [Department of Earth Science, MS-126, Rice University, 6100 Main Street, Houston, TX 77005 (United States); Department of Chemistry, Rice University, 6100 Main Street, Houston, TX 77005 (United States)

    2009-08-01

    Iron oxide encrustations are formed on black slate surfaces during oxidative weathering of iron sulfide and phosphate bearing, organic matter-rich slates. Synchronously, trace elements are released during ongoing weathering. Laser ablation ICP-MS analyses of a weathered and encrusted slate showed that major portions of the V, Cu, As, Mo, Pb, Th, and U reside in the encrustation. Recently a potential relationship between several micrometer to 500 nm surface topography roughness of such encrustations and its uranium concentration was shown. Based on laser scanning microscopy measurements, the present study shows that this interrelation must be expanded to small submicron-sized half-pores with diameters between 100 nm and 500 nm. We demonstrate that the relationship is not limited to topography variations of a single encrustation in the hand-specimen scale. Surface topography and geochemical analyses of iron oxide encrustations from several locations but from the same geochemical environment and with similar weathering history showed that the concentrations of U, P, Cu, and Zn correlate inversely with the surface roughness parameter F. This parameter represents the total surface area and is - in this case - a proxy for the root-mean square surface roughness Rq. This study substantiates the environmental importance that micrometer- to submicrometer topography variations of fluid-rock interfaces govern the trapping of trace elements.

  17. Painting with polygons: a procedural watercolor engine.

    Science.gov (United States)

    DiVerdi, Stephen; Krishnaswamy, Aravind; Měch, Radomír; Ito, Daichi

    2013-05-01

    Existing natural media painting simulations have produced high-quality results, but have required powerful compute hardware and have been limited to screen resolutions. Digital artists would like to be able to use watercolor-like painting tools, but at print resolutions and on lower end hardware such as laptops or even slates. We present a procedural algorithm for generating watercolor-like dynamic paint behaviors in a lightweight manner. Our goal is not to exactly duplicate watercolor painting, but to create a range of dynamic behaviors that allow users to achieve a similar style of process and result, while at the same time having a unique character of its own. Our stroke representation is vector based, allowing for rendering at arbitrary resolutions, and our procedural pigment advection algorithm is fast enough to support painting on slate devices. We demonstrate our technique in a commercially available slate application used by professional artists. Finally, we present a detailed analysis of the different vector-rendering technologies available.

  18. 40Ar/39Ar and K/Ar whole rock age constraints on the timing of regional deformation, South Coast of New South Wales, Lachlan Fold Belt, Southeastern Australia: problems and implications

    International Nuclear Information System (INIS)

    Phillips, D.; Fergusson, C.L.

    1999-01-01

    Full text: Subduction complex rocks are well exposed on the south coast of New South Wales around Batemans Bay. Farther south in the Narooma and Bermagui region, Offier et al (1998) have determined two 40 Ar/ 39 Ar ages of 450 ± 3 Ma and 445 ± 2 Ma. They argued that these ages constrain the timing of intense underplating-related deformation and we have undertaken farther work, from an area south of Batemans Bay, to test this suggestion. The 40 Ar/ 39 Ar method applied to fine-grained, low temperature metamorphic rocks, such as slates, is beset by the problem of recoil loss and/or redistribution of 39 Ar during the irradiation process. Another problem is the difficulty of distinguishing between the contributions to 40 Ar/ 39 Ar spectra from illite/muscovite grown during the cleavage-producing deformation and detrital muscovite/illite. In the current study, four slate samples, with variable contents of detrital white mica, were analysed by both the K-Ar and 40 Ar/ 39 Ar step-heating methods. A separate of detrital white mica from one slate sample yields a plateau age of 500 ± 2 Ma. This result indicates that inheritance has not been eliminated by metamorphism as is commonly assumed and that the 40 Ar/ 39 Ar ages provide only a maximum estimate for the timing of deformation. 40 Ar/ 39 Ar analyses of state chips yield discordant, saddle-shaped age spectra, with minimum, within-saddle' ages of ca. 420 Ma. Two slate samples give identical 40 Ar/ 39 Ar integrated ages of 455 ± 2 Ma. One sample contains relatively abundant detrital bedding-parallel mica flakes that are locally oblique to the regional cleavage in the rock. The 40 Ar/ 39 Ar ages are some 20 Ma older than K-Ar ages for these same samples, suggesting that recoil loss of 39 Ar may also have affected these slates. Both recoil loss of 39 Ar and inherited white micas will yield elevated apparent ages, thus providing only maximum ages for the cleavage-producing deformation. Two other samples from slaty tectonic

  19. Obtención de espumas a partir de residuos de pizarra

    Directory of Open Access Journals (Sweden)

    Cambronero, L. E. G.

    2005-12-01

    Full Text Available The objective of the present work is the recovery of slate wastes into a raw material for the ceramic industry. Foams are obtained without any addition of foaming agent thanks to the transformation of component present on the slate during heating. A glass base material with a closed porosity, gray color and density value around to 0,3g/cm3 has been obtained. Raw material is the slate waste as slurry, after cutting roofing slates. After drying, the slate powders were die pressed to achieve green samples, which were sintered in N2-5%H2 atmosphere at different temperatures, as well as in air as reference material at 1150ºC. Dilatometer behavior was studied on die pressed slate powders under both atmospheres as well as XRay diffraction in order to determine the crystalline phases on sintered materials. Sintered density decreases as temperature increases under non-oxidant atmosphere, which leads to decrease the mechanical properties with the temperature when the foam structure is developed (over 1075ºC on N2-5%H2 atmosphere.

    La transformación de los residuos de pizarra de techar en materias primas no tradicionales de la industria cerámica, es el objetivo del presente trabajo. Sin la adición de agentes espumantes, mediante la alteración que sufren los componentes de la pizarra cuando la misma es sometida a un calentamiento en atmósfera no oxidante, se han alcanzado espumas de poro cerrado o cerámica porosa de color gris oscuro con densidades próximas a 0,3 g/cm3 en las que las paredes están formadas principalmente por una fase vítrea. La materia prima empleada se obtiene por secado de lodos procedentes de las operaciones de corte de la pizarra para techar. Los compactos en verde obtenidos en matriz flotante se sinterizaron en atmósfera de N2-5% H2 a distintas temperaturas, así como en aire a 1150ºC como material de referencia y se empleó la difracción de rayos X para determinar las fases cristalinas presentes en los materiales

  20. Source of arsenic-bearing pyrite in southwestern Vermont, USA: Sulfur isotope evidence

    Energy Technology Data Exchange (ETDEWEB)

    Mango, Helen, E-mail: helen.mango@castleton.edu [Department of Natural Sciences, Castleton State College, 233 South Street, Castleton, VT 05735 (United States); Ryan, Peter, E-mail: pryan@middlebury.edu [Department of Geology, Middlebury College, 276 Bicentennial Way, Middlebury, VT 05753 (United States)

    2015-02-01

    Arsenic-bearing pyrite is the source of arsenic in groundwater produced in late Cambrian and Ordovician gray and black slates and phyllites in the Taconic region of southwestern Vermont, USA. The aim of this study is to analyze the sulfur isotopic composition of this pyrite and determine if a relationship exists between pyrite δ{sup 34}S and arsenic content. Pyrite occurs in both sedimentary/diagenetic (bedding-parallel layers and framboids) and low-grade metamorphic (porphyroblast) forms, and contains up to > 2000 ppm As. The sulfur isotopic composition of arsenic-bearing pyrite ranges from − 5.2‰ to 63‰. In the marine environment, the sulfur in sedimentary pyrite becomes increasingly enriched in {sup 34}S as the geochemical environment becomes increasingly anoxic. There is a positive correlation between δ{sup 34}S and arsenic content in the Taconic pyrite, suggesting that uptake of arsenic by pyrite increased as the environment became more reducing. This increased anoxia may have been due to a rise in sea level and/or tectonic activity during the late Cambrian and Ordovician. Low-grade metamorphism appears to have little effect on sulfur isotope composition, but does correlate with lower arsenic content in pyrite. New groundwater wells drilled in this region should therefore avoid gray and black slates and phyllites that contain sedimentary/diagenetic pyrite with heavy δ{sup 34}S values. - Highlights: • Pyrite is the source of arsenic in groundwater in the Taconic region of Vermont, USA. • As-bearing pyrite δ{sup 34}S = – 5.2 to 63‰ with higher {sup 34}S as environment becomes more anoxic. • High sea level, tectonic activity create anoxia, with incorporation of As into pyrite. • New wells should avoid slate/phyllite containing sedimentary pyrite with heavy δ{sup 34}S.

  1. Source of arsenic-bearing pyrite in southwestern Vermont, USA: Sulfur isotope evidence

    International Nuclear Information System (INIS)

    Mango, Helen; Ryan, Peter

    2015-01-01

    Arsenic-bearing pyrite is the source of arsenic in groundwater produced in late Cambrian and Ordovician gray and black slates and phyllites in the Taconic region of southwestern Vermont, USA. The aim of this study is to analyze the sulfur isotopic composition of this pyrite and determine if a relationship exists between pyrite δ 34 S and arsenic content. Pyrite occurs in both sedimentary/diagenetic (bedding-parallel layers and framboids) and low-grade metamorphic (porphyroblast) forms, and contains up to > 2000 ppm As. The sulfur isotopic composition of arsenic-bearing pyrite ranges from − 5.2‰ to 63‰. In the marine environment, the sulfur in sedimentary pyrite becomes increasingly enriched in 34 S as the geochemical environment becomes increasingly anoxic. There is a positive correlation between δ 34 S and arsenic content in the Taconic pyrite, suggesting that uptake of arsenic by pyrite increased as the environment became more reducing. This increased anoxia may have been due to a rise in sea level and/or tectonic activity during the late Cambrian and Ordovician. Low-grade metamorphism appears to have little effect on sulfur isotope composition, but does correlate with lower arsenic content in pyrite. New groundwater wells drilled in this region should therefore avoid gray and black slates and phyllites that contain sedimentary/diagenetic pyrite with heavy δ 34 S values. - Highlights: • Pyrite is the source of arsenic in groundwater in the Taconic region of Vermont, USA. • As-bearing pyrite δ 34 S = – 5.2 to 63‰ with higher 34 S as environment becomes more anoxic. • High sea level, tectonic activity create anoxia, with incorporation of As into pyrite. • New wells should avoid slate/phyllite containing sedimentary pyrite with heavy δ 34 S

  2. Geochronology, radiogenic isotope geochemistry, and petrogenesis of Sang bast Paleo-tethys monzogranite, Mashhad, Iran

    International Nuclear Information System (INIS)

    Karimpour, M. H.; Farmer, G.L.; Stern, C.R.

    2010-01-01

    The study area is located in northeastern Iran (south of Mashhad). Paleo-Tethys Ocean opened during Silurian time and subduction under Turan plate was started in Late Devonian. By Late Triassic (225 Ma) there was no Paleo-Tethys left on an Iranian transect, therefore Turan plate obducted over Iran Plate. Two stages of low grade regional metamorphism are exposed, that are related to Hercynian (Late Paleozoic) and Cimmerian (Jurassic) oro genies. The Paleo-Tethys remnants (meta-ophiolite and meta-flysch) were intruded by Sang bast monzogranite. Chemically, monzogranite is moderately peraluminous S-type granitoid. It has low values of magnetic susceptibility [(5 to 11) * 10 -5 SI] therefore it is classified as belonging to the ilmenite-series of reduced type granitoids. Monzogranite is characterized by strong light rare earth element enrichment and less low heavy rare earth element. All samples have very small negative Eu anomalies (Eu/Eu * = 0.62 to 0.88). Total rare earth element content of monzogranite is between 212-481 ppm. The result of U-Pb zircon age dating of monzogranite is 201.3 ± 3.6 Ma (Upper Triassic, Rhaetian time). The initial 87 Sr/ 86 Sr and 143 Nd/ 144 Nd ratios for monzogranite is (0.706776 and 0.512219) when recalculated to an age of 201 Ma, consistent with the new radiometric. The initial 87 Sr/ 86 Sr and 143 Nd/ 144 Nd ratios for slate is (0.720613 and 0.511601) respectively when recalculated to an age of 201 Ma, consistent with the new radiometric results. Initial εNd isotope values for monzogranite is -3.13 and the slate is -15.19. Based on radiogenic isotopic data and rare earth element monzogranite magma originated either from lower continental crust which was very different from slate or it is originated from mantle and contaminated in continental crust during ascending.

  3. Designs that make a difference: the Cardiac Universal Bed model.

    Science.gov (United States)

    Johnson, Jackie; Brown, Katherine Kay; Neal, Kelly

    2003-01-01

    Information contained in this article includes some of the findings from a joint research project conducted by Corazon Consulting and Ohio State University Medical Center on national trends in Cardiac Universal Bed (CUB) utilization. This article outlines current findings and "best practice" standards related to the benefits of developing care delivery models to differentiate an organization with a competitive advantage in the highly dynamic marketplace of cardiovascular care. (OSUMC, a Corazon client, is incorporating the CUB into their Ross Heart Hospital slated to open this spring.)

  4. Example of feedstock optimization

    International Nuclear Information System (INIS)

    Boustros, E.

    1991-01-01

    An example of feedstock optimization at an olefins plant which has the flexibility to process different kinds of raw materials while maintaining the same product slate, is presented. Product demand and prices, and the number of units in service as well as the required resources to operate these units are considered to be fixed. The plant profitability is a function of feedstock choice, plus constant costs which are the non-volume related costs. The objective is to find a set or combination of feedstocks that could match the client product demands and fall within the unit's design and capacity, while maximizing the financial operating results

  5. Managing the Mars Science Laboratory Thermal Vacuum Test for Safety and Success

    Science.gov (United States)

    Evans, Jordan P.

    2010-01-01

    The Mars Science Laboratory is a NASA/JPL mission to send the next generation of rover to Mars. Originally slated for launch in 2009, development problems led to a delay in the project until the next launch opportunity in 2011. Amidst the delay process, the Launch/Cruise Solar Thermal Vacuum Test was undertaken as risk reduction for the project. With varying maturity and capabilities of the flight and ground systems, undertaking the test in a safe manner presented many challenges. This paper describes the technical and management challenges and the actions undertaken that led to the ultimate safe and successful execution of the test.

  6. Rubidium-strontium method

    International Nuclear Information System (INIS)

    Dubansky, A.

    1980-01-01

    The rubidium-strontium geological dating method is based on the determination of the Rb and Sr isotope ratio in rocks, mainly using mass spectrometry. The method is only practical for silicate minerals and rocks, potassium feldspars and slates. Also described is the rubidium-strontium isochrone method. This, however, requires a significant amount of experimental data and an analysis of large quantities of samples, often of the order of tons. The results are tabulated of rubidium-strontium dating of geological formations in the Czech Socialist Republic. (M.S.)

  7. An Overview of the Jupiter Icy Moons Orbiter (JIMO) Mission, Environments, and Materials Challenges

    Science.gov (United States)

    Edwards, Dave

    2012-01-01

    Congress authorized NASA's Prometheus Project in February 2003, with the first Prometheus mission slated to explore the icy moons of Jupiter with the following main objectives: (1) Develop a nuclear reactor that would provide unprecedented levels of power and show that it could be processed safely and operated reliably in space for long-duration. (2) Explore the three icy moons of Jupiter -- Callisto, Ganymede, and Europa -- and return science data that would meet the scientific goals as set forth in the Decadal Survey Report of the National Academy of Sciences.

  8. Creativity at Work

    DEFF Research Database (Denmark)

    Mathieu, Chris; Bertelsen, Marianne

    This case focuses on juries that award prizes at film festivals. Prize juries usually award a preordained set of prizes to a preselected slate of films, but on grounds or criteria that are usually up to the actual jury itself to formally or informally establish and administer. The consequences...... is a matter of debate. The film festivals themselves and their leadership also are impacted by the jury and its decisions, as these build or erode legitimacy and publicity for the festival. Likewise, the jury members themselves may receive a number of benefits from their jury work, as elaborated on below....

  9. A new radiation exposure record system

    International Nuclear Information System (INIS)

    Lyon, M.; Berndt, V.L.; Trevino, G.W.; Oakley, B.M.

    1993-04-01

    The Hanford Radiological Records Program (HRRP) serves all Hanford contractors as the single repository for radiological exposure for all Hanford employees, subcontractors, and visitors. The program administers and preserves all Hanford radiation exposure records. The program also maintains a Radiation Protection Historical File which is a historical file of Hanford radiation protection and dosimetry procedures and practices. Several years ago DOE declared the existing UNIVAC mainframe computer obsolete and the existing Occupational Radiation Exposure (ORE) system was slated to be redeveloped. The new system named the Radiological Exposure (REX) System is described in this document

  10. Semantic web technologies for enterprise 2.0

    CERN Document Server

    Passant, A

    2010-01-01

    In this book, we detail different theories, methods and implementations combining Web 2.0 paradigms and Semantic Web technologies in Enterprise environments. After introducing those terms, we present the current shortcomings of tools such as blogs and wikis as well as tagging practices in an Enterprise 2.0 context. We define the SemSLATES methodology and the global vision of a middleware architecture based on Semantic Web technologies and Linked Data principles (languages, models, tools and protocols) to solve these issues. Then, we detail the various ontologies that we build to achieve this g

  11. Goldtraces on wedge-shaped artefacts from late neolithic of south Scandinavia analysed by proton induced x-ray emission spectroscopy

    International Nuclear Information System (INIS)

    Ahlberg, M.; Akselsson, R.; Forkman, B.; Rausing, G.

    1975-01-01

    Visible coloured traces on the surface of two selected wedge-shaped artefacts (pendants) of slate from the late Neolithic of South Scandinavia was analysed by means of proton-induced x-ray emission spectroscopy (PIXE). PIXE is shown to be a feasible tool in investigating surface layers of archeological significance. Three different gold-silver alloys was found on the two pendants. The results indicate that we shall have to reconsider the general accepted theories on the economic basis of the early Bronze Age in the area. (author)

  12. Genetic engineering: picking up the pieces.

    Science.gov (United States)

    Budiansky, S

    Proposals from two private companies for the field testing of recombinant organisms are still slated to be considered by the Recombinant DNA Advisory Committee (RAC) of the National Institutes of Health (NIH), despite a federal district court ruling that temporarily halted a University of California field test and barred RAC from approving any other experiments involving NIH funds that would deliberately release recombinant DNA into the environment. The ruling, which was prompted by a lawsuit filed by Jeremy Rifkin, specifically exempted private companies because they are not legally bound by RAC decisions, but have been complying voluntarily. The temporary injunction is being appealed by the university.

  13. 40Ar/39Ar and K-Ar age constraints on the timing of regional deformation, south coast of New South Wales, Lachlan Fold Belt: problems and implications

    International Nuclear Information System (INIS)

    Fergusson, C.L.; Phillips, D.

    2001-01-01

    Four slate samples from subduction complex rocks exposed on the south coast of New South Wales, south of Batemans Bay, were analysed by K-Ar and 40 Ar/ 39 Ar step-heating methods, One sample contains relatively abundant detrital muscovite flakes that are locally oblique to the regional cleavage in the rock, whereas the remaining samples appear to contain sparse detrital muscovite. Separates of detrital muscovite yielded plateau ages of 505 + 3 Ma and 513 + 3 Ma indicating that inheritance has not been eliminated by metamorphism and recrystallisation. Step-heating analyses of whole-rock chips from all four slate samples produced discordant apparent age spectra with 'saddle shapes' following young apparent ages at the lowest temperature increments. Elevated apparent ages associated with the highest temperature steps are attributed to the presence of variable quantities of detrital muscovite ( 40 Ar/ 39 Ar integrated ages of ca 455Ma, which are some 15-30 million years older than K-Ar ages for the same samples. These discrepancies suggest that the slates have also been affected by recoil loss/redistribution of 39 Ar, Ieading to anomalously old 40 Ar/ 39 Ar ages. Two other samples, from slaty tectonic melange and intensely cleaved slate, yielded average 40 Ar/ 39 Ar integrated ages of ca 424Ma, which are closer to associated mean K-Ar ages of 423 + 4Ma and 409 + 16Ma, respectively. Taking into account the potential influences of recoil loss/redistribution of 39 Ar and inheritance, the results from the latter samples suggest a maximum age of ca 440 Ma for deformation/metamorphism. The current results indicate that recoil and inheritance problems may also have affected whole-rock 40 Ar/ 39 Ar data reported from other regions of the Lachlan Fold Belt. Therefore, until these effects are adequately quantified, models for the evolution of the Lachlan Fold Belt, that are based on such whole-rock 40 Ar/ 39 Ar data, should be treated with caution. Copyright (2001) Geological

  14. Selective hydrogenation processes in steam cracking

    Energy Technology Data Exchange (ETDEWEB)

    Bender, M.; Schroeter, M.K.; Hinrichs, M.; Makarczyk, P. [BASF SE, Ludwigshafen (Germany)

    2010-12-30

    Hydrogen is the key elixir used to trim the quality of olefinic and aromatic product slates from steam crackers. Being co-produced in excess amounts in the thermal cracking process a small part of the hydrogen is consumed in the ''cold part'' of a steam cracker to selectively hydrogenate unwanted, unsaturated hydrocarbons. The compositions of the various steam cracker product streams are adjusted by these processes to the outlet specifications. This presentation gives an overview over state-of-art selective hydrogenation technologies available from BASF for these processes. (Published in summary form only) (orig.)

  15. Chronology of the beryllium replacement shutdown at the High Flux Isotope Reactor (HFIR), 1983

    International Nuclear Information System (INIS)

    Kohring, M.W.

    1984-04-01

    In addition to the permanent beryllium reflector, several other components were replaced. The outer shroud and lower tracks were replaced. The new control rod access plugs and the upper tracks were installed. Replacement of collimator tubes for HB-1 and -2 are tentatively slated for the next permanent beryllium changeout. Inspection of the reactor vessel, the vessel-to-nozzle welds, core support structure, and vessel internal cladding showed them to be in acceptable condition. The highest, accumulative radiation doses received by Reactor Operations personnel during the shutdown, in mrem, were 665, 606, and 560; the highest for P and E personnel were 520, 505, and 475

  16. Mineral resource of the month: dimension stone

    Science.gov (United States)

    Dolley, Thomas P.

    2012-01-01

    The article offers information on dimension stone (DS) that are quarried as natural rock for a specific size and dimension chosen for its color, strength, durability. Varieties of metamorphic, igneous or sedimentary rocks are used but DS rocks are mainly marble, granite and slate that can be found from Maine to Alabama in the U.S., in the Carrara District of Italy as well as in Greece, China and Brazil. It also notes the advent of steel and concrete in construction that ceased the use of DS.

  17. Rare Earth Plant in Malaysia: Governance, Green Politics, and Geopolitics

    OpenAIRE

    Kai Lit Phua

    2016-01-01

    A rare earth elements (REE) extraction plant was built and began operating in Gebeng, Malaysia (near the city of Kuantan), from early December 2012. This plant, slated to be the world’s largest when it operates at full capacity, is very controversial in Malaysia. Various factors appear to have influenced the setting up of this foreign-owned REE extraction plant, although the source of its raw material is thousands of kilometers away in the desert of Western Australia. This article examines an...

  18. Potentialities and Limits of ICESAT-2 Observation for Atmospheric Aerosol Investigation

    Directory of Open Access Journals (Sweden)

    Mona L.

    2016-01-01

    Full Text Available ICESat-2(Ice, Cloud, and land Elevation Satellite-2, slated for launch in 2017, will continue the important observations of ice-sheet elevation change, sea-ice freeboard, and vegetation canopy height begun by ICESat in 2003. Among the other potential applications, ICESat-2 could provide some information about atmospheric aerosol over Polar Regions thanks to the lidar instrument. In this context, it is essential to demonstrate the ICESat-2 capability of providing vertical profiles of the aerosol backscatter coefficient and to define its potentialities and limits. First results of this investigation are reported and will be presented at the conference.

  19. Frictional Behavior of Altered Basement Approaching the Nankai Trough

    Science.gov (United States)

    Saffer, D. M.; Ikari, M.; Rooney, T. O.; Marone, C.

    2017-12-01

    The frictional behavior of basement rocks plays an important role in subduction zone faulting and seismicity. This includes earthquakes seaward of the trench, large megathrust earthquakes where seamounts are subducting, or where the plate interface steps down to basement. In exhumed subduction zone rocks such as the Shimanto complex in Japan, slivers of basalt are entrained in mélange which is evidence of basement involvement in the fault system. Scientific drilling during the Nankai Trough Seismogenic Zone Experiment (NanTroSEIZE) recovered basement rock from two reference sites (C0011 and C0012) located seaward of the trench offshore the Kii Peninsula during Integrated Ocean Discovery Program (IODP) Expeditions 322 and 333. The basement rocks are pillow basalts that appear to be heterogeneously altered, resulting in contrasting dense blue material and more vesicular gray material. Major element geochemistry shows differences in silica, calcium oxides and loss-on-ignition between the two types of samples. Minor element geochemistry reveals significant differences in vanadium, chromium, and barium. X-ray diffraction on a bulk sample powder representing an average composition shows a phyllosilicate content of 20%, most of which is expandable clays. We performed laboratory friction experiments in a biaxial testing apparatus as either intact sample blocks, or as gouge powders. We combine these experiments with measurements of Pennsylvania slate for comparison, including a mixed-lithology intact block experiment. Intact Nankai basement blocks exhibit a coefficient of sliding friction of 0.73; for Nankai basement powder, slate powder, slate blocks and slate-on-basement blocks the coefficient of sliding friction ranges from 0.44 to 0.57. At slip rates ranging from 3x10-8 to 3x10-4 m/s we observe predominantly velocity-strengthening frictional behavior, indicating a tendency for stable slip. At rates of < 1x10-6 m/s some velocity-weakening was observed, specifically in

  20. A critical analysis of Pier Paolo Pasolini’s African Oresteia

    Directory of Open Access Journals (Sweden)

    K. Michaelis

    1996-04-01

    Full Text Available Pasolini's Appunti per un’Orestiade africana (1970 is a metaphorical film, inspired by the Greek legend of Orestes, in which Pasolini views postcolonial African history through the lens of mythology. His portrait of the birth of “modern” Africa is an attempt to narrate the passage from past to present and to salvage "prehistory" through his dream of the unification of the rational, democratic state and the irrational, primal slate of being. It is, however, a dream punctuated by contradictions and paradoxes, a dream which Pasolini will later abandon. Yet it is significant in the overall development of Pasolini's genre.

  1. The Efficacy of Water Treaties in the Eastern Nile Basin

    Directory of Open Access Journals (Sweden)

    Wuhibegezer Ferede

    2014-01-01

    Full Text Available This paper attempts to analyse the efficacy of the water treaties of the Nile in light of the principles of international law. The following critical examination of the treaties brings to light numerous legal defects associated with fraud, coercion, exclusivity and the deficiency of many of the precepts of the international law. Moreover, the lower riparian states’ advocacy for the succession of colonial treaties, which is branded as the re-affirmation of colonialism, is found to be incompatible with the principles of the clean-slate theory adopted by the upper riparian states. Therefore, the region lacks an efficacious regime that could address the interests of all riparian states.

  2. Introduction

    DEFF Research Database (Denmark)

    2012-01-01

    Why yet another dead French thinker'.' We already have Althusser. Foucault and Derrida. Docs International Relations (I R) really need Pierre Bourdieu! The short answer is yes. The slightly longer answer is that Bourdieu's sociology provides us with an opportunity to rethink international politics....... In short. Bourdieu helps us to take the discursive, visual and embodied practices in international politics more seriously....... in ways not offered by these other thinkers. Bourdieu helps us rediscover the everyday practices. symbolic structures and arenas of conflict that bring many other actors into perspective. rather than just focusing on nation slates that produce (what we call) international politics. All engagement with his...

  3. Thermal Predictions of the Cooling of Waste Glass Canisters

    Energy Technology Data Exchange (ETDEWEB)

    Donna Post Guillen

    2014-11-01

    Radioactive liquid waste from five decades of weapons production is slated for vitrification at the Hanford site. The waste will be mixed with glass forming additives and heated to a high temperature, then poured into canisters within a pour cave where the glass will cool and solidify into a stable waste form for disposal. Computer simulations were performed to predict the heat rejected from the canisters and the temperatures within the glass during cooling. Four different waste glass compositions with different thermophysical properties were evaluated. Canister centerline temperatures and the total amount of heat transfer from the canisters to the surrounding air are reported.

  4. Preserving high-purity 233U

    International Nuclear Information System (INIS)

    Krichinsky, Alan; Giaquinto, Joe; Canaan, Doug

    2016-01-01

    The MARC X Conference hosted a workshop for the scientific community to communicate needs for high-purity 233 U and its by-products in order to preserve critical items otherwise slated for downblending and disposal. Currently, only small portions of the U.S. holdings of separated 233 U are being preserved. However, many additional kilograms of 233 U (>97 % pure) still are destined to be disposed, and it is unlikely that this material will ever be replaced due to a lack of operating production capability. Summaries of information conveyed at the workshop and feedback obtained from the scientific community are presented herein. (author)

  5. Local innovation: The key to globalisation

    Directory of Open Access Journals (Sweden)

    Srivardhini K. Jha

    2013-12-01

    Full Text Available The round table discussion draws the panellists to weigh in on how multinational enterprises from developed countries are innovating in and for emerging markets, the challenges faced, and lessons learnt. The key takeaways are that MNEs are increasingly innovating for the Indian market, alongside their contribution to global products. They are doing so by developing close relationships with field facing organisations, co-creating with customers, empowering engineers, and taking a clean slate approach to product development. This approach has given them dividends not only in the local market but also in the global market.

  6. Radioactivity in building materials

    International Nuclear Information System (INIS)

    Stranden, E.

    1979-01-01

    The object of this brief report is to make the pollution inspectorate aware of the radiation hazards involved in new building materials, such as gypsum boards and alum slate based concrete blocks whose radium content is high. Experience in Swedish housebuilding has shown that a significant increase in the radiation dose to the occupants can occur. Improved insulation and elimination of draughts in fuel conservation accentuate the problem. Norwegian investigations are referred to and OECD and Scandinavian discussions aiming at recommendations and standards are mentioned. Suggested measures by the Norwegian authorities are given. (JIW)

  7. The use of mixed pyrrhotite/pyrite catalysts for co-liquefaction of coal and waste rubber tires

    Energy Technology Data Exchange (ETDEWEB)

    Dadyburjor, D.B.; Zondlo, J.W.; Sharma, R.K. [West Virginia Univ., Morgantown, WV (United States)] [and others

    1995-12-31

    The overall objective of this research program is to determine the optimum processing conditions for tire/coal co-liquefaction. The catalysts used will be a ferric-sulfide-based materials, as well as promising catalysts from other consortium laboratories. The intent here is to achieve the maximum coal+tire conversion at the mildest conditions of temperature and pressure. Specific objectives include an investigation of the effects of time, temperature, pressure, catalyst and co-solvent on the conversion and product slate of the co-liquefaction. Accomplishments and conclusions are discussed.

  8. The Hydrocarbon Pool in Ethanol-to-Gasoline over HZSM-5 Catalysts

    DEFF Research Database (Denmark)

    Johansson, Roger; Hruby, S.L.; Hansen, Jeppe Rass

    2009-01-01

    It is shown that the conversion of ethanol-to-gasoline over an HZSM-5 catalyst yields essentially the same product distribution as for methanol-to-gasoline performed over the same catalyst. Interestingly, there is a significant difference between the identity of the hydrocarbon molecules trapped...... inside the HZSM-5 catalyst when ethanol is used as a feed instead of methanol. In particular, the hydrocarbon pool contains a significant amount of ethylsubstituted aromatics when ethanol is used as feedstock, but there remains only methyl-substituted aromatics in the product slate....

  9. A Case of Argyria Following Colloidal Silver Ingestion

    OpenAIRE

    Kwon, Hyok Bu; Lee, Joon Ho; Lee, Seung Ho; Lee, Ai Young; Choi, Jong Sun; Ahn, Yeon Soon

    2009-01-01

    Argyria is a rare cutaneous discoloration caused by the intake of silver or various compounds containing silver. We report a case of argyria in a 73-year-old male following ingestion of colloidal silver as an alternative medicine over 5 years. He had a diffuse, slate gray discoloration of his face and hands. A biopsy specimen from the face revealed brown-black extracellular granules in the upper dermis and between collagen bundles. We also found silver particles in the mucous of the colon. Th...

  10. Sorption of radionuclides on hard rocks

    International Nuclear Information System (INIS)

    Berry, J.A.; Bourke, P.J.; Green, A.; Littleboy, A.K.

    1987-09-01

    Methods for measuring sorption on hard rocks, particularly of strontium, caesium, neptunium and americium on Darley Dale sandstone and Welsh slate have been investigated. The methods tried included batch tests with crushed rock and tests of simultaneous diffusion and convection with sorption on intact rock. High pressures (800m H 2 O) were used in the convective tests to pump water quickly through the rock samples and to measure high sorptivities in times shorter than those needed in the diffusive methods with intact samples. (author)

  11. Benchmark Imagery FY11 Technical Report

    Energy Technology Data Exchange (ETDEWEB)

    Roberts, R. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Pope, P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2011-06-14

    This report details the work performed in FY11 under project LL11-GS-PD06, “Benchmark Imagery for Assessing Geospatial Semantic Extraction Algorithms.” The original LCP for the Benchmark Imagery project called for creating a set of benchmark imagery for verifying and validating algorithms that extract semantic content from imagery. More specifically, the first year was slated to deliver real imagery that had been annotated, the second year to deliver real imagery that had composited features, and the final year was to deliver synthetic imagery modeled after the real imagery.

  12. THERESA FRANCO INSPECTS THE SOLAR PANELS OF THE MARS GLOBAL SURVEYOR

    Science.gov (United States)

    1996-01-01

    Theresa Franco of SPECTROLAB Inc. carefully inspects the solar panels of the Mars Global Surveyor spacecraft, undergoing preflight assembly and checkout in the Payload Hazardous Servicing Facility in KSC's Industrial Area. The four solar array panels will play a crucial role in the Mars Global Surveyor mission by providing the electrical power required to operate the spacecraft and its complement of scientific instruments. The Surveyor is slated for launch November 6 aboard a Delta II expendable launch vehicle. After arriving at the Red Planet in September 1997, the Surveyor will carry out an extensive study of Mars, gathering data about the planet's topography, magnetism, mineral composition and atmosphere.

  13. Estimating total 239240Pu in blow-sand mounds of two safety-shot sites

    International Nuclear Information System (INIS)

    Gilbert, R.O.; Essington, E.H.

    1977-01-01

    A study for estimating the total amount (inventory) of 239 240 Pu in blow-sand mounds at two safety-shot sites (Area 13-Project 57 on the Nellis Air Force Base and Clean Slate 3 on the Tonopah Test Range in Nevada) is described. The total amount in blow-sand mounds at these two sites is estimated to be 5.8 +- 1.3 (total +- standard error) and 10.6 +- 2.5 curies, respectively. The total 239 240 Pu in mounds plus desert pavement areas, both to a depth of 5 cm below desert pavement level, is estimated to be 39 +- 5.7 curies at the Project 57 site and 36 +- 4.8 curies at Clean Slate 3. These estimates are compared with the somewhat higher estimates of 46 +- 9 and 37 +- 5.4 curies reported that pertain to only the top 5 cm of mounds and desert pavement. The possibility is discussed that these differences are due to sampling variability arising from the skewed nature of plutonium concentrations, particularly near ground zero

  14. Hydropyrolysis of biomass to produce liquid hydrocarbon fuels. Final report. Biomass Alternative-Fuels Program

    Energy Technology Data Exchange (ETDEWEB)

    Fujita, R K; Bodle, W W; Yuen, P C

    1982-10-01

    The ojective of the study is to provide a process design and cost estimates for a biomass hydropyrolysis plant and to establish its economic viability for commercial applications. A plant site, size, product slate, and the most probable feedstock or combination of feedstocks were determined. A base case design was made by adapting IGT's HYFLEX process to Hawaiian biomass feedstocks. The HYFLEX process was developed by IGT to produce liquid and/or gaseous fuels from carbonaceous materials. The essence of the process is the simultaneous extraction of valuable oil and gaseous products from cellulosic biomass feedstocks without forming a heavy hard-to-handle tar. By controlling rection time and temperature, the product slate can be varied according to feedstock and market demand. An optimum design and a final assessment of the applicability of the HYFLEX process to the conversion of Hawaiian biomass was made. In order to determine what feedstocks could be available in Hawaii to meet the demands of the proposed hydropyrolysis plant, various biomass sources were studied. These included sugarcane and pineapple wastes, indigenous and cultivated trees and indigenous and cultivated shrubs and grasses.

  15. Relationship between fluvial clastic sediment and source rock abundance in Rapti river basin of central Nepal Himalayas

    International Nuclear Information System (INIS)

    Tamrakar Naresh Kazi; Shresth Madhusudan Bhakta

    2008-01-01

    Many tributaries from carbonate sedimentary, metamorphic and igneous rocks of the Lesser Himalayan and clastic sedimentary rocks of the Sub-Himalayan Ranges carry gravelly sediments to the Rapti River. River bar sediments were analyzed for composition and texture to evaluate downstream changes in properties, and to establish relationship between proportion of clasts and the abundance of rock types in the source areas. Percent quartzite clast or granite clast increases whereas that of carbonate, schist or slate decreases along downstream. The largest grain size decreases downstream, whereas fatness index and sphericity tend to increase. Despite of little diminish in relative abundance of rock types in source areas along the river, the relative proportion of corresponding clast type shows rapid reduction (e.g. slate or phyllite or carbonate clasts) or rapid enhancement (e.g. granite clast). The relationships of quartzite clast and schist clasts with their corresponding source rocks are statistically significant suggesting that these clasts can provide clue to source rock abundance. About 85 to 94% of the gravel clasts represent rock types of the Lesser Himalayan Range suggesting that this range has been contributing enormous amount of sediments.

  16. Strategic marketing opportunities for Suncor OSG [Oil Sands Group

    International Nuclear Information System (INIS)

    Carrothers, S.

    1993-01-01

    Suncor's Oil Sands Group (OSG) is in a unique position to provide advantages to its customers, producing a light, sweet resid-free crude at a time when North American production of this valuable type of oil is in decline. While the per-barrel production cost of synthetic crude has been high historically, the OSG has recently committed to over US$300 million in capital investments which will reduce unit costs to conventional levels. Adding to this, the plant is located on a reserve that, even with existing technology, could feed the plant virtually indefinitely. Three aggressive strategic initiatives which will enhance the value of the products are being undertaken. The product slate diversification initiative involves significantly expanding the production slate to include premium products that are customized to meet customer needs. The product quality initiative will address product characteristics that are unattractive to some end users. The transportation initiative will ensure reliable and timely delivery of a wide variety of OSG products to an expanded customer base. 1 fig

  17. The Charfuel coal refining process

    International Nuclear Information System (INIS)

    Meyer, L.G.

    1991-01-01

    The patented Charfuel coal refining process employs fluidized hydrocracking to produce char and liquid products from virtually all types of volatile-containing coals, including low rank coal and lignite. It is not gasification or liquefaction which require the addition of expensive oxygen or hydrogen or the use of extreme heat or pressure. It is not the German pyrolysis process that merely 'cooks' the coal, producing coke and tar-like liquids. Rather, the Charfuel coal refining process involves thermal hydrocracking which results in the rearrangement of hydrogen within the coal molecule to produce a slate of co-products. In the Charfuel process, pulverized coal is rapidly heated in a reducing atmosphere in the presence of internally generated process hydrogen. This hydrogen rearrangement allows refinement of various ranks of coals to produce a pipeline transportable, slurry-type, environmentally clean boiler fuel and a slate of value-added traditional fuel and chemical feedstock co-products. Using coal and oxygen as the only feedstocks, the Charfuel hydrocracking technology economically removes much of the fuel nitrogen, sulfur, and potential air toxics (such as chlorine, mercury, beryllium, etc.) from the coal, resulting in a high heating value, clean burning fuel which can increase power plant efficiency while reducing operating costs. The paper describes the process, its thermal efficiency, its use in power plants, its pipeline transport, co-products, environmental and energy benefits, and economics

  18. Material culture across the Aleutian archipelago.

    Science.gov (United States)

    Hatfield, Virginia L

    2010-12-01

    The material evidence from sites across the Aleutian Islands reflects colonization events, subsequent adaptations, and influxes of ideas and/or people from the east. The occurrence in the eastern Aleutians of bifacial technology around 7000 BP, of artifacts similar to the Arctic Small Tool tradition between 4000 and 3500 BP, and of slate and jet objects around 1000 BP reflects repeated surges of influence or movement of peoples from further east into the eastern end of the chain. In the central and western Aleutians, influence or perhaps colonization from east of the Aleutians is also marked by the occurrence of bifacial technology about 6500 BP and the appearance of slate artifacts after 1000 BP, suggesting the movement of ideas or people from further east. Basic trends across the archipelago include a decrease in formal chipped-stone tools, an increase in the use and the complexity of bone technology, and the increase in use and variety of ground-stone tools. In addition, increasing village site sizes and denser midden deposits are seen later in time throughout the archipelago. The similarity in sites and assemblages, albeit with regional variations, reflects trends that are seen across the chain and indicates that these island communities were not isolated from one another or from mainland Alaska.

  19. Structural Analysis: Folds Classification of metasedimentary rock in the Peninsular Malaysia

    Science.gov (United States)

    Shamsuddin, A.

    2017-10-01

    Understanding shear zone characteristics of deformation are a crucial part in the oil and gas industry as it might increase the knowledge of the fracture characteristics and lead to the prediction of the location of fracture zones or fracture swarms. This zone might give high influence on reservoir performance. There are four general types of shear zones which are brittle, ductile, semibrittle and brittle-ductile transition zones. The objective of this study is to study and observe the structural geometry of the shear zones and its implication as there is a lack of understanding, especially in the subsurface area because of the limitation of seismic resolution. A field study was conducted on the metasedimentary rocks (shear zone) which are exposed along the coastal part of the Peninsular Malaysia as this type of rock resembles the types of rock in the subsurface. The analysis in this area shows three main types of rock which are non-foliated metaquartzite and foliated rock which can be divided into slate and phyllite. Two different fold classification can be determined in this study. Layer 1 with phyllite as the main type of rock can be classified in class 1C and layer 2 with slate as the main type of rock can be classified in class 1A. This study will benefit in predicting the characteristics of the fracture and fracture zones.

  20. Semi-annual review forecast, 1965 Canada

    Energy Technology Data Exchange (ETDEWEB)

    1965-07-19

    Production of crude oil and natural gas liquids is expected to average 920,000 bpd this year, up some 70,000 bpd or about 8% from last year's record rate of 850,000 bpd. Petroleum demand within Canada is expected to gain about 44,000 bpd, or 4%, to average 1,073,000 bpd, excluding LPG's. Drilling could set the second consecutive record this year, with the first half drilling totaling 7.5 million ft. The processing construction spotlight is on chemical fertilizer plants with $120 million investment slated over a 2-yr period. Pipeline construction this year will reflect a drop in big-inch work and a rise in small-diameter work. Secondary recovery projects slated to go into operation this year should add at least a billion bbl of recoverable oil. Exploration in 1965 features the search for Keg River reefs, present along a 1,200-mile belt from the Northwest Territories to North Dakota. It could develop into the hottest activity in North America. Graphs and tables summarize the data.

  1. Refining and end use study of coal liquids I - pilot plant studies

    Energy Technology Data Exchange (ETDEWEB)

    Erwin, J.; Moulton, D.S.

    1995-12-31

    The Office of Fossil Energy, Pittsburgh Energy Technology Center is examining the ways in which coal liquids may best be integrated into the refinery of the 2000-2015 time frame and what performance and emission properties will prevail among the slate of fuels produced. The study consists of a Basic Program administered by Bechtel Group, Inc. to build a linear programming refinery model and provide processing and fuel properties data through subcontractors Southwest Research Institute, Amoco Oil R&D, and M.W. Kellogg Company. The model will be used in an Option 1 to devise a slate of test fuels meeting advanced specifications, which will be produced and tested for physical ASTM-type properties, engine performance, and vehicle emissions. Three coal liquids will be included: a direct liquid from bituminous coal, another from subbituminous, and a Fischer-Tropsch indirect liquefaction product. This paper reports the work to date on fractions of the first direct liquid including naphtha hydrotreating, heavy distillate hydrotreating, FCC of the heavy distillate hydrotreater products. Also reported are the first stages of work on the indirect liquefaction wax including feed preparation and FCC tests of blends with petroleum FCC feed.

  2. Radon exhalation from building materials for decorative use

    Energy Technology Data Exchange (ETDEWEB)

    Chen Jing, E-mail: jing.chen@hc-sc.gc.c [Radiation Protection Bureau, Health Canada, 775 Brookfield Road, Ottawa K1A 1C1 (Canada); Rahman, Naureen M.; Atiya, Ibrahim Abu [Radiation Protection Bureau, Health Canada, 775 Brookfield Road, Ottawa K1A 1C1 (Canada)

    2010-04-15

    Long-term exposure to radon increases the risk of developing lung cancer. There is considerable public concern about radon exhalation from building materials and the contribution to indoor radon levels. To address this concern, radon exhalation rates were determined for 53 different samples of drywall, tile and granite available on the Canadian market for interior home decoration. The radon exhalation rates ranged from non-detectable to 312 Bq m{sup -2} d{sup -1}. Slate tiles and granite slabs had relatively higher radon exhalation rates than other decorative materials, such as ceramic or porcelain tiles. The average radon exhalation rates were 30 Bq m{sup -2} d{sup -1} for slate tiles and 42 Bq m{sup -2} d{sup -1} for granite slabs of various types and origins. Analysis showed that even if an entire floor was covered with a material having a radon exhalation rate of 300 Bq m{sup -2} d{sup -1}, it would contribute only 18 Bq m{sup -3} to a tightly sealed house with an air exchange rate of 0.3 per hour. Generally speaking, building materials used in home decoration make no significant contribution to indoor radon for a house with adequate air exchange.

  3. Comportamiento hídrico de pizarras de techar

    Directory of Open Access Journals (Sweden)

    Ruiz de Argandoña, G.

    1990-12-01

    Full Text Available The hidric behaviour of two slaty rocks from the NW of Spain (phyllite of Rande —La Coruña— and slate of Luarca —Asturias— used as ornamental and roof slate is studied. An experimental methodology for proper interpretation of the hidric phenomena to which they can be subjected due to their particular use in the building industries is proposed. The results of the tests (swelling, slaking and wetting/drying cycles are related to the mineralogy and texture, as well as to some physical properties related to the water movement throughout the rocks (porosity, air permeability and water absorption.

    Se estudia el comportamiento hídrico de dos rocas pizarrosas del NW de España (filita de Rande —La Coruña— y pizarra de Luarca —Asturias—, utilizadas como pizarras ornamentales y de techar. Se propone una metodología experimental para una correcta interpretación de los fenómenos hídricos a que pueden estar sometidas por sus usos en la industria de la construcción. Los resultados de los ensayos (hinchamiento, desmoronamiento y ciclos humedad/sequedad se relacionan con la mineralogía y textura, así como con algunas propiedades físicas relacionadas con el movimiento del agua por el interior de las rocas (porosidad, permeabilidad al aire y absorción de agua.

  4. Substratum type affects recruitment and development of marine assemblages over artificial substrata: A case study in the Alboran Sea

    Science.gov (United States)

    Sempere-Valverde, Juan; Ostalé-Valriberas, Enrique; Farfán, Gonzalo M.; Espinosa, Free

    2018-05-01

    There are more than 27,000 harbours along coasts worldwide and construction is expected to increase. The development and application of new ecological engineering ideas, for both old and new structures, is now imperative in order to reduce perturbation on marine coastal biota and to avoid the spread of non-native species. In this study, the early benthic assessment of subtidal and intertidal communities is tracked on five artificial substrata differing in origin, roughness, and chemical composition: Oyster Sandstone, Limestone, Gabbro, Slate and Concrete. Within substrata, Sandstone was the roughest on a 1-2 mm scale. Also, Sandstone and Limestone had predominantly calcareous composition while silicon was abundant in Concrete, Gabbro and Slate. In the intertidal zone, results showed that primary productivity and diatom abundance markedly increased with substratum roughness. In the subtidal zone, species richness and diversity over experimental substrata were lower than in adjacent rocky reefs. Nonetheless, during the first year of colonization communities varied within the experimental substrata. Coverage was higher on Sandstone than Concrete and Gabbro, and species richness was higher on Sandstone than Limestone. The differences are related to intrinsic substratum-type characteristics and showed Limestone, Gabbro and Concrete hold relatively poor ecological benefits in the first phases of ecological succession. The results may help to promote future research in this field and to test different substrata combinations and heterogeneities, for more environmentally sustainable surfaces in design of coastal structures.

  5. Rethinking About Chronology Of Chichen Itza: By Thermoluminescence Dating Of Volcanic Glass.

    Science.gov (United States)

    Chung, H.; Gonzalez, P.; Ramirez, A.; Schaaf, P.; Lee, I.

    One of the most frequently recurring questions in archaeology concerns the age of the studied objects. To date, determining the chronology of the Puuc and Chichen Slate pottery of Chchen Itza, based on the stylistic change in the pottery, has been problematic. The Thermoluminescence method of dating pottery was applied to samples of Chichen Itza, Yucatan, Mexico, which contain volcanic glass as temper. They were analyzed using the fine grain technique. The radisotopes that contribute to the accumulate annual dose in ceramic samples (40K, 238U, 232Th) were determined by means of Energy Dispersive X-ray Spectroscopy and Neutron Activation Analysis technique, while the artificial irradiation of the samples was carried out using 90Sr source beta radiation. We obtained results indicating the following dates; 875 ± 88; 1055 ± 85; 1063 ± 47, 1154 ± 76; 1110 ± 53, 1132 ± 69, 1221 ± 30, 1532 ± 26. The results demonstrate a chronological order of dates. Most results are in accordance with the established dates of Chichen Itza. However, Puuc and Chichen Slate did not show differences of 200 years as previously proposed, and there is evidence of an earlier period than those two pottery periods. This necessitates a reconsideration of the chronology of Chichen Itza.

  6. Radiological Dose Calculations And Supplemental Dose Assessment Data For Neshap Compliance For SNL Nevada Facilities 1996.

    Energy Technology Data Exchange (ETDEWEB)

    None, None

    2017-05-01

    Operations of Sandia National Laboratories, Nevada (SNL/NV) at the Tonopah Test Range (TTR) resulted in no planned point radiological releases during 1996. Other releases from SNL/NV included diffuse transuranic sources consisting of the three Clean Slate sites. Air emissions from these sources result from wind resuspension of near-surface transuranic contaminated soil particulates. The total area of contamination has been estimated to exceed 20 million square meters. Soil contamination was documented in an aerial survey program in 1977 (EG&G 1979). Surface contamination levels were generally found to be below 400 pCi/g of combined plutonium-238, plutonium-239, plutonium-240, and americium-241 (i.e., transuranic) activity. Hot spot areas contain up to 43,000 pCi/g of transuranic activity. Recent measurements confirm the presence of significant levels of transuranic activity in the surface soil. An annual diffuse source term of 0.39 Ci of transuranic material was calculated for the cumulative release from all three Clean Slate sites. A maximally exposed individual dose of 1.1 mrem/yr at the TTR airport area was estimated based on the 1996 diffuse source release amounts and site-specific meteorological data. A population dose of 0.86 person-rem/yr was calculated for the local residents. Both dose values were attributable to inhalation of transuranic contaminated dust.

  7. Microsatellite marker-based genetic analysis of relatedness between commercial and heritage turkeys (Meleagris gallopavo).

    Science.gov (United States)

    Kamara, D; Gyenai, K B; Geng, T; Hammade, H; Smith, E J

    2007-01-01

    The turkey is second only to the chicken in importance as an agriculturally important poultry species. Unlike the chicken, however, genetic studies of the turkey continue to be limited. For example, to date, many genomic investigations have been conducted to characterize genetic relationships between commercial (CO) and non-CO chicken breeds, whereas the nature of the genetic relatedness between CO and heritage turkeys remains unknown. The objective of the current research was to use microsatellites to analyze the genetic relatedness between CO and heritage domestic turkeys including Narragansett, Bourbon Red, Blue Slate, Spanish Black, and Royal Palm. Primer pairs specific for 10 previously described turkey microsatellite markers were used. The phylogenetic analysis showed that the Blue Slate, Bourbon Red, and Narragansett were genetically closely related to the CO strain, with a Nei distance of 0.30, and the Royal Palm and Spanish Black were the least related to the CO strain, with Nei distances of 0.41 and 0.40, respectively. The present work provides a foundation for the basis of using heritage turkeys to genetically improve CO populations by introgression.

  8. Groundwater denitrification in two agricultural river catchments: influence of hydro-geological setting and aquifer geochemistry

    Science.gov (United States)

    McAleer, Eoin; Mellander, Per-Erik; Coxon, Catherine; Richards, Karl G.; Jahangir, Mohammad M. R.

    2015-04-01

    Identifying subsurface environments with a natural capacity for denitrification is important for improving agricultural management. At the catchment scale, a complex hierarchy of landscape, hydro-geological and physico-chemical characteristics combine to affect the distribution of groundwater nitrate (NO3-). This study was conducted along four instrumented hillslopes in two ca. 10km2 agricultural river catchments in Ireland, one dominated by arable and one by grassland agriculture. Both catchments are characterised by well drained soils, but have differing aquifer characteristics. The arable catchment is underlain by weathered Ordovician slate bedrock which is extensively fractured with depth. The grassland catchment is characterised by Devonian sandstone bedrock, exhibiting both lateral (from upslope to near stream) and vertical variations in permeability along each hillslope. The capacity for groundwater denitrification was assessed by examining the concentration and distribution patterns of N species (total nitrogen, nitrate, nitrite, ammonium), dissolved organic carbon (DOC), dissolved oxygen (DO) and redox potential (Eh) in monthly samples from shallow and deep groundwater piezometers (n=37). Additionally, the gaseous products of denitrification: nitrous oxide (N2O) and excess dinitrogen (excess N2) were measured seasonally using gas chromatography and membrane inlet mass spectroscopy, respectively. The slate catchment was characterised by uniformity, both laterally and vertically, in aquifer geochemistry and gaseous denitrification products. The four year spatial mean groundwater NO3--N concentration was 6.89 mg/l and exhibited low spatial and temporal variability (temporal SD: 1.19 mg/l, spatial SD: 1.185 mg/l). Elevated DO concentrations (mean: 9.75 mg/l) and positive Eh (mean: +176.5mV) at all sample horizons indicated a setting with little denitrification potential. This non-reducing environment was reflected in a low accumulation of denitrification

  9. Tonopah Test Range Air Monitoring: CY2012 Meteorological, Radiological, and Airborne Particulate Observations

    Energy Technology Data Exchange (ETDEWEB)

    Mizell, Steve A; Nikolich, George; Shadel, Craig; McCurdy, Greg; Miller, Julianne J

    2013-07-01

    In 1963, the Atomic Energy Commission (AEC), predecessor to the US Department of Energy (DOE), implemented Operation Roller Coaster on the Tonopah Test Range (TTR) and an adjacent area of the Nevada Test and Training Range (NTTR) (formerly the Nellis Air Force Range (NAFR)). Operation Roller Coaster consisted of four tests in which chemical explosions were detonated in the presence of nuclear devices to assess the dispersal of radionuclides and evaluate the effectiveness of storage structures to contain the ejected radionuclides. These tests resulted in dispersal of plutonium over the ground surface downwind of the test ground zero. Three tests, Clean Slate 1, 2, and 3, were conducted on the TTR in Cactus Flat; the fourth, Double Tracks, was conducted in Stonewall Flat on the NTTR. DOE is working to clean up and close all four sites. Substantial cleaned up has been accomplished at Double Tracks and Clean Slate 1. Cleanup of Clean Slate 2 and 3 is on the DOE planning horizon for some time in the next several years. The Desert Research Institute installed two monitoring stations, number 400 at the Sandia National Laboratories Range Operations Center and number 401 at Clean Slate 3, in 2008 and a third monitoring station, number 402 at Clean Slate 1, in 2011 to measure radiological, meteorological, and dust conditions. The primary objectives of the data collection and analysis effort are to (1) monitor the concentration of radiological parameters in dust particles suspended in air, (2) determine whether winds are re-distributing radionuclides or contaminated soil material, (3) evaluate the controlling meteorological conditions if wind transport is occurring, and (4) measure ancillary radiological, meteorological, and environmental parameters that might provide insight to the above assessments. The following observations are based on data collected during CY2012. The mean annual concentration of gross alpha and gross beta is highest at Station 400 and lowest at Station

  10. Regional and Detailed Survey for Radon Activities in Soil-Gas and Groundwater in the Okchon Zone, Korea

    Science.gov (United States)

    Je, H.-K.; Chon, H.-T.

    2012-04-01

    The Okchon zone in Korea provides a typical example of natural geological materials enriched in potentially toxic elements including uranium which is parent nuclide for radon gas. For the purpose of radon radioactivity risk assessment, making the map of radon risk grade from Okchon zone, regional and detailed field surveys were carried out during 3 years. The study area is located in the central part of Korea, called the Okchon zone (about 5,100 km2), which occur in a 80km wide, northeast-trending belt that extends across the Korean Peninsula. The Okchon zone is underlain by metasedimentary rocks of unknown age that are composed mainly of black slate, phyllite, shale, and limestone. The three research areas (defined as Boeun, Chungju, and Nonsan) for detailed survey were selected from the results of regional survey. Results of detailed radon survey indicated a wide range of radon activities for soil-gases (148-1,843 pCi/L) and ground waters (23-5,540 pCi/L). About 15 percent of soil-gas samples exceeded 1,000 pCi/L and 84 percent of ground water samples exceeded the MCL (maximum contaminant level) of drinking water, 300 pCi/L, which proposed by U.S. Environmental Protection Agency in 1999. For detailed survey, radon activities of soil-gas and ground water were classified as bedrock geology, based on 1/50,000 geological map and field research. For soil-gas measurements, mean values of radon activity from black slate-shale (789 pCi/L) were highest among the other base rocks. And for groundwater measurements, mean value of radon activities were decreased in the order of granite (1,345 pCi/L) > black shale-slate (915 pCi/L) > metasediments (617 pCi/L). Result of indoor radon measurement from detailed survey areas showed that about 50% of houses exceeded the indoor guideline, 4 pCi/L. For the radon risk assessment in indoor environment showed that probability of lung cancer risk from the houses located on the granite base rock (3.0×10-2) was highest among the other

  11. Early Cretaceous wedge extrusion in the Indo-Burma Range accretionary complex: implications for the Mesozoic subduction of Neotethys in SE Asia

    Science.gov (United States)

    Zhang, Ji'en; Xiao, Wenjiao; Windley, Brian F.; Cai, Fulong; Sein, Kyaing; Naing, Soe

    2017-06-01

    The Indo-Burma Range (IBR) of Myanmar, the eastern extension of the Yarlung-Tsangpo Neotethyan belt of Tibet in China, contains mélanges with serpentinite, greenschist facies basalt, chert, sericite schist, silty slate and unmetamorphosed Triassic sandstone, mudstone and siltstone interbedded with chert in the east, and farther north high-pressure blueschist and eclogite blocks in the Naga Hills mélange. Our detailed mapping of the Mindat and Magwe sections in the middle IBR revealed a major 18 km antiformal isocline in a mélange in which greenschist facies rocks in the core decrease in grade eastwards and westwards symmetrically `outwards' to lower grade sericite schist and silty slate, and at the margins to unmetamorphosed sediments, and these metamorphic rocks are structurally repeated in small-scale imbricated thrust stacks. In the Mindat section the lower western boundary of the isoclinal mélange is a thrust on which the metamorphic rocks have been transported over unmetamorphosed sediments of the Triassic Pane Chaung Group, and the upper eastern boundary is a normal fault. These relations demonstrate that the IBR metamorphic rocks were exhumed by wedge extrusion in a subduction-generated accretionary complex. Along strike to the north in the Naga Hills is a comparable isoclinal mélange in which central eclogite lenses are succeeded `outwards' by layers of glaucophane schist and glaucophanite, and to lower grade greenschist facies sericite schist and slate towards the margins. In the Natchaung area (from west to east) unmetamorphosed Triassic sediments overlie quartzites, sericite schists, actinolite schists and meta-volcanic amphibolites derived from MORB-type basalt, which are in fault contact with peridotite. Olivine in the peridotite has undulatory extinction suggesting deformation at 600-700 °C, similar to the peak temperature of the amphibolite; these relations suggest generation in a metamorphic sole. The amphibolites have U/Pb zircon ages of 119

  12. Master Environmental Plan: Fort Wingate Depot Activity, Gallup, New Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Biang, C.A.; Yuen, C.R.; Biang, R.P.; Antonopoulos, A.A.; Ditmars, J.D.

    1990-12-01

    The master environmental plan is based on an environmental assessment of the areas requiring environmental evaluation (AREEs) at Fort Wingate Depot Activity near Gallup, New Mexico. The Fort Wingate Depot Activity is slated for closure under the Base Closure and Realignment Act, Public Law 100--526. The MEP assesses the current status, describes additional data requirements, recommends actions for the sites, and establishes a priority order for actions. The plan was developed so that actions comply with hazardous waste and water quality regulations of the State of New Mexico and applicable federal regulations. It contains a brief history of the site, relevant geological and hydrological information, and a description of the current status for each AREE along with a discussion of the available site-specific data that pertain to existing or potential contamination and the impact on the environment. 35 refs., 27 figs., 23 tabs.

  13. The impacts of the export ban on Alaskan crude oil trade

    International Nuclear Information System (INIS)

    Farah, P.G.; Bausell, C.W.; Vogelsang, A.

    1990-01-01

    The authors investigated the petroleum markets impacts of lifting the ban on Alaska North Slope (ANS) crude oil exports. This paper reports on some aspects of this investigation. The economic analysis relied heavily on the modeling of the ANS crude trade conducted on behalf of GAO by the Energy Information Administration (EIA) using the Transportation and Refining of International Petroleum model (TRIP). In contrast to previous studies, this one suggests that transportation costs may not be the only major factor in the realignment of ANS crude trade in response to lifting the ban. The differences in the yields of ANS crude and various crudes used by refiners in Pacific Rim countries on the one hand, and the product demand slates of the US West Coast and the potential buyers of ANS crude in Pacific Rim may also figure prominently in determining the reallocation of ANS crude if exports are permitted

  14. The outlook for natural gas markets in the GRI baseline projection

    International Nuclear Information System (INIS)

    Holtberg, P.D.

    1990-01-01

    Gas Research Institute is an independent, not-for-profit organization that plans, manages, and develops financing for a cooperative research and development program for the mutual benefit of the natural gas industry and its customers. The research program consists of over 500 active research projects in natural gas supply and end use, and in gas industry operations, as well as related basic research. This paper summarizes the U.S. natural gas demand and supply outlook projected in a preliminary version of the 191 edition of the GRI Baseline Projection of U.S. Energy Supply and Demand. The projection used for this paper is from an early run of the GRI modeling structure. As such, it is subject to substantial revision before the Baseline Projection is finalized. The paper presents a projection of natural gas demand in the major end-use sectors and the slate of supply sources expected to meet that demand over the period from 1989 to 2010

  15. International Uranium Resources Evaluation Project (IUREP) orientation phase mission summary report: Thailand

    International Nuclear Information System (INIS)

    1985-01-01

    The IURBP Orientation Phase Mission assesses the Speculative Uranium Resources in Thailand to be within the range of 1 500 to 38 500 tonnes U. Geological environments which are considered by the Mission to be favourable for uranium occurrences include the following: sandstones of Jurassic to Triassic age; Tertiary sedimentary basins (northern Thailand); Tertiary sedimentary basins (southern Thailand); associated with fluorite deposits; granitic rocks; black shales and graphitic slates of the Palaeozoic; associated with sedimentary phosphate deposits; and associated with monazite sands. Physical conditions in Thailand, including a wet tropical climate, dense forest growth and rugged terrain in some areas and relative inaccessibility, make exploration difficult and costly. There is currently no ready accessibility to detailed topographic and geological maps and other basic data. This lack of availability is a severe constraint to systematic exploration. The lack of skilled personnel experienced in uranium studies and the low level of technical support is a serious hindrance to exploration in Thailand. (author)

  16. Implementation and the delicate question of context

    DEFF Research Database (Denmark)

    Vohnsen, Nina Holm

    This paper argues against classic views that portray implementation-gone-wrong as resulting from bad planning, resistance amongst front-staff ultimately charged with implementation, miscommunication, or stake-holder resistance. Rather it places the source of distortion inside the organization whe...... a competing frame of goals and values....... marked by various other projects, efforts, and goals that compete for implementers’ attention. The paper therefore argues that the main reason policies fail are the policy-makers’ tendency to project their sites of intervention as blank slates or ‘ground zeros’ on which they can ‘build’ from scratch...... wish nothing more than to implement it but that implementers are usually placed in complex bureaucratic set-ups which are already bursting with goals (such as other legislation, local directives, other projects, result-contracts, etc.) all of which rely on their compliance to be fulfilled...

  17. Goals in Nutrition Science 2015–2020

    KAUST Repository

    Allison, David B.

    2015-09-08

    With the definition of goals in Nutrition Science, we are taking a brave step and a leap of faith with regard to predicting the scope and direction of nutrition science over the next 5 years. The content of this editorial has been discussed, refined, and evaluated with great care by the Frontiers in Nutrition editorial board. We feel the topics described represent the key opportunities, but also the biggest challenges in our field. We took a clean-slate, bottom-up approach to identify and address these topics and present them in eight categories. For each category, the authors listed take responsibility, and deliberately therefore this document is a collection of thoughts from active minds, rather than a complete integration or consensus. At Frontiers in Nutrition, we are excited to develop and share a platform for this discussion. Healthy Nutrition for all – an ambition too important to be handled by detached interest groups.

  18. The impact of freeze-thawing on the friability of formed elemental sulfur

    Energy Technology Data Exchange (ETDEWEB)

    Clark, P.D.; Almond, P.

    1995-10-01

    Winter weather fluctuation tests were performed in a laboratory to determine the freeze-thaw effect on the particle size distribution and friability of sulfur samples of Polish Air Prills, Procor GX Granules, Petrosul, Sandvik Rotoform, and slate. Formed elemental sulfur is often stored outdoors and is subjected to temperature fluctuations which could potentially result in structural stress, particularly if the sulfur contained any moisture from rainwater or melting snow. Concern was expressed that sulfur stored under these conditions might have increased friability during shipping and handling. Results of stress level tests indicated that winter weather fluctuations did not effect the particle size distribution or friability of the samples. When sulfur samples were in contact with water for one month, there were was no significant change in overall friability. It was concluded that all premium product forms of solid elemental sulfur could be stored outdoors, even if subjected to freeze-thaw cycles. 4 tabs., 5 figs.

  19. Magnetotelluric Investigations of the Yellowstone Caldera: Understanding the Emplacement of Crustal Magma Bodies

    Science.gov (United States)

    Gurrola, R. M.; Neal, B. A.; Bennington, N. L.; Cronin, R.; Fry, B.; Hart, L.; Imamura, N.; Kelbert, A.; Bowles-martinez, E.; Miller, D. J.; Scholz, K. J.; Schultz, A.

    2017-12-01

    Wideband magnetotellurics (MT) presents an ideal method for imaging conductive shallow magma bodies associated with contemporary Yellowstone-Snake River Plain (YSRP) magmatism. Particularly, how do these magma bodies accumulate in the mid to upper crust underlying the Yellowstone Caldera, and furthermore, what role do hydrothermal fluids play in their ascent? During the summer 2017 field season, two field teams from Oregon State University and the University of Wisconsin-Madison installed forty-four wideband MT stations within and around the caldera, and using data slated for joint 3-D inversion with existing seismic data, two 2-D vertical conductivity sections of the crust and upper mantle were constructed. These models, in turn, provide preliminary insight into the emplacement of crustal magma bodies and hydrothermal processes in the YSRP region.

  20. JPRS Report, East Europe.

    Science.gov (United States)

    1990-03-07

    10.26 2.14 Total 81.60 240 Pork Roast 46.0 11.82 3.89 Side 20.0 8.0 2.50 Total 34.90 121 Chicken 30.0 49.40 5.33 5.63 165 Milk (1 liter) 3.10 7.80 - 2.54...34 roasted , meaning that they wanted to be nominated on JPRS-EER-90-028 7 March 1990 POLITICAL 15 slates. Well, what I’m saying is this: Let the lawyers go...wish to have a prosperous agriculture producing inexpensive food and capable of competing on theAgriculture 1.605 world market, we need a recipe as

  1. The Role of Personality Features on in Information- seeking Bahavior of Graduate Students at University of Tehran (2006-2007

    Directory of Open Access Journals (Sweden)

    Mahmood Khowsrojerdi

    2009-04-01

    Full Text Available The present study attempts to investigate the nature of information seeking behavior in the sample population of 158 graduate students and examine the role of personality factors in their information seeking behavior. Two questionnaires were used. Pearson correlation analysis and multi-valued regression analysis were employed in analyzing the data. Findings indicate that there is a positive significance between students’ extroversion and relevance judgment, positing of new ideas, time as a motivating factor, and effort to seek out information. A similar indication was observed between interpolation of experience and time slated for searching for information. Generally it could be deduced that there is a significant relationship between personality features and information seeking behavior of graduate students.

  2. Office of Technology Development Program for Research, Development, Demonstration, Testing, and Evaluation. FY 1993 Program Summary

    Energy Technology Data Exchange (ETDEWEB)

    1993-10-01

    DOE has set a goal to clean up its complex and to bring all sites into compliance with applicable environmental regulations. This initiative is slated for completion by the year 2019. Four years ago there was no coordinated plan for identifying or cleaning these contaminated sites. Since 1989, DOE`s Office of Environmental Restoration and Waste Management has invested time, money, and manpower to establish a wide range of programs to meet this immense challenge. DOE is responsible for waste management and clean up of more than 100 contaminated installations in 36 states and territories. This includes 3,700 sites: over 26,000 acres, with hazardous or radioactive contaminated surface or groundwater, soil, or structures; over 26,000 acres requiring remediation, with the number growing as new sites are defined; 500 surplus facilities awaiting decontamination and decommissioning and approximately 5,000 peripheral properties (residences, businesses) that have soil contaminated with uranium tailings.

  3. Atomic mineral resources and geotectonics of it's deposits in South Korea

    International Nuclear Information System (INIS)

    Shin, B.W.

    1981-01-01

    The necessity of nuclear power in the electric generation is increased yearly in the oil-importing nations. Accordingly it is very important and essential to investigate and develop the uranium resources in Korea. Prospecting of the uranium deposits in south Korea was started in 1960 and for twenty years, the survey of Kangneum, Chungnam and Honam coal fields, Kapyong-Chuncheon metamorphis zone and Taejeon, Boeon-Hwenam caboni-ferous slate have been made. I have studied the geologic structure, mainly the lineaments of Okcheon, Kwesan and Kapyong uranium deposits. The lieaments are not related to uranium reserves and grade but important to exploration. In future it is also necessary to study the thorium, heavy sand deposits and to determine the feasibility for developments. (Author)

  4. Worries mount over ability to finance pipeline nukes

    International Nuclear Information System (INIS)

    Utroska, D.

    1985-01-01

    Concerns over financing the 31 nuclear power plants now in the construction pipeline lead some analysts to question whether plants not already slated for cancellation will be able to survive the increasingly risky investment climate. Any accident or utility default could weaken marginally healthy utilities to the point of default on construction bonds. Junk bonds that spread the percentage points of interest rates are competing in the market with those of other businesses. Regulatory decisions that protect ratepayers increase the risk to investors. The industry needs about $40 billion to finish the plants now in the pipeline, and much of the capital must come from internal generation. Adding to the risk are challenges to emergency and safety procedures, but optimistic analysts feel the market for high risk/high return securities has not reached saturation. One problem is the lack of standardization in calculating the estimated costs of completion versus abandonment. 3 tables

  5. Economic viability of photovoltaic power for development assistance applications

    Science.gov (United States)

    Bifano, W. J.

    1982-01-01

    This paper briefly discusses the development assistance market and examines a number of specific photovoltaic (PV) development assistance field tests, including water pumping/grain grinding (Tangaye, Upper Volta), vaccine refrigerators slated for deployment in 24 countries, rural medical centers to be installed in Ecuador, Guyana, Kenya and Zimbabwe, and remote earth stations to be deployed in the near future. A comparison of levelized energy cost for diesel generators and PV systems covering a range of annual energy consumptions is also included. The analysis does not consider potential societal, environmental or political benefits associated with PV power. PV systems are shown to be competitive with diesel generators, based on life cycle cost considerations, assuming a system price of $20/W(peak), for applications having an annual energy demand of up to 6000 kilowatt-hours per year.

  6. The United States foreign research reactor spent nuclear fuel acceptance program: Proposal to modify the program

    International Nuclear Information System (INIS)

    Messick, C.E.

    2005-01-01

    The United States Department of Energy (DOE), in consultation with the Department of State (DOS), adopted the Nuclear Weapons Nonproliferation Policy Concerning Foreign Research Reactor Spent Nuclear Fuel in May 1996. The policy was slated to expire in May 2009. However, in October 2003, a petition requesting a program extension was delivered to the United States Secretary of Energy from a group of research reactor operators from foreign countries. In April 2004, the Secretary directed DOE undertake an analysis, as required by the National Environmental Policy Act (NEPA), to consider potential extension of the Program. On December 1, 2004, a Federal Register Notice was issued approving the program extension. This paper discusses the findings from the NEPA analysis and the potential changes in the program that may result from implementation of the proposed changes. (author)

  7. Integrating the 3Ds—Social Determinants, Health Disparities, and Health-Care Workforce Diversity

    Science.gov (United States)

    Pierre, Geraldine

    2014-01-01

    The established relationships among social determinants of health (SDH), health disparities, and race/ethnicity highlight the need for health-care professionals to adequately address SDH in their encounters with patients. The ethnic demographic transition slated to occur during the next several decades in the United States will have numerous effects on the health-care sector, particularly as it pertains to the need for a more diverse and culturally aware workforce. In recent years, a substantial body of literature has developed, exploring the extent to which diversity in the health-care workforce may be used as a tool to eliminate racial/ethnic disparities in health and health care in the U.S. We explore existing literature on this topic, propose a conceptual framework, and identify next steps in health-care policy for reducing and eliminating health disparities by addressing SDH and diversification of the health-care workforce. PMID:24385659

  8. Integrating the 3Ds--social determinants, health disparities, and health-care workforce diversity.

    Science.gov (United States)

    LaVeist, Thomas A; Pierre, Geraldine

    2014-01-01

    The established relationships among social determinants of health (SDH), health disparities, and race/ethnicity highlight the need for health-care professionals to adequately address SDH in their encounters with patients. The ethnic demographic transition slated to occur during the next several decades in the United States will have numerous effects on the health-care sector, particularly as it pertains to the need for a more diverse and culturally aware workforce. In recent years, a substantial body of literature has developed, exploring the extent to which diversity in the health-care workforce may be used as a tool to eliminate racial/ethnic disparities in health and health care in the U.S. We explore existing literature on this topic, propose a conceptual framework, and identify next steps in health-care policy for reducing and eliminating health disparities by addressing SDH and diversification of the health-care workforce.

  9. A technician from NASDA test the real-time radiation monitoring device on SPACEHAB in preparation fo

    Science.gov (United States)

    1997-01-01

    A technician from the National Space Development Agency of Japan (NASDA) tests the real-time radiation monitoring device on SPACEHAB at Kennedy Space Center in preparation for the STS-89 mission, slated to be the first Shuttle launch of 1998. STS-89 will be the eighth of nine scheduled Mir dockings and will include a double module of SPACEHAB, used mainly as a large pressurized cargo container for science, logistical equipment and supplies to be exchanged between the orbiter Endeavour and the Russian Space Station Mir. The nine-day flight of STS-89 also is scheduled to include the transfer of the seventh American to live and work aboard the Russian orbiting outpost. Liftoff of Endeavour and its seven-member crew is targeted for Jan. 15, 1998, at 1:03 a.m. EDT from Launch Pad 39A.

  10. NASDA technician test real-time radiation monitoring device

    Science.gov (United States)

    1997-01-01

    A technician from the National Space Development Agency of Japan (NASDA) tests the real-time radiation monitoring device on SPACEHAB at Kennedy Space Center in preparation for the STS-89 mission, slated to be the first Shuttle launch of 1998. STS-89 will be the eighth of nine scheduled Mir dockings and will include a double module of SPACEHAB, used mainly as a large pressurized cargo container for science, logistical equipment and supplies to be exchanged between the orbiter Endeavour and the Russian Space Station Mir. The nine-day flight of STS-89 also is scheduled to include the transfer of the seventh American to live and work aboard the Russian orbiting outpost. Liftoff of Endeavour and its seven-member crew is targeted for Jan. 15, 1998, at 1:03 a.m. EDT from Launch Pad 39A.

  11. Global demand for rare earth resources and strategies for green mining

    Energy Technology Data Exchange (ETDEWEB)

    Dutta, Tanushree [Department of Civil & Environmental Engineering, Hanyang University, 222 Wangsimni-Ro, Seoul 04763 (Korea, Republic of); Kim, Ki-Hyun, E-mail: kkim61@hanyang.ac.kr [Department of Civil & Environmental Engineering, Hanyang University, 222 Wangsimni-Ro, Seoul 04763 (Korea, Republic of); Uchimiya, Minori [USDA-ARS Southern Regional Research Center, 1100 Robert E. Lee Boulevard, New Orleans, LA 70124 (United States); Kwon, Eilhann E. [Department of Environment and Energy, Sejong University, Seoul 05006 (Korea, Republic of); Jeon, Byong-Hun [Department of Natural Resources & Environmental Engineering, Hanyang University, 222 Wangsimni-Ro, Seoul 04763 (Korea, Republic of); Deep, Akash [Central Scientific Instruments Organisation (CSIR-CSIO), Sector 30C, Chandigarh 160030 (India); Yun, Seong-Taek [Department of Earth and Environmental Sciences and KU-KIST Green School, Korea University, Seoul 02841 (Korea, Republic of)

    2016-10-15

    Rare earth elements (REEs) are essential raw materials for emerging renewable energy resources and ‘smart’ electronic devices. Global REE demand is slated to grow at an annual rate of 5% by 2020. This high growth rate will require a steady supply base of REEs in the long run. At present, China is responsible for 85% of global rare earth oxide (REO) production. To overcome this monopolistic supply situation, new strategies and investments are necessary to satisfy domestic supply demands. Concurrently, environmental, economic, and social problems arising from REE mining must be addressed. There is an urgent need to develop efficient REE recycling techniques from end-of-life products, technologies to minimize the amount of REEs required per unit device, and methods to recover them from fly ash or fossil fuel-burning wastes.

  12. Office of Technology Development Program for Research, Development, Demonstration, Testing, and Evaluation

    International Nuclear Information System (INIS)

    1993-10-01

    DOE has set a goal to clean up its complex and to bring all sites into compliance with applicable environmental regulations. This initiative is slated for completion by the year 2019. Four years ago there was no coordinated plan for identifying or cleaning these contaminated sites. Since 1989, DOE's Office of Environmental Restoration and Waste Management has invested time, money, and manpower to establish a wide range of programs to meet this immense challenge. DOE is responsible for waste management and clean up of more than 100 contaminated installations in 36 states and territories. This includes 3,700 sites: over 26,000 acres, with hazardous or radioactive contaminated surface or groundwater, soil, or structures; over 26,000 acres requiring remediation, with the number growing as new sites are defined; 500 surplus facilities awaiting decontamination and decommissioning and approximately 5,000 peripheral properties (residences, businesses) that have soil contaminated with uranium tailings

  13. New Mexico waste plant sits idle amid controversy

    International Nuclear Information System (INIS)

    Lovejoy, L.A. Jr.

    1994-01-01

    The Department of Energy (DOE) hopes to permanently dispose of radioactive waste from its weapons program at a Waste Isolation Pilot Plant about 26 miles from Carlsbad, New Mexico. The plant has been plagued by problems, according to Lindsay A. Lovejoy, Jr., an assistant attorney general of New Mexico. Among them are cracks in the walls of some of the underground rooms slated for storage of radioactive waste. Meanwhile, above-ground problems involve DOE's struggle toward regulatory compliance. The Environmental Protection Agency (EPA), under the Resource Conservation Recovery Act, has assumed a regulatory role over DOE's radioactive waste-disposal efforts, which is a new role for the agency. Lovejoy proposes that EPA, in its regulation of the New Mexico plant, develop compliance criteria and involve DOE and the public in ongoing open-quotes dialogue aimed at ferreting out any and all problems before a single scrap of radioactive waste is deposited into the earth beneath new Mexico.close quotes

  14. Guatemala: World Oil Report 1991

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    This paper reports that government officials have been working on changes to the hydrocarbon law to make it easier for operators to explore. In a reform effort, Minister of Energy and Mines Carlos Hutarte brought a new staff dedicated to spurring oil development into office with him. This includes the Directorate of Hydrocarbons, which held a three-day seminar in Dallas, Texas, to acquaint U.S. firms with new policies. Only one company, Basic Resources International, has been operating in Guatemala over the last year. The firm drilled three onshore wells in 1990 for 16,499 ft, including one oil producer. Two further onshore wells are slated this year. Oil production from 14 active wells out of 16 capable averaged 3,943 bpd, up 8.4% from 1989. Reserves are 191 MMbbl

  15. A Review of Methods for the Manufacture of Residential Roofing Materials

    Energy Technology Data Exchange (ETDEWEB)

    Akbari, Hashem; Levinson, Ronnen; Berdahl, Paul

    2003-06-01

    Shingles, tiles, and metal products comprise over 80% (by roof area) of the California roofing market (54-58% fiberglass shingle, 8-10% concrete tile, 8-10% clay tile, 7% metal, 3% wood shake, and 3% slate). In climates with significant demand for cooling energy, increasing roof solar reflectance reduces energy consumption in mechanically cooled buildings, and improves occupant comfort in non-conditioned buildings. This report examines methods for manufacturing fiberglass shingles, concrete tiles, clay tiles, and metal roofing. The report also discusses innovative methods for increasing the solar reflectance of these roofing materials. We have focused on these four roofing products because they are typically colored with pigmented coatings or additives. A better understanding of the current practices for manufacturing colored roofing materials would allow us to develop cool colored materials creatively and more effectively.

  16. Average contents of uranium and thorium in the most important types of rocks of the Ukrainian shield

    International Nuclear Information System (INIS)

    Belevtsev, Ya.N.; Egorov, Yu.P.; Titov, V.K.; Sukhinin, A.M.; Grechishnikova, Z. M.; Zayats, V.B.; Tikhonenko, V.A.; Zhukova, A.M.

    1975-01-01

    The data given concern uranium and thorium contents in the most important rock types of the Ukraina shield. The smallest quantities of uranium are characteristic for the vulcanic rocks of basic and ultrabasic rocks. Archean formations, whose source materials were mainly basic and ultrabasic vulcanites, are marked by this low uranium content. The highest uranium content is observed in the clastogenic rocks of low Proterozoic. The average uranium content is observed in silty argellite rocks represented by crystal slates and paragneissis. Rheomorphic and metasomatic granites and granosyenites of low and middle Proterozoic are also characterized by an increased content of uranium. The platform precipitation rocks of high Proterozoic possess a relatively low uranium content. Thorium concentrations with low thorium-uranium proportions in granites, syenites and granosyenites prove their enrichment in uranium

  17. Terahertz lens made out of natural stone.

    Science.gov (United States)

    Han, Daehoon; Lee, Kanghee; Lim, Jongseok; Hong, Sei Sun; Kim, Young Kie; Ahn, Jaewook

    2013-12-20

    Terahertz (THz) time-domain spectroscopy probes the optical properties of naturally occurring solid aggregates of minerals, or stones, in the THz frequency range. Refractive index and extinction coefficient measurement reveals that most natural stones, including mudstone, sandstone, granite, tuff, gneiss, diorite, slate, marble, and dolomite, are fairly transparent for THz frequency waves. Dolomite in particular exhibits a nearly uniform refractive index of 2.7 over the broad frequency range from 0.1 to 1 THz. The high index of refraction allows flexibility in lens designing with a shorter accessible focal length or a thinner lens with a given focal length. Good agreement between the experiment and calculation for the THz beam profile confirms that dolomite has high homogeneity as a lens material, suggesting the possibility of using natural stones for THz optical elements.

  18. The role of globalization in drug development and access to orphan drugs: orphan drug legislation in the US/EU and in Latin America.

    Science.gov (United States)

    Arnold, Renée J G; Bighash, Lida; Bryón Nieto, Alejandro; Tannus Branco de Araújo, Gabriela; Gay-Molina, Juan Gabriel; Augustovski, Federico

    2015-01-01

    Compared to a decade ago, nearly three times as many drugs for rare diseases are slated for development. This article addresses the market access issues associated with orphan drug status in Europe and the United States in contrast to the legislation in five Latin American (LA) countries that have made strides in this regard--Mexico, Brazil, Colombia, Chile and Argentina. Based on the success of orphan drug legislation in the EU and US, LA countries should strive to adopt similar strategies with regard to rare diseases and drug development. With the implementation of new targeted regulations, reimbursement strategies, and drug approvals, accessibility to treatment will be improved for people afflicted with rare diseases in these developing countries.

  19. Site characterization report for Building 3515 at Oak Ridge National Laboratory, Oak Ridge, Tennessee. Environmental Restoration Program

    International Nuclear Information System (INIS)

    1994-08-01

    Building 3515 at Oak Ridge National Laboratory (ORNL), also known as the Fission Product Pilot Plant, is a surplus facility in the main plant area to the east of the South Tank Farm slated for decontamination and decommissioning (D ampersand D). The building consists of two concrete cells (north and south) on a concrete pad and was used to extract radioisotopes of ruthenium, strontium, cesium, cerium, rhenium and other elements from aqueous fission product waste. Site characterization activities of the building were initiated. The objective of the site characterization was to provide information necessary for engineering evaluation and planning of D ampersand D approaches, planning for personal protection of D ampersand D workers, and estimating waste volumes from D ampersand D activities. This site characterization report documents the investigation with a site description, a summary of characterization methods, chemical and radiological sample analysis results, field measurement results, and waste volume estimates

  20. The Rosslyn Code: Can Physics Explain a 500-Year Old Melody Etched in the Walls of a Scottish Chapel?

    Energy Technology Data Exchange (ETDEWEB)

    Wilson, Chris [State Magazine

    2011-10-19

    For centuries, historians have puzzled over a series of 213 symbols carved into the stone of Scotland’s Rosslyn Chapel. (Disclaimer: You may recognize this chapel from The Da Vinci Code, but this is real and unrelated!) Several years ago, a composer and science enthusiast noticed that the symbols bore a striking similarity to Chladni patterns, the elegant images that form on a two- dimensional surface when it vibrates at certain frequencies. This man’s theory: A 500-year-old melody was inscribed in the chapel using the language of physics. But not everyone is convinced. Slate senior editor Chris Wilson travelled to Scotland to investigate the claims and listen to this mysterious melody, whatever it is. Come find out what he discovered, including images of the patterns and audio of the music they inspired.

  1. Development of natural gas vehicles in China

    Energy Technology Data Exchange (ETDEWEB)

    Zongmin, Cheng

    1996-12-31

    Past decade and current status of development of natural gas vehicles (NGVs) in China is described. By the end of 1995, 35 CNG refueling stations and 9 LPG refueling stations had been constructed in 12 regions, and 33,100 vehicles had been converted to run on CNG or LPG. China`s automobile industry, a mainstay of the national economy, is slated for accelerated development over next few years. NGVs will help to solve the problems of environment protection, GHGs mitigation, and shortage of oil supply. The Chinese government has started to promote the development of NGVs. Projects, investment demand, GHG mitigation potential, and development barriers are discussed. China needs to import advanced foreign technologies of CNGs. China`s companies expect to cooperate with foreign partners for import of CNG vehicle refueling compressors, conversions, and light cylinders, etc.

  2. The Stability of Metasedimentary Rock in Ranau, Sabah, Malaysia

    Directory of Open Access Journals (Sweden)

    Ismail Abd Rahim

    2018-01-01

    Full Text Available DOI: 10.17014/ijog.5.1.23-31The aim of this paper is to determine the stability of slopes and to propose preliminary rock cut slope protection and stabilization measures for Paleocene to Middle Eocene Trusmadi Formation along Marakau-Kigiok in Ranau, Sabah, Malaysia. The rock of Trusmadi Formation is slightly metamorphosed and dominated by interbeds of sandstone with quartz vein (metagreywacke, metamudstone, shale, slate, sheared sandstone, and mudstone. The rock unit can be divided into four geotechnical units namely arenaceous unit, argillaceous unit, interbedded unit, and sheared unit. Twelve slopes were selected for this study. Geological mapping, discontinuity survey, kinematic analysis, and prescriptive measure were used in this study. Results of this study conclude that the potential modes of failures are planar and wedge. Terrace, surface drainage, weep holes, horizontal drain, vegetation cover, wire mesh, slope reprofiling, and retaining structure were proposed protection and stabilization measures for the slopes in the studied area.

  3. State of the art and future perspectives of thermophilic anaerobic digestion

    DEFF Research Database (Denmark)

    Ahring, Birgitte Kiær; Mladenovska, Zuzana; Iranpour, R.

    2002-01-01

    The slate of the art of thermophilic digestion is discussed. Thermophilic digestion is a well established technology in Europe for treatment of mixtures of waste in common large scale biogas plants or for treatment of the organic fraction of municipal solid waste. Due to a large number of failures...... over time with thermophilic digestion of sewage sludge this process has lost its appeal in the USA. New demands on sanitation of biosolids before land use will, however, bring the attention back to the use of elevated temperatures during sludge stabilization. In the paper we show how the use of a start......-up strategy based on the actual activity of key microbes can be used to ensure proper and fast transfer of mesophilic digesters into thermophilic operation. Extreme thermophilic temperatures of 65degreesC or more may be necessary in the future to meet the demands for full sanitation of the waste material...

  4. A Review of Introducing Issues with Opposing Viewpoints: Animal Rights. By Lauri S. Friedman. Greenhaven Press: Farmington Hills, MI, USA, 2010; Hardcover, 144 pp; Price: $33.58; ISBN: 978-0737749373

    Directory of Open Access Journals (Sweden)

    Lee J. Markowitz

    2011-07-01

    Full Text Available Given the volatile nature of animal rights issues and the extensive array of writings on the topic, one might expect several introductory anthologies to be available. The only anthologies in print, however, are scholarly tomes (listed below geared towards more advanced readers. Fortunately, Lauri S. Friedman, author of dozens of anthologies on controversial topics such as gun control, national security, terrorism, fast food, sexually transmitted diseases, and many other topics, fills this void well with her volume titled Introducing Issues with Opposing Viewpoints: Animal Rights. She has included articles by influential authors in a diverse range of lay outlets such as The Wall Street Journal, Slate, Guardian, Christianity Today, Food & Wine, among others. Below, I describe the contents of the book, its strengths and weaknesses, and how educators might use the book in classroom settings.

  5. Materials for construction and civil engineering science, processing, and design

    CERN Document Server

    Margarido, Fernanda

    2015-01-01

    This expansive volume presents the essential topics related to construction materials composition and their practical application in structures and civil installations. The book's diverse slate of expert authors assemble invaluable case examples and performance data on the most important groups of materials used in construction, highlighting aspects such as nomenclature, the properties, the manufacturing processes, the selection criteria, the products/applications, the life cycle and recyclability, and the normalization. Civil Engineering Materials: Science, Processing, and Design is ideal for practicing architects; civil, construction, and structural engineers, and serves as a comprehensive reference for students of these disciplines. This book also: ·       Provides a substantial and detailed overview of traditional materials used in structures and civil infrastructure ·       Discusses properties of natural and synthetic materials in construction and materials' manufacturing processes ·  �...

  6. On the structure of quantal proposition systems

    Science.gov (United States)

    Bub, Jeffrey

    1994-09-01

    I define sublaltices of quantum propositions that can be taken as having determinate (but perhaps unknown) truth values for a given quantum state, in the sense that sufficiently many two-valued maps satisfying a Boolean homomorphism condition exist on each determinate sublattice to generate a Kolmogorov probability space for the probabilities defined by the slate. I show that these sublattices are maximal, subject to certain constraints, from which it follows easily that they are unique. I discuss the relevance of this result for the measurement problem, relating it to an early proposal by Jauch and Piron for defining a new notion of state for quantum systems, to a recent uniqueness proof by Clifton for the sublattice of propositions specified as determinate by modal interpretations of quantum mechanics that exploit the polar decompostion theorem, and to my own previous suggestions for interpreting quantum mechanics without the projection postulate.

  7. Stuck in the moment: Cognitive inflexibility in preschoolers following an extended time period.

    Directory of Open Access Journals (Sweden)

    Carolina eGarcia

    2013-12-01

    Full Text Available Preschoolers display surprising inflexibility in problem solving, but seem to approach new challenges with a fresh slate. We provide evidence that while the former is true the latter is not. Here, we examined whether brief exposure to stimuli can influence children’s problem solving following several weeks after first exposure to the stimuli. We administered a common executive function task, the Dimensional Change Card Sort, which requires children to sort picture cards by one dimension (e.g., color and then switch to sort the same cards by a conflicting dimension (e.g., shape. After a week or after a month delay, we administered the second rule again. We found that 70% of preschoolers continued to sort by the initial sorting rule, even after a month delay, and even though they are explicitly told what to do. We discuss implications for theories of executive function development, and for classroom learning.

  8. Revisiting Utopia: How a Legacy of Idealistic Plans Resonates with Christchurch’s Rebuild

    Directory of Open Access Journals (Sweden)

    Jacky Bowring

    2015-11-01

    Full Text Available Imagined landscapes find their form in utopian dreaming. As ideal places, utopias are set up according to the ideals of their designers. Inevitably, utopias become compromised when they move from the imaginary into the actual. Opportunities to create utopias rely largely on a blank slate, a landscape unimpeded by the inconveniences of existing occupation – or even topography. Christchurch has seen two utopian moments. The first was at the time of European settlement in the mid-nineteenth century, when imported ideals provided a model for a new city. The earthquakes of 2010 and 2011 provided a second point at which utopian dreaming spurred visions for the city. Christchurch’s earthquakes have provided a unique opportunity for a city to re-imagine itself. Yet, as is the fate for all imaginary places, reality got in the way.

  9. Eliminating the Neglected Tropical Diseases: Translational Science and New Technologies.

    Directory of Open Access Journals (Sweden)

    Peter J Hotez

    2016-03-01

    Full Text Available Today, the World Health Organization recognizes 17 major parasitic and related infections as the neglected tropical diseases (NTDs. Despite recent gains in the understanding of the nature and prevalence of NTDs, as well as successes in recent scaled-up preventive chemotherapy strategies and other health interventions, the NTDs continue to rank among the world's greatest global health problems. For virtually all of the NTDs (including those slated for elimination under the auspices of a 2012 London Declaration for NTDs and a 2013 World Health Assembly resolution [WHA 66.12], additional control mechanisms and tools are needed, including new NTD drugs, vaccines, diagnostics, and vector control agents and strategies. Elimination will not be possible without these new tools. Here we summarize some of the key challenges in translational science to develop and introduce these new technologies in order to ensure success in global NTD elimination efforts.

  10. Dicty_cDB: FC-AI17 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available FC (Link to library) FC-AI17 (Link to dictyBase) - - - Contig-U15690-1 FC-AI17P (Li...nk to Original site) FC-AI17F 587 FC-AI17Z 626 FC-AI17P 1212 - - Show FC-AI17 Library FC (Link to library) Clone ID FC-AI...nal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI17Q.Seq.d/ Representative seq. ID FC-AI...17P (Link to Original site) Representative DNA sequence >FC-AI17 (FC-AI17Q) /CSM/FC/FC-AI/FC-AI...slated Amino Acid sequence ANIATVGDFLKADTVVPKMIITYNKRKQGTDYLKAVIGPILSNVIKQELNLELKPNLVYA AIISEQEIRTGEKSTLDRNV

  11. Optimal Strategies for Probing Terrestrial Exoplanet Atmospheres with JWST

    Science.gov (United States)

    Batalha, Natasha E.; Lewis, Nikole K.; Line, Michael

    2018-01-01

    It is imperative that the exoplanet community determines the feasibility and the resources needed to yield high fidelity atmospheric compositions from terrestrial exoplanets. In particular, LHS 1140b and the TRAPPIST-1 system, already slated for observations by JWST’s Guaranteed Time Observers, will be the first two terrestrial planets observed by JWST. I will discuss optimal observing strategies for observing these two systems, focusing on the NIRSpec Prism (1-5μm) and the combination of NIRISS SOSS (1-2.7μm) and NIRSpec G395H (3-5μm). I will also introduce currently unsupported JWST readmodes that have the potential to greatly increase the precision on our atmospheric spectra. Lastly, I will use information content theory to compute the expected confidence interval on the retrieved abundances of key molecular species and temperature profiles as a function of JWST observing cycles.

  12. The radioactive waste management and disposal program in France

    International Nuclear Information System (INIS)

    Jacq, F.

    2001-01-01

    The bill voted in 1991 provides a framework, up to the year 2006, for all researches conducted in France on the management of high-level and long-lived radioactive wastes. Three complementary directions are explored in the intervening period, including geological disposal. The law sets the conditions for the studies and researches, particularly the necessary reliance on experiments in underground laboratories. In August 1999, the government authorized Andra to build a first laboratory, in the clay formation at the boundary of the Meuse and Haute-Marne departments, an operation that is under way today. A second laboratory is also slated, in a granitic formation, on a site remaining to be determined. When the 2006 deadline arrives, a debate will be organized in the French Parliament. The present article discusses the researches conducted in connection with the feasibility study of disposal in a deep geological formation, and highlights the complementarity between the different research directions. (author)

  13. Nuclear fusion: The issues

    International Nuclear Information System (INIS)

    Griffin, R.D.

    1993-01-01

    The taming of fusion energy, has proved one of the most elusive quests of modern science. For four decades, the United States has doggedly pursued energy's holy grail, pumping more than $9 billion into research and reactor prototypes. This year, the federal government is slated to spend $339 million on fusion, more than the combined amount the government will spend for research on oil, natural gas, solar power, wind power, geothermal energy, biofuels and conservation. This article summarizes the technical, political in terms of international cooperation, economic, planning, etc. issues surrounding the continued development of fusion as a possible power source for the next century. Brief descriptions of how fusion works and of the design of a tokamak fusion machine are included

  14. KSC-04PD-2689

    Science.gov (United States)

    2004-01-01

    KENNEDY SPACE CENTER, FLA. A shipping container housing part of the new Orbiter Boom Sensor System (OBSS) is lifted from a truck into the Remote Manipulator System lab in the Vehicle Assembly Building (VAB). Once the entire structure has arrived, the OBSS will be assembled and undergo final checkout and testing in the lab prior to being transferred to the Orbiter Processing Facility (OPF) for installation on Space Shuttle Discovery. The 50-foot- long OBSS will be attached to the Remote Manipulator System, or Shuttle arm, and is one of the new safety measures for Return to Flight, equipping the orbiter with cameras and laser systems to inspect the Shuttle's Thermal Protection System while in space. Discovery is slated to fly mission STS-114 once Space Shuttle launches resume. The launch planning window is May 12 to June 3, 2005.

  15. KSC-04PD-2687

    Science.gov (United States)

    2004-01-01

    KENNEDY SPACE CENTER, FLA. A shipping container transporting part of the new Orbiter Boom Sensor System (OBSS) is delivered by truck to the Remote Manipulator System lab in the Vehicle Assembly Building (VAB). Once the entire structure has arrived, the OBSS will be assembled and undergo final checkout and testing in the lab prior to being transferred to the Orbiter Processing Facility (OPF) for installation on Space Shuttle Discovery. The 50-foot-long OBSS will be attached to the Remote Manipulator System, or Shuttle arm, and is one of the new safety measures for Return to Flight, equipping the orbiter with cameras and laser systems to inspect the Shuttle's Thermal Protection System while in space. Discovery is slated to fly mission STS-114 once Space Shuttle launches resume. The launch planning window is May 12 to June 3, 2005.

  16. Strength and rupture-life transitions caused by secondary carbide precipitation in HT-9 during high-temperature low-rate mechanical testing

    International Nuclear Information System (INIS)

    DiMelfi, R.J.; Gruber, E.E.; Kramer, J.M.; Hughes, T.H.

    1992-01-01

    The martensitic-ferritic alloy HT-9 is slated for long-term use as a fuel-cladding material in the Integral Fast Reactor. Analysis of published high-temperature mechanical property data suggests that secondary carbide precipitation would occur during service life causing substantial strengthening of the as-heat-treated material. Aspects of the kinetics of this precipitation process are extracted from calculations of the back stress necessary to produce the observed strengthening effect under various creep loading conditions. The resulting Arrhenius factor is shown to agree quantitatively with shifts to higher strength of crept material in reference to the intrinsic strength of HT-9. The results of very low constant strain-rate high-temperature tensile tests on as-heat-treated HT-9 that focus on the transition in strength with precipitation will be presented and related to rupture-life

  17. SPECTROSCOPIC AND INTERFEROMETRIC MEASUREMENTS OF NINE K GIANT STARS

    Energy Technology Data Exchange (ETDEWEB)

    Baines, Ellyn K. [Remote Sensing Division, Naval Research Laboratory, 4555 Overlook Avenue SW, Washington, DC 20375 (United States); Döllinger, Michaela P. [Max-Planck-Institut für Astronomie, Königstuhl 17, D-69117 Heidelberg (Germany); Guenther, Eike W.; Hatzes, Artie P. [Thüringer Landessternwarte Tautenburg, Sternwarte 5, D-07778 Tautenburg (Germany); Hrudkovu, Marie [Isaac Newton Group of Telescopes, Apartado de Correos 321, E-387 00 Santa Cruz de la Palma, Canary Islands (Spain); Belle, Gerard T. van, E-mail: ellyn.baines@nrl.navy.mil [Lowell Observatory, Flagstaff, AZ 86001 (United States)

    2016-09-01

    We present spectroscopic and interferometric measurements for a sample of nine K giant stars. These targets are of particular interest because they are slated for stellar oscillation observations. Our improved parameters will directly translate into reduced errors in the final masses for these stars when interferometric radii and asteroseismic densities are combined. Here, we determine each star’s limb-darkened angular diameter, physical radius, luminosity, bolometric flux, effective temperature, surface gravity, metallicity, and mass. When we compare our interferometric and spectroscopic results, we find no systematic offsets in the diameters and the values generally agree within the errors. Our interferometric temperatures for seven of the nine stars are hotter than those determined from spectroscopy with an average difference of about 380 K.

  18. Mapping contact metamorphic aureoles in Extremadura, Spain, using Landsat thematic mapper images

    Science.gov (United States)

    Rowan, L.C.; Anton-Pacheco, C.; Brickey, D.W.; Kingston, M.J.; Payas, A.

    1987-01-01

    In the Extremadura region of western Spain, Ag, Pb, Zn, and Sn deposits occur in the pieces of late Hercynian granitic plutons and near the pluton contacts in late Proterozoic slate and metagraywacke that have been regionally metamorphosed to the green schist facies. The plutons generally are well exposed and have distinctive geomorphological expression and vegetation; poor exposures of the metasedimentary host rocks and extensive cultivation, however, make delineation of the contact aureoles difficult. Landsat Thematic Mapper (TM) images have been used to distinguish soil developed on the contact metamorphic rocks from soil formed on the stratigraphically equivalent slate-metagraywacke sequence. The mineral constituents of these soils are similar, except that muscovite is more common in the contact metamorphic soil; carbonaceous material is common in both soils. Contact metamorphic soil have lower reflectance, especially in the 1.6-micrometers wavelength region (TM 5), and weaker Al-OH, Mg-OH, and Fe3+ absorption features than do spectra of the slate-metagraywacke soil. The low-reflectance and subdued absorption features exhibited by the contact metamorphic soil spectra are attributed to the high absorption coefficient f the carbonaceous material caused by heating during emplacement of the granitic plutons. These spectral differences are evident in a TM 4/3, 4/5, 3/1 color-composite image. Initially, this image was used to outline the contact aureoles, but digital classification of the TM data was necessary for generating internally consistent maps of the distribution of the exposed contact metamorphic soil. In an August 1984, TM scene of the Caceras area, the plowed, vegetation-free fields were identified by their low TM 4/3 values. Then, ranges of TM 4/5 and 3/1 values were determine for selected plower fields within and outside the contact aureoles; TM 5 produced results similar to TM 4/5. Field evaluation, supported by X-ray diffraction and petrographic

  19. 2011 Wind Technologies Market Report

    Energy Technology Data Exchange (ETDEWEB)

    Wiser, Ryan [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Bolinger, Mark [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Barbose, Galen [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Darghouth, Naim [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Hoen, Ben [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Mills, Andrew [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Porter, Kevin [Exeter Associates, Columbia, MD (United States); Buckley, Michael [Exeter Associates, Columbia, MD (United States); Fink, Sari [Exeter Associates, Columbia, MD (United States); Oteri, Frank [National Renewable Energy Lab. (NREL), Golden, CO (United States); Tegen, Suzanne [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2012-08-01

    The U.S. wind power industry is facing uncertain times. With 2011 capacity additions having risen from 2010 levels and with a further sizable increase expected in 2012, there are – on the surface – grounds for optimism. Key factors driving growth in 2011 included continued state and federal incentives for wind energy, recent improvements in the cost and performance of wind power technology, and the need to meet an end-of-year construction start deadline in order to qualify for the Section 1603 Treasury grant program. At the same time, the currently-slated expiration of key federal tax incentives for wind energy at the end of 2012 – in concert with continued low natural gas prices and modest electricity demand growth – threatens to dramatically slow new builds in 2013.

  20. Design of Multilayer Insulation for the Multipurpose Hydrogen Test Bed

    Science.gov (United States)

    Marlow, Weston A.

    2011-01-01

    Multilayer insulation (MLI) is a critical component for future, long term space missions. These missions will require the storage of cryogenic fuels for extended periods of time with little to no boil-off and MLI is vital due to its exceptional radiation shielding properties. Several MLI test articles were designed and fabricated which explored methods of assembling and connecting blankets, yielding results for evaluation. Insight gained, along with previous design experience, will be used in the design of the replacement blanket for the Multipurpose Hydrogen Test Bed (MHTB), which is slated for upcoming tests. Future design considerations are discussed which include mechanical testing to determine robustness of such a system, as well as cryostat testing of samples to give insight to the loss of thermal performance of sewn panels in comparison to the highly efficient, albeit laborious application of the original MHTB blanket.

  1. Advances in dynamics, patterns, cognition challenges in complexity

    CERN Document Server

    Pikovsky, Arkady; Rulkov, Nikolai; Tsimring, Lev

    2017-01-01

    This book focuses on recent progress in complexity research based on the fundamental nonlinear dynamical and statistical theory of oscillations, waves, chaos, and structures far from equilibrium. Celebrating seminal contributions to the field by Prof. M. I. Rabinovich of the University of California at San Diego, this volume brings together perspectives on both the fundamental aspects of complexity studies, as well as in applications in different fields ranging from granular patterns to understanding of the cognitive brain and mind dynamics. The slate of world-class authors review recent achievements that together present a broad and coherent coverage of modern research in complexity greater than the sum of its parts. Presents the most up-to-date developments in the studies of complexity Combines basic and applied aspects Links background nonlinear theory of oscillations and waves with modern approaches Allows readers to recognize general dynamical principles across the applications fields.

  2. An MCNP model of glove boxes in a plutonium processing facility

    International Nuclear Information System (INIS)

    Dooley, D.E.; Kornreich, D.E.

    1998-01-01

    Nuclear material processing usually occurs simultaneously in several glove boxes whose primary purpose is to contain radioactive materials and prevent inhalation or ingestion of radioactive materials by workers. A room in the plutonium facility at Los Alamos National Laboratory has been slated for installation of a glove box for storing plutonium metal in various shapes during processing. This storage glove box will be located in a room containing other glove boxes used daily by workers processing plutonium parts. An MCNP model of the room and glove boxes has been constructed to estimate the neutron flux at various locations in the room for two different locations of the storage glove box and to determine the effect of placing polyethylene shielding around the storage glove box. A neutron dose survey of the room with sources dispersed as during normal production operations was used as a benchmark to compare the neutron dose equivalent rates calculated by the MCNP model

  3. Moist temperate forest butterflies of western Bhutan

    Directory of Open Access Journals (Sweden)

    Arun P. Singh

    2016-03-01

    Full Text Available Random surveys were carried out in moist temperate forests (1,860–3,116 m around Bunakha Village and Dochula Pass, near Thimphu in western Bhutan, recording 65 species of butterflies.  Of these, 11 species, viz., Straightwing Blue Orthomiella pontis pontis Elwes, Slate Royal Maneca bhotea bhotea Moore, Dull Green Hairstreak Esakiozephyrus icana Moore, Yellow Woodbrown Lethe nicetas Hewitson, Small Silverfork Zophoessa jalaurida elwesi Moore, Scarce Labyrinth, Neope pulahina (Evans, Chumbi Wall Chonala masoni Elwes, Pale Hockeystick Sailer Neptis manasa manasa Moore and White Commodore Parasarpa dudu dudu Westwood, are restricted to the eastern Himalaya, northeastern India and Myanmar.  Two other species, Tawny Mime Chiasa agestor agestor (Gray and Himalayan Spotted Flat Celaenorrhinus munda Moore have been only rarely recorded from Bhutan and a few individuals of the rare Bhutan Glory Bhutanitis lidderdalei Atkinson were also recorded near Bunakha.  

  4. First joint environmental consultancy for China

    International Nuclear Information System (INIS)

    Hendry, S.

    1993-01-01

    China's first joint venture environmental consulting firm, Environomics, formed with $100,000 from Chinese and U.S. investors, will begin doing business next month, says general manager Husayn Anwar. Last December Beijing slated its environmental industry's output to triple to yuan 10 billion ($1.8 billion)/year by the year 2000 - a response to increased strains on the environment caused by China's economic boom. The chemical industry is the foremost source of emissions of toxic substances such as mercury, phenol, and chromium: it also emits one-third of all industrial wastewater in the country, according to a May 1992 Ministry of the Chemical Industry report. Demand for ozone-depleting chlorofluorocarbons, without any change in technology, is set to triple by 2000, the ministry says

  5. The Danish National Database for Asthma

    DEFF Research Database (Denmark)

    Hansen, Susanne; Hoffmann-Petersen, Benjamin; Sverrild, Asger

    2016-01-01

    in death only in extreme cases, the disease is associated with significant morbidity, reduced quality of life, increased absenteeism, and large costs for society. Asthma can be diagnosed based on report of characteristic symptoms and/or the use of several different diagnostic tests. However......, there is currently no gold standard for making a diagnosis, and some degree of misclassification and inter-observer variation can be expected. This may lead to local and regional differences in the treatment, monitoring, and follow-up of the patients. The Danish National Database for Asthma (DNDA) is slated...... control visits, appropriate pharmacological treatment, measurement of lung function, and asthma challenge testing; second, tools used for diagnosis in new cases; and third, annual assessment of smoking status, height, and weight measurements, and the proportion of patients with acute hospital treatment...

  6. Mechanisms of Lignin Biosynthesis During Xylogenesis in Zinnia elegans. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Eriksson, Karl-Erik L.; Dean, Jeffrey F.D.

    1999-06-30

    The original plan for this project was to use Zinnia elegans and its xylogenic cell differentiation system to dissect the role(s) played in lignin deposition by the three classes of laccases (p-diphenoloxidases) the authors had previously detected in zinnia stem extracts. The project, was broadly divided into two general areas--biochemistry/enzymology and molecular biology/genetic engineering--each of which was pursued by one of two graduate students. As noted in the attached publication list, DOE funding for this project facilitated the publication of five (5) research papers, and two (2) more papers slated for peer-review publication are currently nearing completion. In addition, our research results were presented at nine(9) national and international scientific meetings over the past four years. Some of the major findings reported in theses papers and presentations are summarized.

  7. Water flow and solute transport through fractured rock

    International Nuclear Information System (INIS)

    Bolt, J.E.; Bourke, P.J.; Pascoe, D.M.; Watkins, V.M.B.; Kingdon, R.D.

    1990-09-01

    In densely fractured slate at the Nirex research site in Cornwall, the positions, orientations and hydraulic conductivities of the 380 fractures intersecting a drill hole between 9 and 50 m depth have been individually measured. These data have been used: to determine the dimensions of statistically representative volumes of the network of fractures and to predict, using discrete flow path modelling and the NAPSAC code, the total flows into the fractures when large numbers are simultaneously pressurised along various lengths of the hole. Corresponding measurements, which validated the NAPSAC code to factor of two accuracy for the Cornish site, are reported. Possibilities accounting for this factor are noted for experimental investigation, and continuing, more extensive, inter hole flow and transport measurements are outlined. The application of this experimental and theoretical approach for calculating radionuclide transport in less densely fractured rock suitable for waste disposal is discussed. (Author)

  8. Natural radionuclide distribution in Brazilian commercial granites

    International Nuclear Information System (INIS)

    Anjos, R.M.; Veiga, R.; Soares, T.; Santos, A.M.A.; Aguiar, J.G.; Frasca, M.H.B.O.; Brage, J.A.P.; Uzeda, D.; Mangia, L.; Facure, A.; Mosquera, B.; Carvalho, C.; Gomes, P.R.S.

    2005-01-01

    The dimension stones sector in Brazil produces several varieties of granites, marbles, slates and basalts. More than half of this production corresponds to around 200 different commercial types of granites with specific names, geographical and geological origins and mineral compositions. The well-known natural radioactivity present in rocks, where high radiation levels are associated with igneous rocks such as granite, can be used to determine their general petrologic features. This subject is important in environmental radiological protection, since granites are widely used as building and ornamental stones. In this paper, it is applied to correlate the petrographic characteristics of commercial granites with their corresponding dose rates for natural radioactivity. Amounts of thorium, uranium and potassium concentrations have been reported in several Brazilian commercial granite samples

  9. Study of He-Ne Laser Beam Propagation Through Air and Pure, Salt (Still and Turbulence Water

    Directory of Open Access Journals (Sweden)

    Safa AL. Barmany

    2018-01-01

    Full Text Available  This papers ,study  properties of the laser beam in the  different condition,  By using optical system consist of the (He- Ne laser ((λ =632.8nm , p=1.04mw, the parameter beam laser(spot, shape, intensity were study and also study the attenuation and turbulence for the laser mentioned above and with following environmental condition.(1 in the air (2 in the pure ,slate (seawaterwater with concentration 10-5Ml (still, turbulence  at different distance. Measurement were obtained by using a CCD camera and silicon detector type(Silicon PIN in fast response (.0.4-0.7A/W, absorption coefficient value of all cases  was calculated.

  10. Geochemical correlations between uranium and other components in U-bearing formations of Ogcheon belt

    International Nuclear Information System (INIS)

    Lee, M.S.; Chon, H.T.

    1980-01-01

    Some components in uranium-bearing formations which consist mainly of black shale, slate and low grade coal-bearing formation of Ogcheon Belt were processed statistically in order to find out the geochemical correlations with uranium. Geochemical enrichment of uranium, vanadium and molybdenum in low grade coal-bearing formations and surrounding rocks is remarkable in the studied area. Geochemical correlation coefficient of uranium and molybdenum in the rocks displays about 0.6 and that of uranium and fixed carbon about 0.4. Uranium and vanadium in uranium-bearing low grade coals denote very high correlation with fixed carbon, which is considered to be responsible for enrichment of metallic elements, especially molybdenum. Close geochemical correlation of uranium-molybdenum couple in the rocks can be applied as a competent exploration guide to low grade uranium deposits of this area. (author)

  11. Microstructural analysis from archaeological sculptures of the Olmeca culture

    International Nuclear Information System (INIS)

    Rodriguez L, V.; Mendoza A, D.; Espinosa P, M.; Martinez C, G.

    1999-01-01

    This work presents the results obtained from the characterization of a series of samples belonging to different monuments of the Olmec culture. These monuments are exhibited in the archaeological site of La Venta, Tabasco, Mexico. Scanning Electron Microscopy (SEM) and X-ray diffraction (XRD) were used to determine the crystalline phases that characterise the samples, these phases are associated to different morphology. The elemental analysis exhibits the presence mainly of such elements as C, Si, O, Al, Na, Ca and in less abundance Ti, K, Cr, Ni and Mn were determined. The morphology is characterized by the presence of plane tabular structures, schists, extended slates and clusters of irregular grain. Such crystal phases as anorthite, albite, sanidine, zinnwaldite and clinochlore were identified. These phases are associated with such type of materials as feldspars and mica. All the identified phases are noted for presenting near perfect exfoliation. (Author)

  12. Process Design and Economics for the Conversion of Algal Biomass to Biofuels: Algal Biomass Fractionation to Lipid- and Carbohydrate-Derived Fuel Products

    Energy Technology Data Exchange (ETDEWEB)

    Davis, R.; Kinchin, C.; Markham, J.; Tan, E.; Laurens, L.; Sexton, D.; Knorr, D.; Schoen, P.; Lukas, J.

    2014-09-01

    Beginning in 2013, NREL began transitioning from the singular focus on ethanol to a broad slate of products and conversion pathways, ultimately to establish similar benchmarking and targeting efforts. One of these pathways is the conversion of algal biomass to fuels via extraction of lipids (and potentially other components), termed the 'algal lipid upgrading' or ALU pathway. This report describes in detail one potential ALU approach based on a biochemical processing strategy to selectively recover and convert select algal biomass components to fuels, namely carbohydrates to ethanol and lipids to a renewable diesel blendstock (RDB) product. The overarching process design converts algal biomass delivered from upstream cultivation and dewatering (outside the present scope) to ethanol, RDB, and minor coproducts, using dilute-acid pretreatment, fermentation, lipid extraction, and hydrotreating.

  13. Tres pizarras con dibujos de época visigoda en la provincia de Salamanca

    Directory of Open Access Journals (Sweden)

    Manuel SANTONJA

    2009-11-01

    Full Text Available RESUMEN: Junto a las pizarras con inscripciones numerales y escritura cursiva de tiempos visigodos conocidas en la región -Salamanca y Ávila fundamentalmente-, y desde hace años valoradas en su significado histórico, surge un nuevo grupo con escenas figuradas que parece ofrecer así mismo amplias posibilidades de interpretación.ABSTRACT: Along with slate slabs with numeric inscriptions and italic lettering of the visigoth period, well know in the region —Salamanca and Avila basically— and long praised in their historic significance, a new group of figurative scenes springs, which, likewise, seems to offer ample possibilities of interpretation.

  14. Monitoring of PV systems at the Centre for Renewable Energy and Eco-Energy House

    Energy Technology Data Exchange (ETDEWEB)

    Riffat, S.B.; Omer, S.A.; Wilson, R.

    2001-07-01

    This report summarises the results of an examination of the design, installation and operation of two building integrated photovoltaic (PV) systems at the University of Nottingham. Details are given of the thin film, glass Tedlar PV system installed at the Centre, the average system performance, the installation of the monocrystalline roof slate PV system at the Eco-Energy House, and annualised costs for both systems. A holistic approach to building design, a solution to client and installer uncertainty, training to enhance the skills of related trades, the provision of guidance on the minimum acceptable standard of documentation, and the guaranteeing of a minimum level of performance by the system supplier are among the recommendations given.

  15. Annual technical report. PV domestic field trial

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-07-01

    This report describes progress at the first five sites of the UK photovoltaic (PV) domestic field trial. All five sites are generating electricity, but one has not yet been commissioned and two sites are not yet monitoring performance. The BedZED development has roof-mounted PV modules and PV cells installed in sealed double-glazing. Solar slates/tiles have been installed at the Laing Homes development in Montagu Road, where the designer has sought to minimise the visual impact of the PV system on the roofs. At Hunters Moon, PV modules have been retrofitted and some unforeseen difficulties have arisen. PV is an integral part of the roof design at the state-of-the-art low energy development by Integer Houses at Greenfields. Corn Croft uses a British mounting system to facilitate integration of the modules flush with the roof. Installation issues and the progress of the trial are discussed.

  16. PS BOOSTER BEAM TESTS OF THE NEW DIGITAL BEAM CONTROL SYSTEM FOR LEIR

    CERN Document Server

    Angoletta, Maria Elena; Bento, J; De Long, J H; Findlay, A; Matuszkiewicz, P; Pedersen, F; Salom-Sarasqueta, A; CERN. Geneva. AB Department

    2005-01-01

    We have been developing a scaled-down prototype of the new digital beam control and cavity servoing system for CERN’s Low Energy Ion Ring (LEIR) slated for commissioning in 2005. The system’s hardware and software, developed as part of a CERN-BNL collaboration, are based on new all-digital technology already deployed at BNL's AGS Booster. The system relies on VME modules, carrying Digital Signal Processors (DSPs) as well as Field Programmable Gate Arrays (FPGAs), and daughter cards. New concepts deployed include software implementation, through DSPs & FPGAs, of functions traditionally executed by analogue hardware, such as reference-functions and timings generation. Additionally, a user-selectable digital data acquisition functionality provides diagnostic and troubleshoot access points, a new feature which is very useful in a digital system. The scaled-down prototype implements frequency program, radial steering, phase and radial loops capabilities and it has been tested in CERN's PS Booster (PSB) dur...

  17. Water flow and solute transport through fractured rock

    International Nuclear Information System (INIS)

    Bourke, P.J.; Kingdon, R.D.; Bolt, J.E.; Pascoe, D.M.; Watkins, V.M.B.

    1991-01-01

    In densely fractured slate at the Nirex research site in Cornwall, the positions, orientations and hydraulic conductivities of the 380 fractures intersecting a drill hole between 9 and 50 m depths have been individually measured. These data have been used: - to determine the dimensions of statistically representative volumes of the sheetwork of fractures; - to predict; using discrete flowpath modelling and the NAPSAC code; the total flows into the fractures when large numbers are simultaneously pressurised along various lengths of the hole; Corresponding measurements, which proved the modelling and validated the code to factor of two accuracy, are reported. Possibilities accounting for this factor are noted for experimental investigation, and continuing, more extensive inter-hole flow and transport measurements are outlined. The application of this experimental and theoretical approach for calculating radionuclide transport in less densely fractured rock suitable for waste disposal is discussed. 7 figs., 9 refs

  18. The role of globalization in drug development and access to orphan drugs: orphan drug legislation in the US/EU and in Latin America [v1; ref status: indexed, http://f1000r.es/3ix

    Directory of Open Access Journals (Sweden)

    Renée J.G. Arnold

    2015-02-01

    Full Text Available Compared to a decade ago, nearly three times as many drugs for rare diseases are slated for development. This article addresses the market access issues associated with orphan drug status in Europe and the United States in contrast to the legislation in five Latin American (LA countries that have made strides in this regard--Mexico, Brazil, Colombia, Chile and Argentina. Based on the success of orphan drug legislation in the EU and US, LA countries should strive to adopt similar strategies with regard to rare diseases and drug development. With the implementation of new targeted regulations, reimbursement strategies, and drug approvals, accessibility to treatment will be improved for people afflicted with rare diseases in these developing countries.

  19. The radon hazard in non - uranium European mines: Retrospective of a survey conducted between 1978 and 1982 in different mines across Europe and new results in France

    International Nuclear Information System (INIS)

    Bernhard, S.; Pineau, J.F.; Zettwoog, P.; Skowronek, J.

    1996-01-01

    From 1979 to 1982, a study of the hazard due to the natural radioactivity in non-uranium mines has been initiated by the CEC. The programme of the work involved coal, potash salt, fluors par, gypsum, clay, graphite, tungsten, antimony, bauxite, cassiterite, slate, iron, pyrites, lead-zinc, tin, silver-zinc, as well as gold mines, situated in Belgium, France, United Kingdom, Germany and Italy. In all studies mines, a radiological and ventilation audit have been conducted and an individual dosimetry has been implemented for a group of a few tens of miners in some of the mines. An overview of the results is presented here, giving information about the radiological risk treatming the miner's health. The overview is completed with recent measurements made more recently, on a routine basis, in some French non-uranium mines. (author). 47 refs, 8 figs, 3 tabs

  20. Thermophysical Properties and Phase Behavior of Fluids for Application in Carbon Capture and Storage Processes.

    Science.gov (United States)

    Trusler, J P Martin

    2017-06-07

    Phase behavior and thermophysical properties of mixtures of carbon dioxide with various other substances are very important for the design and operation of carbon capture and storage (CCS) processes. The available empirical data are reviewed, together with some models for the calculation of these properties. The systems considered in detail are, first, mixtures of carbon dioxide, water, and salts; second, carbon dioxide-rich nonelectrolyte mixtures; and third, mixtures of carbon dioxide with water and amines. The empirical data and the plethora of available models permit the estimation of key fluid properties required in the design and operation of CCS processes. The engineering community would benefit from the further development, and delivery in convenient form, of a small number of these models sufficient to encompass the component slate and operating conditions of CCS processes.

  1. Notes on the distribution of lichen biota of Podlasie. III. Nowosady village, Podlaskie province (north-eastern Poland

    Directory of Open Access Journals (Sweden)

    Sylwia Kiercul

    2015-08-01

    Full Text Available The present study was undertaken to evaluate the biodiversity of lichen species in Nowosady village and surrounding areas. This work was conducted in 2014 (in August and biodiversity of lichen species growing on tree bark and bushes, on dead wood (anthropogenic origin, glacial erratics, concrete, mortared walls and other specific substrates like eternit roof slates has been assessed. The lichen species represented morphologically diverse forms: crustose (38%, foliose (38%, fruticose (13%, dimorphous (5%, placodial (3% and squamulose (3%. They belonged to different ecological types including epiphytes (27 species, epixyles (18 and epilithes (12. Out of 39 species identified in Nowosady village, five are included in the Polish red list of lichens: Bryoria fuscescens, Evernia prunastri, Hypogymnia tubulosa, Ramalina farinacea and Ramalina fraxinea. Four taxons from the study area are under statutory protection of species. One species, Ramalina fraxinea is under full protection and 3 species (Bryoria fuscescens, Evernia prunastri and Hypogymnia tubulosa are under partial protection.

  2. The acquisition of biological knowledge during childhood: Cognitive conflict or tabula rasa?

    Science.gov (United States)

    Lawson, Anton E.

    Clinical interviews were conducted with three elementary school children, who varied in age but not in family or school environment, to determine the extent to which they held naive misconceptions about important biological topics and to determine agewise trends in the development of biological knowledge. Does early biological knowledge acquisition follow a pattern of spontaneous naive theory construction and cognitive conflict or does it follow a pattern of gradual accretion to an initially blank slate? Contrary to findings in the physical sciences, little evidence was found for biological misconceptions as knowledge acquisition appeared to more directly follow the gradual accretion hypothesis with the primary source of that knowledge adult authority rather than personal experience. However, conceptual change teaching is still advocated due to its ability to provoke students to consider and test alternative conceptions (even if they are not their own) as a means of encouraging the development of important general reasoning patterns utilized in the testing of causal hypotheses.

  3. Integral Criticality Estimators in MCATK

    Energy Technology Data Exchange (ETDEWEB)

    Nolen, Steven Douglas [Los Alamos National Laboratory; Adams, Terry R. [Los Alamos National Laboratory; Sweezy, Jeremy Ed [Los Alamos National Laboratory

    2016-06-14

    The Monte Carlo Application ToolKit (MCATK) is a component-based software toolset for delivering customized particle transport solutions using the Monte Carlo method. Currently under development in the XCP Monte Carlo group at Los Alamos National Laboratory, the toolkit has the ability to estimate the ke f f and a eigenvalues for static geometries. This paper presents a description of the estimators and variance reduction techniques available in the toolkit and includes a preview of those slated for future releases. Along with the description of the underlying algorithms is a description of the available user inputs for controlling the iterations. The paper concludes with a comparison of the MCATK results with those provided by analytic solutions. The results match within expected statistical uncertainties and demonstrate MCATK’s usefulness in estimating these important quantities.

  4. Petroleum refining industry in China

    International Nuclear Information System (INIS)

    Walls, W.D.

    2010-01-01

    The oil refining industry in China has faced rapid growth in oil imports of increasingly sour grades of crude with which to satisfy growing domestic demand for a slate of lighter and cleaner finished products sold at subsidized prices. At the same time, the world petroleum refining industry has been moving from one that serves primarily local and regional markets to one that serves global markets for finished products, as world refining capacity utilization has increased. Globally, refined product markets are likely to experience continued globalization until refining investments significantly expand capacity in key demand regions. We survey the oil refining industry in China in the context of the world market for heterogeneous crude oils and growing world trade in refined petroleum products. (author)

  5. Solar Panel Integration as an Alternate Power Source on Centaur 2 (SPIAPS)

    Science.gov (United States)

    Gebara, Christine A.; Schuetze, Nich A.; Knochel, Aviana M.; Magruder, Darby F.

    2011-01-01

    The dream of exploration has inspired thousands throughout time. Space exploration, in particular, has taken the past century by storm and caused a great advance in technology. In this project, a retractable solar panel array will be developed for use on the Centaur 2 Rover. Energy generated by the solar panels will go to power the Centaur 2 Robot (C2) or Regolith & Environment Science & Oxygen & Lunar Volatile Extraction (RESOLVE) payload, an in-situ resource utilization project. Such payload is designed to drill into lunar and Martian terrain as well as be able to conduct other geological testing; RESOLVE is slated for testing in 2012. Ultimately, this project will fit into NASA s larger goal of deep space exploration as well as long term presence outside Earth s orbit.

  6. Shale as a radioactive waste repository: the importance of vermiculite

    Energy Technology Data Exchange (ETDEWEB)

    Komarneni, S; Roy, D M; Pennsylvania State Univ., University Park; USA). Materials Research Labs.)

    1979-01-01

    Cesium sorption and fixation properties of thirty shale minerals and shales were investigated in search of a criterion for the suitability of shales for a radioactive waste repository. Shales and illites containing vermiculite fixed the largest proportion of total Cs sorbed (up to 91%) against displacement with 0.1 N KCl. For example, a slate sample fixed 33% of the total Cs sorbed while its weathered counterpart in which chlorite had altered to vermiculite fixed 89% of the total Cs sorbed. Since Cs is one of the most soluble and hazardous radioactive ions, its containment is of great importance in safe radioactive waste disposal. Presence of vermiculite in a shale body may therefore, serve as one criterion in the selection of a suitable shale for radioactive waste disposal if and when shales in geologically stable areas are selected for repositories.

  7. Plutonium explosive dispersal modeling using the MACCS2 computer code

    International Nuclear Information System (INIS)

    Steele, C.M.; Wald, T.L.; Chanin, D.I.

    1998-01-01

    The purpose of this paper is to derive the necessary parameters to be used to establish a defensible methodology to perform explosive dispersal modeling of respirable plutonium using Gaussian methods. A particular code, MACCS2, has been chosen for this modeling effort due to its application of sophisticated meteorological statistical sampling in accordance with the philosophy of Nuclear Regulatory Commission (NRC) Regulatory Guide 1.145, ''Atmospheric Dispersion Models for Potential Accident Consequence Assessments at Nuclear Power Plants''. A second advantage supporting the selection of the MACCS2 code for modeling purposes is that meteorological data sets are readily available at most Department of Energy (DOE) and NRC sites. This particular MACCS2 modeling effort focuses on the calculation of respirable doses and not ground deposition. Once the necessary parameters for the MACCS2 modeling are developed and presented, the model is benchmarked against empirical test data from the Double Tracks shot of project Roller Coaster (Shreve 1965) and applied to a hypothetical plutonium explosive dispersal scenario. Further modeling with the MACCS2 code is performed to determine a defensible method of treating the effects of building structure interaction on the respirable fraction distribution as a function of height. These results are related to the Clean Slate 2 and Clean Slate 3 bunkered shots of Project Roller Coaster. Lastly a method is presented to determine the peak 99.5% sector doses on an irregular site boundary in the manner specified in NRC Regulatory Guide 1.145 (1983). Parametric analyses are performed on the major analytic assumptions in the MACCS2 model to define the potential errors that are possible in using this methodology

  8. When did the Penglai orogeny begin on Taiwan?: Geochronological and petrographic constraints on the exhumed mountain belts and foreland-basin sequences

    Science.gov (United States)

    Chen, W. S.; Syu, S. J.; Yeh, J. J.

    2017-12-01

    Foreland basin receives large amounts of synorogenic infill that is eroded from the adjacent exhumed mountain belt, and therefore provides the important information on exhumation evolution. Furthermore, a complete stratigraphic sequence of Taiwan mountain belt consists of five units of Miocene sedimentary rocks (the Western Foothills and the uppermost sequence on the proto-Taiwan mountain belt), Oligocene argillite (the Hsuehshan Range), Eocene quartzite (the Hsuehshan Range), Eocene-Miocene slate and schist (Backbone Range), and Cretaceous schist (Backbone Range) from top to bottom. Based on the progressive unroofing history, the initiation of foreland basin received sedimentary lithic sediments from the uppermost sequence of proto-Taiwan mountain belt, afterwards, and receiving low- to medium-grade metamorphic lithic sediments in ascending order of argillite, quartzite, slate, and schist clasts. Therefore, the sedimentary lithics from mountain belt were deposited which represents the onset of the mountain uplift. In this study, the first appearance of sedimentary lithic sediments occurs in the Hengchun Peninsula at the middle Miocene (ca. 12-10 Ma). Thus, sandstone petrography of the late Miocene formation (10-5.3 Ma) shows a predominantly recycled sedimentary and low-grade metamorphic sources, including sandstone, argillite and quartzite lithic sediments of 10-25% which records erosion to slightly deeper metamorphic terrane on the mountain belt. Based on the results of previous thermogeochronological studies of the Yuli belt, it suggests that the middle Miocene occurred mountain uplift. The occurrence of low-grade metamorphic lithic sediments in the Hengchun Peninsula during late Miocene is coincident with the cooling ages of uplift and denuded Yuli schist belt at the eastern limb of Backbone Range.

  9. Structural control and correlation of uranium distribution and mineralogy of meta-pelites in Ogcheon terrain, Korea

    International Nuclear Information System (INIS)

    Park, B.S.; So, C.S.

    1980-01-01

    The rock units of Goesan area in the Ogcheon metamorphic terrain established on the basis of field criteria should be redefined into following sequence. Based on shear senses in secondary small structures which are usually observable in the investigated area, the stratigraphy can be lithologically divided into the lower pelite, pebbly mudstone, upper pelite, quartzite and psammite unit in ascending order. This conclusion is in discordance with a previous opinion; Munjuri formation and Guryongsan formation may be equivalent to upper pelite unit, Iwonri formation and Hwanggangri formation to pebbly mudstone. From this, it may be inferred that isoclinal overtuned folds repeatedly occur in the area. The uranium bearing coaly thin layers in upper pelite unit have relatively broad exposures in Deogpyeongri block of Goesan area along culmination zone in the central part of the investigated area. It is believed that structural feature in the block recognized complexly refolded synform plunging to southwest. Mineralogical and radiometric studies were made on 135 representative samples from the Ogcheon Group of Korea. The mineralogy of all black slate samples is qualitatively similar but quantitatively different. The uranium distribution in the studied area show approximately log normal. Uranium in the black slates of the Ogcheon Group was deposited together under same physico-chemical environmental conditions. The chemical and geological factors that controlled the abundance of organic carbon and iron oxides also controlled the uranium content. The relationship of the major components to uranium can be expressed by the following regression equation: Log(Ux10 4 +1)=1.70999-0.00367(quartz)-0.00512(micas)-0.00930(other silicates)+0.01911(iron oxides)-0.03389(other opaques)+0.02062(organic carbon). (author)

  10. Natural Radioactivity in some building materials from Spain

    Energy Technology Data Exchange (ETDEWEB)

    Miro, C. [Universidad de Extremadura (UEX), 10071-Caceres (Spain); Madruga, M.J.; Reis, M. [Instituto Superior Tecnico, Universidade de Lisboa, Campus Tecnologico e Nuclear, 2695-066 Bobadela LRS (Portugal)

    2014-07-01

    Studies of natural radiation are of great importance because it is the main source of exposure of human kind. Building materials is one of the sources which cause direct radiation exposure because of their radium, thorium and potassium content. The aim of this work is to measure gamma activity due to {sup 40}K, {sup 226}Ra and {sup 232}Th in samples of commonly used as a building materials in Spain. Cement, gypsum, plaster, marble, slates, granite and wood had been analysed. These materials are used for private and public building. Radium equivalent activities (Ra{sub eq}) and various hazard indices were also calculated to assess the radiation hazard. Results were also compared with the data available in the literature for other countries of the world. Cement, gypsum and plaster samples were collected from hardware stores. Marble, slates and granite samples were taken from different quarries. And the wood samples were taken from eucalyptus trees from forest. Activity concentrations {sup 40}K-, {sup 226}Ra- and {sup 232}Th-activity was determined by gamma spectrometry using a HPGe coaxial detector. The results show that the range of average values of the activity concentrations due to {sup 40}K, {sup 226}Ra and {sup 232}Th were found between 37 and 1340 Bq/kg, 0.007 and 104 Bq/kg, and <0.005 and 75 Bq/kg, respectively. Maxima values were obtained in granite. Radium equivalent activities range from 3.7 Bq/kg to 283 Bq/kg, calculated in wood and granite, respectively. Therefore all the samples showed Raeq activities within the limit, 370 Bq/kg, set by UNSCEAR. Values of external hazard index for all samples under investigation are below the unity, while the internal hazard index for granite exhibits a value around the unity. Acknowledgements to the financial support of the Junta de Extremadura (project PRI09A092 and FEDER-group GRU09053). (authors)

  11. Petrographic and Geochemical Analyses of Kirana Hills Shield Rocks around Sargodha and Economic Potential

    Directory of Open Access Journals (Sweden)

    Muhammad Waseem Khan

    2017-04-01

    Full Text Available The present study deals with geochemical and petrographic analysis of the Kirana Hill shield rocks of Punjab plains from Buland, Hachi, Shaheen Abad, Shaikh and Machh hills. On basis of the current studies certain modifications have been made in the classification and nomenclature of rocks exposed in the study areas. Chemical analyses have also been carried out in order to calculate Cross Iddings, Pirsson, and Washington (CIPW norms”, to strengthen nomenclature scheme and finally rocks are classified by using “MAGMA SOFTWARE”. Rhyolites predominate over the basalts/dolerites, andesites, and phyllite/ slate. Rhyolitic rocks are light grey, greenish grey and light brown in color, aphanitic in nature. The observed microscopic textures are aphyric, phyric or porphyritic and micropoikilitc. Moreover, some rhyolitic rocks also show flow texture. They are either cryptocrystalline to microcrystalline or microcrystalline to cryptocrystalline. No glassy material has been observed in any thin section. Mafic rocks are characterized by the presence of ferromagnesian minerals with plagioclase. Andesites exhibit mainly porphyritic texture, but aphyric texture has also been observed in few samples. Hydrothermal alterations are also very common in these rocks. Other rock assemblages identified during laboratory studies from Kirana area include: tuffs i.e. (Lithic Crystal Tuff and Lithic Tuff, basaltic andesite, rhyodacite/ dacite, slate/ phyllite, ankeritic rocks/ veins and quartzofeldspathic veins. Our studies also reveal that no evidence of quartzite has been found in the samples collected from above mentioned areas of Kirana, although it has been reported in previous literature. Iron (Fe has been observed in rhyolite as well as other volcanic rocks of Kirana hills, its presence suggests magma from deep mantle instead of crustal melting / anatexis. In the present analysis some primary and secondary copper minerals including chalcopyrite, atacamite and

  12. Natural Stone in Spain: trends and perspectives; La piedra natural en España: evolución y perspectivas

    Energy Technology Data Exchange (ETDEWEB)

    Marchán Sanz, C.; Regueiro y González-Barros, M.; Delgado Arenas, P.

    2017-09-01

    The natural stone sector was severely affected by the national construction sector crisis. Production, both exworks and processed, has been also harshly affected dropping from 8Mt/y in 2007 to 3,49Mt/y in 2015, particularly in the marble and granite sectors, since slate has always been a mainly exporting sub-sector. In the latest times, thanks mainly to exports, production apparently has slowly started to recover. In this paper, we review the typology of the Spanish natural stone products and the production data of the main stone subsectors (marble, granite and slate) in the last 10 years and we review possible future trends in the framework of the first steps of the economic recovery. [Spanish] El sector de la Piedra Natural nacional ha sufrido muy duramente el impacto de la crisis del sector de la construcción nacional. La producción tanto en cantera como elaborada se ha resentido gravemente, pasando de 8Mt/año en 2007 a menos de la mitad en 2015, en particular en los subsectores de mármoles y granitos, ya que la pizarra siempre ha sido un subsector netamente exportador. En los últimos tiempos y gracias fundamentalmente a las exportaciones, la producción poco a poco parece que está comenzando a recuperarse. En este trabajo se pasa revista a la tipología de los productos de piedra en España y los datos de producción de los grandes sub-sectores de la piedra natural nacional (mármoles, granitos y pizarras) en los últimos 10 años y se analiza su posible evolución futura en el marco de la incipiente recuperación económica.

  13. Animal-sediment interactions: the effect of ingestion and excretion by worms on mineralogy

    Directory of Open Access Journals (Sweden)

    S. J. Needham

    2004-01-01

    Full Text Available By controlled experiments that simulate marine depositional environments, it is shown that accelerated weathering and clay mineral authigenesis occur during the combined process of ingestion, digestion and excretion of fine-grained sediment by two species of annelid worms. Previously characterized synthetic mud was created using finely ground, low-grade metamorphic slate (temperature approximately 300°C containing highly crystalline chlorite and muscovite. This was added to experiment and control tanks along with clean, wind-blown sand. Faecal casts were collected at regular intervals from the experimental tanks and, less frequently, from the control tanks. Over a period of many months the synthetic mud (slate proved to be unchanged in the control tanks, but was significantly different in faecal casts from the experimental tanks that contained the worms Arenicola marina and Lumbricus terrestris. Chlorite was preferentially destroyed during digestion in the gut of A. marina. Both chlorite and muscovite underwent XRD peak broadening with a skew developing towards higher lattice spacing, characteristic of smectite formation. A neoformed Fe-Mg-rich clay mineral (possibly berthierine and as-yet undefined clay minerals with very high d-spacing were detected in both A. marina and L. terrestris cast samples. We postulate that a combination of the low pH and bacteria-rich microenvironment in the guts of annelid worms may radically accelerate mineral dissolution and clay mineral precipitation processes during digestion. These results show that macrobiotic activity significantly accelerates weathering and mineral degradation as well as mineral authigenesis. The combined processes of sediment ingestion and digestion thus lead to early diagenetic growth of clay minerals in clastic sediments.

  14. [Dust concentration analysis in non-coal mining. Exposure evaluation based on measurements performed by occupational hygiene laboratories in the years 2001-2005 in Poland].

    Science.gov (United States)

    Bujak-Pietrek, Stella; Mikołajczyk, Urszula; Szadkowska-Stańczyk, Irena

    2011-01-01

    Non-coal mining includes the extraction of materials for construction (stone, gravel, sand and clay), chemical industry (salt and sulfur), metallurgy (metal ores, uranium and thorium) and other mining and quarrying. Regardless of the type of mining company one of the most common health hazards in this sector is exposure to high concentrations of dust occurring during the extraction of materials. Such activities as drilling, use of blasting agents, processing of raw material, its transportation and loading are the source of large amounts of dust containing crystalline silica. Data on exposure to dust, collected by industrial hygiene laboratories on the basis of dust concentration measurements in the work environment, were obtained from the sanitary inspection service. The analysis of dust concentrations at workplaces in non-coal mining covered the years 2001-2005. The average concentration of inhalable and respirable dust and the degree of results dispersion at workposts in different branches of non-coal mining (according to NACE rev1.1) were evaluated. Also there was estimated the percentage of surveys indicating dust concentrations above hygiene standards. Almost 5000 measurements of dust concentrations were performed in the years under study. The highest concentration of inhalable dust was noted for the production of salt (5.51 mg/m3), other mining and quarrying (4.30 mg/m3) and quarrying of slate (3.77 mg/m3). For respirable dust the highest concentrations were noted in other mining and quarrying (1.10 mg/m3), quarrying of slate (1.09 mg/m3) and quarrying of stone (0.81 mg/m3). Exposure to high concentrations of dust during the extraction of non-carbon is still an important hazard to human health. Almost for all workposts under study the excess of hygiene standards were observed.

  15. Building Scorecards in Academic Research Libraries: Performance Measurement and Organizational Issues

    Directory of Open Access Journals (Sweden)

    Vivian Lewis

    2013-06-01

    Full Text Available Objective – This paper describes the experiences of four prominent North American research libraries as they implemented Balanced Scorecards as part of a one-year initiative facilitated by the Association of Research Libraries (ARL. The Balanced Scorecard is a widely accepted organizational performance model that ties strategy to performance in four areas: finance, learning and growth, customers, and internal processes.Methods – Four universities participated in the initiative: Johns Hopkins University, McMaster University, the University of Virginia, and the University of Washington. Each university sent a small group of librarians to develop their Scorecard initiatives and identified a lead member. The four teams met with a consultant and the ARL lead twice for face-to-face training in using the Scorecard. Participants came together during monthly phone calls to review progress and discuss next steps. Additional face-to-face meetings were held throughout the year in conjunction with major library conferences.Results – The process of developing the Scorecards included the following steps: defining a purpose statement, identifying strategic objectives, creating a strategy map, identifying measures, selecting appropriate measures, and setting targets. Many commonalities were evident in the four libraries’ slates of strategic objectives. There were also many commonalities among measures, although the number chosen by each institution varied significantly, from 26 to 48.Conclusion – The yearlong ARL initiative met its initial objectives. The four local implementations are still a work in progress, but the leads are fully trained and infrastructure is in place. Data is being collected, and the leadership teams are starting to see their first deliverables from the process. The high level of commonality between measures proposed at the four sites suggests that a standardized slate of measures is viable.

  16. The iron, aluminate and jarosite deposits in Riazas area as potential source of arsenic in groundwater; Los yacimientos de hierro, alunita y jarosita de la zona de Riaza como posible origen del arsenico en las aguas subterraneas

    Energy Technology Data Exchange (ETDEWEB)

    Leal Meca, M.; Lilo Ramos, J.

    2009-07-01

    Arsenic in concentrations above the legal limit of 10 {mu}g/l has been detected in groundwaters of the Duero Cenozoic Basin. The origin of arsenic is related to sedimentary units with arsenic content above the background value of 28.5 mg/kg. Thus, iron-rich deposits located at the base of Cenozoic succession may constitute a potential source of arsenic in the groundwaters. Three outcrops of iron-rich conglomerates in the Riazas area of Segovia province (one in El Negredo and two in Madriguera) have been studied to determine the significance of these materials as a potential source of arsenic in groundwater. These outcrops occur above an unconformity separating them from strongly altered Paleozoic slates, rich in alunite and jarosite. The work is based in geochemical (trace elements detection by INAA) and mineralogical analyses (through XRD-EDAX and ESEM) of 18 samples of altered slates and materials of ferriferrous deposits. Besides, 3 water samples from springs have subjected to hydrochemical analysis to establish major ionic species and trace elements. Although mineralogical study reveals that arsenic occurs in iron oxides and high arsenic concentrations have been identified in rocks of El Negredo (up to 361 mg/kg, average 143.3 mg/kg), the arsenic concentrations in Ca-Mg-HCO{sub 3} - water type are always lower than 10 {mu}g/l. Therefore, it does not seem to be probable that these deposits act as arsenic source, at least at the present physic-chemical conditions.(Author) 37 refs.

  17. Ecological studies of small vertebrates in Pu-contaminated study areas of NTS and TTR

    International Nuclear Information System (INIS)

    Bradley, W.G.; Moor, K.S.

    1975-01-01

    Ecological studies of vertebrates in plutonium-contaminated areas of the Nevada Test Site (NTS) were initiated in March 1972, and have continued to date. In September 1973, standard census methods were also employed to derive a qualitative and quantitative inventory of vertebrate biota of four Nevada Applied Ecology Group (NAEG) study areas of the Tonopah Test Range (TTR). A checklist of vertebrates of NAEG study areas of NTS and TTR is presented. Data are presented on vertebrate composition, relative abundance, and seasonal status in the study areas. Concentrations of 239 Pu and 241 Am were determined in pelt or skin, GI tract, and carcass of 13 lizards and 16 mammals resident on Clean Slate 2, TTR, and Area 11, NTS. A total of 71 animals were collected for radioanalysis. However, the data were not available at the time this report was written. Pu tissue burdens were highest in lizards from Area 11 GZ. Maximum values obtained in nCi/g ash were 30.9, 42.2, and 0.43 for the pelt, GI tract, and carcass, respectively. Maximum 239 Pu values in tissues of small rodents from Area 11 (not from GZ) were 11.4, 6.49, and 0.20 nCi/g ash for pelt, GI tract, and carcass, respectively. Pu/Am ratios were relatively consistent in tissue samples of lizards and small mammals from Area 11 (approximately 6:1, Pu/Am). Pu/Am ratios were not consistent in vertebrates of Clean Slate 2, TTR, and appeared to be lower in carcass (28:1, Pu/Am in mammals) than GI tract (9:1, Pu/Am in mammals). Although this trend was more conspicuous in mammals, it was also evident in reptiles. (auth)

  18. Towards Plasma-Based Water Purification: Challenges and Prospects for the Future

    Science.gov (United States)

    Foster, John

    2016-10-01

    Freshwater scarcity derived from climate change, pollution, and over-development has led to serious consideration for water reuse. Advanced water treatment technologies will be required to process wastewater slated for reuse. One new and emerging technology that could potentially address the removal micropollutants in both drinking water as well as wastewater slated for reuse is plasma-based water purification. Plasma in contact with liquid water generates reactive species that attack and ultimately mineralize organic contaminants in solution. This interaction takes place in a boundary layer centered at the plasma-liquid interface. An understanding of the physical processes taking place at this interface, though poorly understood, is key to the optimization of plasma water purifiers. High electric field conditions, large density gradients, plasma-driven chemistries, and fluid dynamic effects prevail in this multiphase region. The region is also the source function for longer-lived reactive species that ultimately treat the water. Here, we review the need for advanced water treatment methods and in the process, make the case for plasma-based methods. Additionally, we survey the basic methods of interacting plasma with liquid water (including a discussion of breakdown processes in water), the current state of understanding of the physical processes taking place at the plasma-liquid interface, and the role that these processes play in water purification. The development of diagnostics usable in this multiphase environment along modeling efforts aimed at elucidating physical processes taking place at the interface are also detailed. Key experiments that demonstrate the capability of plasma-based water treatment are also reviewed. The technical challenges to the implementation of plasma-based water reactors are also discussed. NSF CBET 1336375 and DOE DE-SC0001939.

  19. Core Description and a Preliminarily Sedimentology Study of Site 1202D, Leg 195, in the Southern Okinawa Trough

    Directory of Open Access Journals (Sweden)

    Chi-Yue Huang

    2005-01-01

    Full Text Available ODP Site 1202 of Leg 195 was designed primarily for a high-resolution study of the paleoceanography of the Kuroshio Current in the southern Okinawa Trough off NE Taiwan. Four holes were drilled in which Hole 1202D is described in detail in this study for an assessment of core quality for paleoceanography study and understanding of sedimentological features, especially turbidite sedimentation and the sediment provenances during the Late Quaternary in the southern Okinawa Trough. Pelagic mud with insignificant silt or sand layers is observed from the core top down to 133 m (mbsf; Marine Isotope Stages 1-3, but the silt-sand layer ratio (SLR: total thickness of silt and sand layers / 1.5 m of core increases gradually from a value of 50 % between 223 and 279 m, followed by decreases to values 250 _ Slate fragments are commonly found in fine-grained turbidite dominant intervals (160 - 280 m, while mica flakes can be observed in the muds throughout the core. The major detrital components were derived primarily from the Miocene slate belt of the pre-collision accretionary prism of the Central Range in northern Taiwan. The occurrence of volcanics could represent submarine volcanic activity in the active-opening Okinawa Trough back-arc basin off NE Taiwan. Shallow-marine fossils including benthic foraminifers, echinoids, bryozoans and mollusks are also found in the fine-grained turbidite dominant intervals. These fossil assemblages could have been deposited in the shallow shelf and then transported to the depositional site along with voluminous terrigenous materials derived from Taiwan, via submarine channels or by slope failures due to frequent earthquakes induced by plate convergence/collision and extension in the southwestern Okinawa Trough off NE Taiwan. It is concluded that the top 133 m of the core is better suited for paleoceanographic reconstruction.

  20. Plutonium explosive dispersal modeling using the MACCS2 computer code

    Energy Technology Data Exchange (ETDEWEB)

    Steele, C.M.; Wald, T.L.; Chanin, D.I.

    1998-11-01

    The purpose of this paper is to derive the necessary parameters to be used to establish a defensible methodology to perform explosive dispersal modeling of respirable plutonium using Gaussian methods. A particular code, MACCS2, has been chosen for this modeling effort due to its application of sophisticated meteorological statistical sampling in accordance with the philosophy of Nuclear Regulatory Commission (NRC) Regulatory Guide 1.145, ``Atmospheric Dispersion Models for Potential Accident Consequence Assessments at Nuclear Power Plants``. A second advantage supporting the selection of the MACCS2 code for modeling purposes is that meteorological data sets are readily available at most Department of Energy (DOE) and NRC sites. This particular MACCS2 modeling effort focuses on the calculation of respirable doses and not ground deposition. Once the necessary parameters for the MACCS2 modeling are developed and presented, the model is benchmarked against empirical test data from the Double Tracks shot of project Roller Coaster (Shreve 1965) and applied to a hypothetical plutonium explosive dispersal scenario. Further modeling with the MACCS2 code is performed to determine a defensible method of treating the effects of building structure interaction on the respirable fraction distribution as a function of height. These results are related to the Clean Slate 2 and Clean Slate 3 bunkered shots of Project Roller Coaster. Lastly a method is presented to determine the peak 99.5% sector doses on an irregular site boundary in the manner specified in NRC Regulatory Guide 1.145 (1983). Parametric analyses are performed on the major analytic assumptions in the MACCS2 model to define the potential errors that are possible in using this methodology.

  1. Woodland caribou persistence and extirpation in relic populations on Lake Superior

    Directory of Open Access Journals (Sweden)

    Arthur T. Bergerud

    2007-04-01

    Full Text Available Extended: The hypothesis was proposed that woodland caribou (Rangifer tarandus caribou in North America had declined due to wolf predation and over-hunting rather than from a shortage of winter lichens (Bergerud, 1974. In 1974, two study areas were selected for testing: for the lichen hypothesis, we selected the Slate Islands in Lake Superior (36 km2, a closed canopy forest without terrestrial lichens, wolves, bears, or moose; for the predation hypothesis, we selected the nearby Pukaskwa National Park (PNP where terrestrial lichens, wolves, bears, and moose were present. Both areas were monitored from 1974 to 2003 (30 years. The living and dead caribou on the Slates were estimated by the ‘King census’ strip transect (mean length 108±9.3 km, extremes 22-190, total 3026 km and the Lincoln Index (mean tagged 45±3.6, extremes 15-78. The mean annual population on the Slate Islands based on the strip transects was 262±22 animals (extremes 104-606, or 7.3/km2 (29 years and from the Lincoln Index 303±64 (extremes 181-482, or 8.4/km2 (23 years. These are the highest densities in North America and have persisted at least since 1949 (56 years. Mountain maple (Acer spicatum interacted with caribou density creating a record in its age structure which corroborates persistence at relatively high density from c. 1930. The mean percentage of calves was 14.8±0.34% (20 years in the fall and 14.1±1.95% (19 years in late winter. The Slate Islands herd was regulated by the density dependent abundance of summer green foods and fall physical condition rather than density independent arboreal lichen availability and snow depths. Two wolves (1 wolf/150 caribou crossed to the islands in 1993-94 and reduced two calf cohorts (3 and 4.9 per cent calves while female adult survival declined from a mean of 82% to 71% and the population declined ≈100 animals. In PNP, caribou/moose/wolf populations were estimated by aerial surveys (in some years assisted by telemetry

  2. Geology of the Cupsuptic quadrangle, Maine

    Science.gov (United States)

    Harwood, David S.

    1966-01-01

    The Cupsuptic quadrangle, in west-central Maine, lies in a relatively narrow belt of pre-Silurian rocks extending from the Connecticut River valley across northern New Hampshire to north-central Maine. The Albee Formation, composed of green, purple, and black phyllite with interbedded-quartzite, is exposed in the core of a regional anticlinorium overlain to the southeast by greenstone of the Oquossoc Formation which in turn is overlain by black slate of the Kamankeag Formation. In the northern part of the quadrangle the Albee Formation is overlain by black slate, feldspathic graywacke, and minor greenstone of the Dixville Formation. The Kamankeag Formation is dated as 1-ate Middle Ordovician by graptolites (zone 12) found near the base of the unit. The Dixville Formation is correlated with the Kamankeag Formation and Oquossoc Formation and is considered to be Middle Ordovician. The Albee Formation is considered to be Middle to Lower Ordovician from correlations with similar rocks in northeastern and southwestern Vermont. The Oquossoc and Kamankeag Formations are correlated with the Amonoosuc and Partridge Formations of northern New Hampshire. The pre-Silurian rocks are unconformably overlain by unnamed rocks of Silurian age in the southeast, west-central, and northwest ninths of the quadrangle. The basal Silurian units are boulder to cobble polymict conglomerate and quartz-pebble conglomerate of late Lower Silurian (Upper Llandovery) age. The overlying rocks are either well-bedded slate and quartzite, silty limestone, or arenaceous limestone. Thearenaceous limestone contains Upper Silurian (Lower Ludlow) brachiopods. The stratified rocks have been intruded by three stocks of biotite-muscovite quartz monzonite, a large body of metadiorite and associated serpentinite, smaller bodies of gabbro, granodiorite, and intrusive felsite, as well as numerous diabase and quartz monzonite dikes. The metadiorite and serpentinite, and possibly the gabbro and granodiorite are Late

  3. Geology and Mineral Deposits of the Snow Camp-Saxapahaw Area, Central North Carolina

    Science.gov (United States)

    Schmidt, Robert G.; Gumiel, Pablo; Payas, Alba

    2006-01-01

    The Snow Camp-Saxapahaw study area, in the Carolina slate belt in the Southeastern United States, is notable for large zones of high-sulfidation alteration in arc-related metavolcanic rocks. The area has potential for additional significant pyrophyllite and related aluminosilicate refractory mineral deposits and may have potential for small- to medium-size gold deposits also associated with the high-sulfidation hydrothermal systems. The Carolina slate belt is an elongate zone of mostly low-grade metamorphic rocks of Neoproterozoic to early Paleozoic age that extends from northeastern Georgia to southern Virginia. It is dominated by volcanic rocks but locally consists of fine-grained epiclastic sedimentary rocks. Plutons and subvolcanic bodies have intruded the rocks of the Carolina slate belt in many places and have been important in controlling the metamorphism and in localizing hydrothermal alteration. The Snow Camp-Saxapahaw area is mostly underlain by volcanic and volcaniclastic rocks and lesser amounts of intrusive shallow plutons. The volcanic rocks range in composition from basalt to rhyolite; however andesites, dacites, and rhyodacites are the most abundant. The intrusive bodies are largely granite and quartz monzonite; gabbroic bodies also are common. It was possible to establish the relative ages of only part of these rocks. Two northeast-trending fault zones and fractures divide the map area into three structural blocks; the central block was tilted down to the southwest to form a grabenlike structure. Most of the hydrothermally altered rocks and all of the intensely altered zones are confined to the downdropped block, which we think may have been calderalike in origin. A major volcanic unit, the Reedy Branch Tuff, is limited to the southwestern part of the graben and may be the youngest volcanic rock in the area. Layered rocks record one or more strong folding events, but the diversity of rock types, lack of recognizable stratigraphic markers, and

  4. Structure of the Anayet Permian basin (Axial Zone, Central Pyrenees)

    Science.gov (United States)

    Rodriguez, L.; Cuevas, J.; Tubía, J. M.

    2012-04-01

    The Anayet Permian basin was generated by strike-slip tectonics that opened subsident basins with pull-apart geometries in the western Spanish Axial Zone (between the Aragon and Tena valleys). A continental succession of Permian age, that represents the first post-variscan deposits in the area, fills the basin and covers discordantly Devonian to Carboniferous limestones, sandstones and slates. Permian deposits have been classically divided in four main detrital groups, with three basic volcanic episodes interbedded (Gisbert, 1984, Bixel, 1987): the Grey Unit (50-120 m, Estefanian to Kungurian) with slates, conglomerates, tobaceous slates, coal and pyroclastic deposits, the Transition Unit (50 m maximum) showing grey and red sandstones and lutites with oolitic limestones intercalated, the Lower Red Unit (250 m) composed of cross-bedded red sandstones and andesitic volcanic rocks at the top, and finally the Upper Red Unit (400 m minimum, top eroded) formed by three fining up megasequences of carbonates, red sandstones and lutites with lacustrine carbonates intercalated and alkali basalts at the top. Increasingly older rocks are found towards the western part of the basin, where its depocenter is located. South-vergent angular folds deform the Permian sedimentary succession. Fold axes are N115 °E-trending, almost horizontal and are characterized by a remarkably constant orientation. Folds exhibit a long limb dipping slightly to the north and a short vertical limb, occasionally reversed. In the Anayet basin four main folds, with a wavelength of 400 m, can be distinguished, two anticlines and two synclines, with minor folds associated. Related to the angular folds an axial plane foliation, E-trending and dipping 40 to 60° to the north, is developed in the lutites. The more competent rocks, conglomerates and breccias, only locally show a spaced fracture cleavage. No main thrusts have been detected in Permian rocks. However, minor scale decollements, usually low angle

  5. Effects of changing pH, incubation time, and As(V) competition, on F- retention on soils, natural adsorbents, by-products, and waste materials

    Science.gov (United States)

    Quintáns-Fondo, Ana; Santás-Miguel, Vanesa; Nóvoa-Muñoz, Juan C.; Arias-Estévez, Manuel; Fernández-Sanjurjo, María J.; Álvarez-Rodríguez, Esperanza; Núñez-Delgado, Avelino

    2018-03-01

    The purpose of this work was to elucidate the repercussion of changing pH, incubation time and As(V) competition on fluoride (F-) sorption on forest and vineyard soil samples, pyritic and granitic materials, as well as on the by-products pine sawdust, oak wood ash, mussel shell ash, fine and coarse mussel shell, and slate processing waste fines. To reach this end, the methodological approach was based on batch-type experiments. The results indicate that, for most materials, F- sorption was very high at the start, but was clearly diminished when the pH value increased. However, oak wood ash and shell ash showed high F- sorption even at alkaline pH, and pine sawdust showed low F- sorption for any pH value. Specifically, F- sorption was close to 100% for both ashes at pH time on F- sorption, it was very low for both soils, pyritic material, granitic material and both kinds of ashes, as all of them showed very rapid F- sorption from the start, with differences being lesser than 10% between sorption at 30 min and 1 month of incubation. However, sawdust and slate fines sorbed 20% of added F- in 30 minutes, remaining constant up to twelve hours, and doubling after 30 days. And finally, mussel shell sorbed 20% at 30 minutes, increasing to close to 60% when incubation time was 30 days. This means that some of the materials showed a first sorption phase characterized by rapid F- sorption, and a slower sorption in a second phase. As regards the effect of the presence of As(V) on F- sorption, it was almost negligible, indicating the absence of competition for sorption sites. In view of that all, these results could aid to appropriately manage soils and by-products when focusing on F- removal, in circumstances where pH value changes, contact time vary from hours to days, and potential competition between F- and As(V) could take place.

  6. Identifying polar bear resource selection patterns to inform offshore development in a dynamic and changing Arctic

    Science.gov (United States)

    Wilson, Ryan R.; Horne, Jon S.; Rode, Karyn D.; Regehr, Eric V.; Durner, George M.

    2014-01-01

    Although sea ice loss is the primary threat to polar bears (Ursus maritimus), little can be done to mitigate its effects without global efforts to reduce greenhouse gas emissions. Other factors, however, could exacerbate the impacts of sea ice loss on polar bears, such as exposure to increased industrial activity. The Arctic Ocean has enormous oil and gas potential, and its development is expected to increase in the coming decades. Estimates of polar bear resource selection will inform managers how bears use areas slated for oil development and to help guide conservation planning. We estimated temporally-varying resource selection patterns for non-denning adult female polar bears in the Chukchi Sea population (2008–2012) at two scales (i.e., home range and weekly steps) to identify factors predictive of polar bear use throughout the year, before any offshore development. From the best models at each scale, we estimated scale-integrated resource selection functions to predict polar bear space use across the population's range and determined when bears were most likely to use the region where offshore oil and gas development in the United States is slated to occur. Polar bears exhibited significant intra-annual variation in selection patterns at both scales but the strength and annual patterns of selection differed between scales for most variables. Bears were most likely to use the offshore oil and gas planning area during ice retreat and growth with the highest predicted use occurring in the southern portion of the planning area. The average proportion of predicted high-value habitat in the planning area was >15% of the total high-value habitat for the population during sea ice retreat and growth and reached a high of 50% during November 2010. Our results provide a baseline on which to judge future changes to non-denning adult female polar bear resource selection in the Chukchi Sea and help guide offshore development in the region. Lastly, our study provides a

  7. Copepod colonization of organic and inorganic substrata at a deep-sea hydrothermal vent site on the Mid-Atlantic Ridge

    Science.gov (United States)

    Plum, Christoph; Pradillon, Florence; Fujiwara, Yoshihiro; Sarrazin, Jozée

    2017-03-01

    The few existing studies on deep-sea hydrothermal vent copepods indicate low connectivity with surrounding environments and reveal high endemism among vents. However, the finding of non-endemic copepod species in association with engineer species at different reduced ecosystems poses questions about the dispersal of copepods and the colonization of hydrothermal vents as well as their ecological connectivity. The objective of this study is to understand copepod colonization patterns at a hydrothermal vent site in response to environmental factors such as temperature and fluid flow as well as the presence of different types of substrata. To address this objective, an in situ experiment was deployed using both organic (woods, pig bones) and inorganic (slates) substrata along a gradient of hydrothermal activity at the Lucky Strike vent field (Eiffel Tower, Mid-Atlantic Ridge). The substrata were deployed in 2011 during the MoMARSAT cruise and were recovered after two years in 2013. Overall, copepod density showed significant differences between substrata types, but was similar among different hydrothermal activity regimes. Highest densities were observed on woods at sites with moderate or low fluid input, whereas bones were the most densely colonized substrata at the 2 sites with higher hydrothermal influence. Although differences in copepod diversity were not significant, the observed trends revealed overall increasing diversity with decreasing temperature and fluid input. Slates showed highest diversity compared to the organic substrata. Temperature and fluid input had a significant influence on copepod community composition, resulting in higher similarity among stations with relatively high and low fluid inputs, respectively. While vent-specialists such as dirivultids and the tegastid Smacigastes micheli dominated substrata at high vent activity, the experiment demonstrated increasing abundance and dominance of non-vent taxa with decreasing temperature and fluid

  8. Caracterización de espumas de pizarra con adiciones de clínquer de cemento

    Directory of Open Access Journals (Sweden)

    Cambronero, L. E.G.

    2007-04-01

    Full Text Available The decomposition of constituents of slates under non-oxidizing atmosphere leads to the manufacturing of foams. Thus die pressing at 80MPa of slates powders (particle size <80 microns mixed with a solid agglomerate, allows a green density close to 1,8 g/cm3 . The heating of compacts under N2-5%H2 atmosphere allows to reach a final density of 2,2 g/cm3 at 1050ºC, meanwhile at 1150ºC the compact foaming leads to densities lower than 0,4 g/cm3. Clínquer addition (5% and 10% modifies the foam density and pore size at 1150ºC. It is necessary to increase the sintering temperature up to 1175ºC to achieve densities close to 0,4 g/cm3 when a 10% of Clínquer is added. The foams with Clínquer shows a high pore size and a compression strength within the range of glass foams: 0.4-1.5MPa.

    La descomposición de los componentes de la Pizarra durante su calentamiento en condiciones no oxidantes conduce a la obtención de espumas. Así, mediante la compactación en matriz a 80MPa de polvos de Pizarra de menos de 80 μm de tamaño de partícula y con adición de un aglomerante, se obtiene una densidad en verde próxima a 1,8 g/cm3. El calentamiento de estos compactos en atmósfera de N2-5% H2 permite alcanzar densidades de 2,2 g/cm3 a 1100ºC , mientras que a 1150ºC la espumación del compacto conduce a densidades inferiores a 0,4 g/cm3. La adición de Clínquer de cemento Portland (5% y 10% en peso modifica la densidad de la espuma a 1150ºC , teniendo que elevarse la temperatura de sinterización a 1175 ºC para alcanzarse espumas con densidades próximas a 0,4 g/cm3 con un 10% de Clínquer. Estas espumas con Clínquer presentan un elevado tamaño de poro, así como una resistencia a compresión en el intervalo de resistencias de los vidrios espumados: 0,4-1,5MPa.

  9. Granulomatous rosacea: Like leukemid in a patient with acute myeloid leukemia

    Directory of Open Access Journals (Sweden)

    Škiljević Dušan

    2008-01-01

    Full Text Available Introduction. Skin findings in leukemias may be divided into specific lesions (leukemia cutis and non-specific lesions (leukemids which may be found in up to 80% of all patients with leukemias. The leukemids vary clinically and they are usually a manifestation of bone marrow or immunologic impairment, but also Sweet syndrome, pyoderma gangrenosum, erythroderma, maculopapular exanthema, prurigo-like papules, generalized pigmentation, follicular mucinosis, generalized pruritus may be found during the course of leukemia. Case report. We report a 70-year-old male with a 3-month history of erythema, papules and pustules on the face, ears and neck and over a month history of refractory anemia, anorexia, weight loss, malaise, and fever. Physical examination revealed symmetric erythematous, violaceous papules, papulo-nodules and plaques with slate scale and sparse, small pustules on the face, earlobes and neck. Histopathologic findings of involved skin showed diffuse mixed inflammatory cell infiltrate with perifollicular accentuation and focal granulomatous inflammation in the papillary and upper reticular dermis. Extensive checkup revealed the presence of acute myeloid leukemia French- American-British (FAB classification subtype M2, with signs of three-lineage dysplasia. The patient was treated by L6 protocol which led to complete remission, both in bone marrow and skin, but after seven months he had relapse of leukemia with the fatal outcome. Conclusion. This case indicates the importance of skin eruptions in the context of hematological malignancies.

  10. Site characterization report for Building 3506 at Oak Ridge National Laboratory, Oak Ridge, Tennessee. Environmental Restoration Program

    Energy Technology Data Exchange (ETDEWEB)

    1994-07-01

    Building 3506, also known as the Waste Evaporator Facility, is a surplus facility at Oak Ridge National Laboratory (ORNL) slated for decontamination and decommissioning (D&D). The building is located in the ORNL main plant area, to the west of the South Tank Farm and near the intersection of Central Avenue and Third Street. Characterization tasks consisted of three main activities: inspections, radiological measurements, and radiological and chemical sampling and analysis. Inspection reports document general facility conditions, as-built information, and specialized information such as structural evaluations. Radiological measurements define the quantity and distribution of radioactive contaminants; this information is used to calibrate a dose model of the facility and estimate the total activity, in curies, of each major radioactive isotope. The radiological information from sample analyses is used to refine the radiological model of the facility, and the radionuclide and hazardous chemical analyses are used for waste management planning. This report presents data from the field investigation and laboratory analyses in the form of a site description, as-built drawings, summary tables of radiological and chemical contaminant concentrations, and a waste volume estimate.

  11. Community inflamed: Passionate opposition mounted to sour-gas drilling plan upwind of Canada's energy capital

    International Nuclear Information System (INIS)

    Lorenz, A.

    1998-01-01

    Residents of Bearspaw and Glendale, two small communities near Calgary are up in arms in opposition to the plans of Canadian 88 Energy Company to drill a 'level four' sour gas well in the area. The target gas contains 33.9 per cent hydrogen sulfide, a substance rated as lethal in much lower doses. Since the well is slated to be drilled on high ground upwind of Calgary, an accident causing a leak could expose community residents and thousands of Calgarians within half hour distance from the well to hydrogen sulfide concentrations several times higher than the Alberta Energy Board considers safe. Seepage into the water system poses yet another danger. For reasons that are not too well understood the Alberta Energy Board relaxed the size of the area for which the company must provide an emergency response plan from a radius of 18 km to a radius of 4 km, considered by experts to be totally unacceptable in a populated area. The Board granted the relaxation of the area covered by the emergency response plan on the assurances of the Company that it would substantially increase the criteria needed to make the plan manageable. However, the community is not convinced that the emergency response plan comes near to addressing the problem, and is prepared to oppose drilling of the well by all available means

  12. U.S. West Coast market developments

    International Nuclear Information System (INIS)

    Yamaguchi, N.D.

    1999-01-01

    The crude production, quality, oil product demand, imports and refinery capabilities of U.S. Petroleum Administration for Defence District Five (PADD -V) were discussed and the distinguishing characteristics of the PADD-V market were summarized. The seven states which make up US PADD-V include Alaska, Hawaii, Washington, Oregon, California, Nevada and Arizona. PADD-V is a unique petroleum market with strong ties to Canada. The only crude oil pipeline serving the area is the TransMountain pipeline which connects Alberta producers with British Columbia and Washington State. PADD-V has emerged as a significant customer of Canadian crude, and methyl tertiary butyl ether (MTBE) to California refiners producing reformulated gasoline. PADD-V refining capacity utilization is high and generally more sophisticated than refineries elsewhere, with higher actual throughput and product output slate higher in value. The large majority of PADD-V output is reformulated gasoline and diesel, aviation fuels, and conventional transport fuels. It is believed that as product demand continues, PADD-V may become an even more significant importer of refined product. The proposed ban on MTBE blending in gasoline could have a major impact on refinery operations and product trade. 14 figs

  13. The preliminary study on the alluvial stratigraphy of Peinan archaeological site, Taiwan

    Science.gov (United States)

    Yang, Hsiaochin; Chen, Wenshan; Yeh, Changkeng

    2015-04-01

    Many of the activities of prehistoric people who lived in Taiwan were concentrated around river terrace environments and seldom in alluvial environments which are resulting from the rapid tectonic uplift and high erosion rate of the late Cenozoic mountain belt. However, the Peinan archaeological site, one of the most important Neolithic sites in Taiwan because of the great amount of slate slab coffins and nephrite artifacts unearthed, is located at the bottom of Peinan Hill which is formed by the activity of Lichi and Luyeh Faults. According to the radioactive carbon dating results, the Peinan alluvial fan used as cemetery was lasted over 3,700 years (5700-2000 yr BP) but the related cultural formation was only lasted 400 years (3500-3100 yr BP). What have happened to the prehistoric people? As the stratigraphic record allows archaeologists to ascertain the effects of geological processes on the preservation of the archaeological record, determining which parts of the archaeological records are absent, which have potentially been preserved, and how fragmentary are the preserved portions of the records. The limitations that geologic processes impose on the archaeological record must be recognized and understood before meaningful interpretations of prehistory can be made. Therefore, the reconstruction of the landscape and stratigraphic records in archaeological site not only provides the paleo-environmental context but also helps to explain changes that occurred to human cultures over time.

  14. Geophysical study of the Peinan Archaeological Site, Taiwan

    Science.gov (United States)

    Tong, Lun-Tao; Lee, Kun-Hsiu; Yeh, Chang-Keng; Hwang, Yan-Tsong; Chien, Jeng-Ming

    2013-02-01

    The Peinan archaeological site is the most intact Neolithic village with slate coffin burial complexes in Taiwan. However, the area that potentially contains significant ancient remains is covered by dense vegetation. No reliable data show the distribution of the ancient village, and no geophysical investigation has been performed at this site. To evaluate various geophysical methods under the geological setting and surface condition of the site, the physical properties of the remains were measured and four geophysical methods involving magnetic, electromagnetic (EM), electrical resistivity tomography (ERT), and ground-penetrating radar (GPR) were tested along three parallel profiles. The results imply that the EM and magnetic methods are much cost-effective and suitable for investigating the entire area. GPR and ERT methods can provide high resolution subsurface image, which are much suitable for subsequently detail investigation. The EM and magnetic surveys were thus conducted over the entire Peinan Cultural Park to understand the distribution of the ancient building remains at the Peinan site. The results of this study were verified by subsequent excavations, which indicate that the EM survey was successful in delineating the majority of the ancient village because the basements of building are highly resistive in comparison to the background sediment. The results of this investigation suggest that the ancient village was broadly distributed over the eastern part of the Peinan Culture Park and extended to the southeast.

  15. BALKAN TARİHİ KARŞISINDA YAHYA KEMAL BEYATLI'NIN ŞİİRİ

    Directory of Open Access Journals (Sweden)

    Ramazan TOPDEMİR

    2015-12-01

    Full Text Available Poets, writers, artists, music lovers, artists, nation, nation, state, and future carry the state makes. Works of national and moral values of society form. Poets of the founders of the national identity, and spiritual architects. Beyatlı Yahya Kemal, the most important is a cornerstone of our identity. Turks in the Balkans to develop and spread of civilization and culture is based on deep slate. Turks in the Balkans, the struggles, victories, defeats, is treated to a wide range of social relations literature. Beyatlı poets of the birth of Yahya Kemal Balkan cities Skopje and the lyrical poems dealt with the moral and material direction. The poet spent his childhood and youth years in Skopje and the Balkans, sorrows, joys, aspirations takes a sensitive manner. Yahya Kemal, established Turkish architecture, with different perspectives on the history of the Balkan cities in Turkey by telling us yesterday, far from the shaft, and spiritual values, recalling the necessity to determine whether we're having our values gives the message. Yahya Kemal Balkan cities, especially focusing on the poetry of the social, cultural, and lyrical themes literature, Balkans brought the rich archive. Yahya Kemal and the Balkans drawing the attention of new generations, our history, our civilization in poetry in a different way to learn by.

  16. New findings for the use of NMR- and computer tomography for gauging the potential of drilling fluids to cause damage to rocks; Neue Erkenntnisse bei der Anwendung von NMR- und Computertomografie-Methoden im Rahmen der Bewertung des Traegerschaedigungspotentiales von Bohrfluessigkeiten

    Energy Technology Data Exchange (ETDEWEB)

    Zwaag, C. van der [Reservoir Labs. AS, Trondheim (Norway); Stallmach, F. [Univ. Leipzig (Germany). Fakultaet fuer Physik und Geowissenschaften; Hanssen, J.E. [MI/Anchor Drilling Fluids AS, Stavanger (Norway); Soergaard, E. [Norsk Hydro AS, Bergen (Norway); Toennesen, R. [Saga Petroleum ASA, Stavanger (Norway)

    1998-12-31

    Polyanionic cellulose, xanthane and ppolyglycole are standard additives for water-based drilling fluids. These are added to drilling liquids to control water loss, provide viscosity and inhibit slating. Filtration losses, which are unavoidable when drilling, cause scavenging polymers to penetrate the area around the drilled hole. This causes a number of different reactions with the surrounding rocks and may ultimately have a permanent influence on the flow conditions of hydrocarbons. The study mentioned above aimed at determining the damage potential of these additives. [Deutsch] Polyanionische Cellulose, Xanthan und Polyglykol sind uebliche Zusatzstoffe von wasserbasischen Bohrspuelungen. Diese werden Bohrfluessigkeiten zur Wasserverlustkontrolle, zur Viskositaetsbildung und zur Schieferinhibierung zugesetzt. Die beim Bohrprozess unvermeidlichen Filtrationsverluste fuehren dazu, dass Spuelungspolymere beim Bohren in den Bohrlochnahbereich eindringen. Die Beschaffenheit dieser Stoffe fuehrt nach dem Eindringen zu unterschiedlichen Reaktionen mit dem Traegergestein. Diese koennen letzten Endes einen dauerhaften Einfluss auf die Zuflussbedingungen von Kohlenwasserstoffen haben. Das Ziel der vorliegenden Studie war es, das Traegerschaedigungspotential der obengenannten Spuelungszusaetze zu charakterisieren. (orig.)

  17. EUVS Sounding Rocket Payload

    Science.gov (United States)

    Stern, Alan S.

    1996-01-01

    During the first half of this year (CY 1996), the EUVS project began preparations of the EUVS payload for the upcoming NASA sounding rocket flight 36.148CL, slated for launch on July 26, 1996 to observe and record a high-resolution (approx. 2 A FWHM) EUV spectrum of the planet Venus. These preparations were designed to improve the spectral resolution and sensitivity performance of the EUVS payload as well as prepare the payload for this upcoming mission. The following is a list of the EUVS project activities that have taken place since the beginning of this CY: (1) Applied a fresh, new SiC optical coating to our existing 2400 groove/mm grating to boost its reflectivity; (2) modified the Ranicon science detector to boost its detective quantum efficiency with the addition of a repeller grid; (3) constructed a new entrance slit plane to achieve 2 A FWHM spectral resolution; (4) prepared and held the Payload Initiation Conference (PIC) with the assigned NASA support team from Wallops Island for the upcoming 36.148CL flight (PIC held on March 8, 1996; see Attachment A); (5) began wavelength calibration activities of EUVS in the laboratory; (6) made arrangements for travel to WSMR to begin integration activities in preparation for the July 1996 launch; (7) paper detailing our previous EUVS Venus mission (NASA flight 36.117CL) published in Icarus (see Attachment B); and (8) continued data analysis of the previous EUVS mission 36.137CL (Spica occultation flight).

  18. Measuring campaign on an autonomous photovoltaic installation of 3 kW peak power; Campagne de mesures de l'installation autonome de 3,0 kWp a Soyhieres (JU)

    Energy Technology Data Exchange (ETDEWEB)

    Affolter, P.; Bezencon, B. [Solstis / SGI, Lausanne (Switzerland)

    2005-07-01

    The autonomous hybrid power generation system located at Soyhieres, northwestern Switzerland, comprises a photovoltaic array made of solar slates (SunslatesTM) and a diesel generator. The 3.0 kWp photovoltaic (PV) system is completely integrated into the roof annex of a farm producing wine according to the rules of organic agriculture. The system has been in operation since 1999 and its performance has been monitored between July 2003 and October 2004. The main results are as follows: a) the PV system operates well since its setting up and is correctly sized; b) the PV system delivers about 76% of the total annual energy demand; this sizing of the PV array leads to very seldom excess PV power generation; c) the losses of the system are mainly due to the necessity of cycling the battery (daily partial charging and discharging, that cause its warming up) and to its limited life-span, the latter resulting in a constantly decreasing efficiency for energy storage; d) the maximum power point (MPP) tracker installed on one part of the PV array does not significantly improve the power generation efficiency.

  19. The use of multisine excitations to characterise damage in structures

    Science.gov (United States)

    Vanhoenacker, K.; Schoukens, J.; Guillaume, P.; Vanlanduit, S.

    2004-01-01

    In order to detect the presence of damage and imperfections in materials, a new and promising method for non-destructive material testing has been developed. The technique focuses on the non-linear distortions that are present in the results of a frequency response function (FRF) or transfer function measurement of the sample. The kernel idea in the described method is to use well-chosen periodic excitations where only some of the considered frequency components are excited. The non-excited frequency lines are used to detect, qualify (even or odd non-linear distortions) and quantify (What is the level of the non-linear distortions?) the non-linear distortions. Undamaged materials are often essentially linear in their response. However, the non-linear behaviour of the same material increases significantly when damage appears. The method is applied in the field of damage detection and health monitoring. The method is illustrated by experiments on uncracked and cracked artificial slate beams used in civil constructions and during mechanical cyclic fatigue loading. The developed technique demonstrated to be a very fast and efficient tool to assess global damage in a material.

  20. TIGER Burned Brightly in JAMIC

    Science.gov (United States)

    Olson, Sandra L.; Kashiwagi, Takashi

    2001-01-01

    The Transition From Ignition to Flame Growth Under External Radiation in 3D (TIGER- 3D) experiment, which is slated to fly aboard the International Space Station, conducted a series of highly successful tests in collaboration with the University of Hokkaido using Japan's 10-sec JAMIC drop tower. The tests were conducted to test engineering versions of advanced flight diagnostics such as an infrared camera for detailed surface temperature measurements and an infrared spectroscopic array for gas-phase species concentrations and temperatures based on detailed spectral emissions in the near infrared. Shown in the top figure is a visible light image and in the bottom figure is an infrared image at 3.8 mm obtained during the microgravity tests. The images show flames burning across cellulose samples against a slow wind of a few centimeters per second (wind is from right to left). These flow velocities are typical of spacecraft ventilation systems that provide fresh air for the astronauts. The samples are ignited across the center with a hot wire, and the flame is allowed to spread upwind and/or downwind. As these images show, the flames prefer to spread upwind, into the fresh air, which is the exact opposite of flames on Earth, which spread much faster downwind, or with the airflow, as in forest fires.

  1. Continued Water-Based Phase Change Material Heat Exchanger Development

    Science.gov (United States)

    Hansen, Scott W.; Sheth, Rubik B.; Poynot, Joe; Giglio, Tony; Ungar, Gene K.

    2015-01-01

    In a cyclical heat load environment such as low Lunar orbit, a spacecraft's radiators are not sized to meet the full heat rejection demands. Traditionally, a supplemental heat rejection device (SHReD) such as an evaporator or sublimator is used to act as a "topper" to meet the additional heat rejection demands. Utilizing a Phase Change Material (PCM) heat exchanger (HX) as a SHReD provides an attractive alternative to evaporators and sublimators as PCM HX's do not use a consumable, thereby leading to reduced launch mass and volume requirements. In continued pursuit of water PCM HX development two full-scale, Orion sized water-based PCM HX's were constructed by Mezzo Technologies. These HX's were designed by applying prior research on freeze front propagation to a full-scale design. Design options considered included bladder restraint and clamping mechanisms, bladder manufacturing, tube patterns, fill/drain methods, manifold dimensions, weight optimization, and midplate designs. Two units, Units A and B, were constructed and differed only in their midplate design. Both units failed multiple times during testing. This report highlights learning outcomes from these tests and are applied to a final sub-scale PCM HX which is slated to be tested on the ISS in early 2017.

  2. RESEARCH ON THE DIGITAL SIMULATION FOR THE WHOLE PROCESS OF MARS EXPLORATION

    Directory of Open Access Journals (Sweden)

    L. Lyu

    2018-05-01

    Full Text Available China has paid considerable attention to space exploration and made great strides in the field. The first Chinese Mars Exploration Mission will be carried out in 2020. Digital simulation has been proved to be an effective and efficient means for planning and deduction in many fields. Thus, it was introduced for the Mars exploration in this paper and key technologies was researched above three aspects. First of all, complicated time-space benchmark was combed to support the interplanetary simulation. Secondly, the multi-resolution pyramid model and indexing strategy were adopted to preprocess the geographical environment data, which ensured the efficiency of data loading, browsing, and querying. Then, the activity objects were abstracted and modelled based on four aspects, including property, ephemeris, geometry, and behavior. Therefore, a digital simulation system, called Sino-Mars, was developed. The architecture of Sino- Mars consists of five layers, including data collection, data processing, scenario modelling, visualization and application layer. Using the Chinese Mars Exploration Mission slated for 2020 as an example, we demonstrated the capabilities of Sino-Mars for data integration, visualization, process deduction, and auxiliary analysis.

  3. Sacrum and Space. Hierotopy of Cephalonia Island (Preliminary Results of the Pilot Study

    Directory of Open Access Journals (Sweden)

    Ewa Maria Kocój

    2017-12-01

    Full Text Available The Byzantine and post-Byzantine cultural heritage of Greek islands and peninsulas is still a blank slate for most Europeans. Only a few scholars from outside Greece focus their scientific studies on artefacts and anything which could be considered as so-called intangible cultural heritage of the humanity. The objective of the study was to investigate the hierotopy of the religious heritage of Cephalonia. I was interested in whether the island has hierotopic spaces, saturated with special power and the resulting special creation in the islanders’ minds. I searched for the beliefs about the origins of these places, extraordinary events, or the related sacred figures and organizations of spaces in the places used by Cephalonians for religious worship. The article uses qualitative methods of scientific research applied from the emic perspectives (free interviews, explicit and implicit participatory observation, photographic documentation and analysis of visual material. The research also focused on the secondary (historic and ethnographic sources as well as on resources available on the Internet. The study has shown that an important role in Cephalonians’ religious imagination is played by the insular nature of the region and the elements: the sea surrounding the land and the earthquakes which cyclically strike the island. These specific natural conditions have given birth to local legends and hierotopic creations of places of religious worship. They have formed the pantheon of the holy figures, whose presence is emphasized by the specific hierotopy of the places of religious worship built on the island.

  4. Study of Climate Responsive Passive Design Features in Traditional Hill Architecture of Khyah Village in Hamirpur, Himachal Pradesh, India for Indoor Thermal Comfort

    Science.gov (United States)

    Sarkar, A.

    2013-03-01

    Vernacular architecture of any settlement is characterized by architecture and construction methods developed by the wisdom of the local masons and builders, often the inhabitants themselves, to provide thermal comfort to users in extreme outdoor uncomfortable climatic conditions, by using locally available building materials and by adopting construction technology which both were more responsive to their climatic and geographic condition. This paper will highlight the climate-responsiveness in the traditional architecture of Khyah village in Hamirpur district of Himachal Pradesh, having sub-tropical climatic condition. The plan of individual house, the cluster of houses and the overall settlement itself has been evolved from a process of understanding the local geo-climatic conditions which causes discomfort in both cold winter and hot summer months. Hence, the house plans were kept compact, thick adobe bricks were used for walls, pitched roof with attic and roof-covering of slate were employed and small window openings were provided with heavy timber shutter—all as a mean to retain indoor heat during cold winter months and also to prevent excessive heat-loss and heat-gains. The paper will also attempt to bring out the adaptive synchronized dynamic interactions between the various activities of inhabitants and their spatial environment, as a response to the local climatic conditions, from the physical survey of this traditional hill settlement.

  5. Complexity index indicates refinery capability, value

    International Nuclear Information System (INIS)

    Johnston, D.

    1996-01-01

    Refinery size usually is measured in terms of distillation capacity. Relative size, however, can be measured using refinery complexity--a concept developed by W.L. Nelson in the 1960s. Nelson developed the complexity index to quantify the relative cost of components that make up a refinery. It is a pure cost index that provides a relative measure of the construction costs of a particular refinery based on its crude and upgrading capacity. The Nelson index compares the costs of various upgrading units--such as a fluid catalytic cracking (FCC) unit or a catalytic reformer--to the cost of a crude distillation unit. Computation of the index is an attempt to quantify the relative cost of a refinery based on the added cost of various upgrading units and the relative upgrading capacity. A review of complexity calculations, and an explanation of how indices have changed, provide a simple means of determining the complexity of single refineries or refining regions. The impact of complexity on product slate is also examined in this paper

  6. On the crypto-explosive crater and its relation with gold mineralization in larma Au-U deposit

    International Nuclear Information System (INIS)

    Chen Guohua; Jing Hongxiang; Huang Shutao

    1998-01-01

    A new type of gold mineralization-controlling structure-hydrothermal crypto-explosive crater was identified at the Larma gold-uranium deposit in the border regions between Gansu and Sichuan provinces, western China. The hydrothermal crypto-explosive crater is ellipse-shaped at the surface, while funnel-like in profile. A silica-cap composed of hydrothermal siliceous breccia is distributed at the top of the crater, while hydrothermal crypto-explosive breccia are in the centre. The configuration of the crater is roughly consistent with the distribution of gold ore bodies. The formation mechanism of the crater is: first, a silica cap composed of hydrothermal siliceous metasomatic rock was formed at the contact area between the siliceous rock and the slate, and blocked the movement of hydrothermal fluid and resulted in the appearance of over-pressed geothermal environment. Then, at 49.5 Ma, the rejuvenation of the EW-striking faults in larma area resulted in the breaking of the brittle silica cap, followed by the crypto-explosion of hydrothermal fluid. In Larma gold-uranium deposit, the hydrothermal crypto-explosion gave rise to the precipitation of gold from the hydrothermal fluid, while the crypto-explosive crater provided the space for gold mineralization

  7. Inperkingsbevele

    Directory of Open Access Journals (Sweden)

    N. J. J. Olivier

    1981-03-01

    Full Text Available Banning orders have been issued since 1951 in terms o f the Internal Security Act 44 of 1950. Currently 109 banning orders are in force. They provide for the infringement of "inter alia” the rights to choose one’s own company, place of work and type of occupation, social contact is either very limited or non-existent. Banning orders have been justified in the light ofthe exciting dangers to the security of the slate, to the upholding of law and order and the threat of Communism. The Rabie Commission into Security Legislation has recommended that the present system bemaintained. In this paper the contents of banning orders are discussed with reference to juridical concepts such as the rule of law, human rights and the principles of natural justice. Banning orders are analyzed in terms of the "imago Dei”-concept and of what the Christian attitude to human rights should be. The exclusion of the common law revisionary powers of the Supreme Court and the absence of independent control are discussed. The recommendations of the Rabie Commission are analyzed and critized. One has to conclude that banning orders form a radical departure from the well-established principle that everyone is deemed innocent until his guilt has been adequately proved in an independent court o f law. This drastic deviation has not been remedied by the proposed Revision Committee whose independence and obligation to apply the rules o f natural justice are not absolute.

  8. Heat flow at the proposed Appalachian Ultradeep Core Hole (ADCOH) Site: Tectonic implications

    Science.gov (United States)

    Costain, John K.; Decker, Edward R.

    The heat flow in northwestern South Carolina at the Appalachian Ultradeep Core Hole (ADCOH) site area is approximately 55 mW/m². This data supplements other data to the east in the Piedmont and Atlantic Coastal Plain provinces where heat flows > 55 mW/m² are characteristic of post- and late-synmetamorphic granitoids. Piedmont heat flow and heat generation data for granites, metagranites, and one Slate Belt site, in a zone approximately parallel to major structural Appalachian trends, define a linear relation. Tectonic truncation of heat-producing crust at a depth of about 8 km (a depth equal to the slope of the heat flow-heat production line) is proposed to explain the linear relation. Using the value of reduced heat flow estimated from this empirical relation, and assuming thicknesses of heat-producing crust defined by new ADCOH seismic data, the heat flow and heat production at the ADCOH site are consistent with a depth to the base of the Inner Piedmont crystalline allochthon of about 5.5 km. Seismic data at the ADCOH site confirm that the Inner Piedmont is tectonically truncated at about 5.5 km by the Blue Ridge master decollement. Temperatures at 10 km at the ADCOH site are predicted to be less than 200 °C.

  9. SimpleTimeseries: Towards a Standard Representation of Astronomical Time-Series

    Science.gov (United States)

    Brewer, John Michael; Bloom, J. S.; Starr, D.

    2010-01-01

    Centuries of astrophysical data will soon be eclipsed by the unprecedented number of novel events regularly captured by large scale synoptic surveys. In the past, a stately accumulation of data could await inclusion in catalogs. More recently, digital catalogs have been placed on websites, or forwarded in e-mails. Fully exploiting the science opportunities of this new era will require much more rapid and standardized data exchange. With abundant novel sources to choose from, the limited followup resources available will need regularized data formats to help in decision making, whether the ultimate decisions lie with a human or a machine. The Berkeley Transients Classification Pipeline (TCP) has developed an XML based time-series format to exchange data within the context of the Palomar Transients Factory (PTF). The benefit of a standard time-series representation lies in promulgating it beyond just one collaboration and so we are publicly releasing the format, SimpleTimeseries. It is also slated to describe time-series within the the Virtual Observatory's upcoming VOEvent 2.0 specification. An XML based format allows easy processing by both machines and humans. We have put together examples and documentation which show the flexibilty of SimpleTimeseries on dotastro.org, where you can also find the XML schema, and public light curves in the new format.

  10. Europython 2006

    CERN Multimedia

    2006-01-01

    Europython 2006 - Annual Python Developer Conference, 3-5 July 2006, CERN Software developers from around the world will gather July 3-5 in Geneva, Switzerland for EuroPython 2006, the fifth annual conference for the Python programming language. The event is hosted this year at CERN, the birthplace of the Web, and promises an exciting slate of keynotes and talks. 'Python keeps growing each year, and EuroPython keeps getting better as well,' says Benedikt Hegner, host and one of the lead organizers for EuroPython 2006. 'This year saw Guido van Rossum, Python's creator, moving to Google with other key Python developers. Hosting EuroPython at CERN is a prestigious step for EuroPython as well. EuroPython 2006 will be keynoted both by Mr. van Rossum as well as Dr. Alan Kay, an originator of object-oriented programming and pioneer of graphical computing. The schedule has 3 days of talks in 8 tracks covering agile development, business, teaching, games, an expanded web frameworks track, and more. The organize...

  11. Oxygen isotopic composition of sulphates from some mineral waters and mine waters in western Bohemia

    International Nuclear Information System (INIS)

    Smejkal, V.

    1979-01-01

    Two main genetic types of sulphate can be distinguished according to the delta 18 O(SO 4 2- ) measurements in sulphate-rich mineral and mine waters of western Bohemia - sulphates in descending mine waters and in weathered outcrops of graphitic pyrite slates from areas outside Tertiary basins, which originated in recent time by the oxidation of sulphides in the presence of atmospheric oxygen, have delta 18 O values from -2.1 to -6.1 per mille SMOW; and sulphates from springs of mineral waters of the renowned spas of Karlovy Vary, Frantiskovy Lazne and Marianske Lazne show distinctly heavier delta 18 O values - from +4.0 to +6.4 per mille, with maximum of values between +5.0 and +6.0 per mille. Similar delta 18 O values have been established in thenardites and in gypsum in Miocene claystones and in sulphates of some mine waters in the nearby Tertiary Cheb and Sokolov Basins. The presented results indicate that sulphates in mineral waters of the Karlovy Vary type originate mainly by leaching of Miocene sulphates and not by present-day oxidation of sulphidic sulphur. (author)

  12. An overview of background environmental radiological surveillance around Kudankulam nuclear power project site

    International Nuclear Information System (INIS)

    Rajan, M.P.; Vijayakumar, B.; George, Thomas; Rajan, P.S.; Rana, B.K.; Kumar, M.; Hegde, A.G.; Chougaonkar, M.P.

    2005-01-01

    A modern Environmental Survey Laboratory (ESL) equipped with state-of-art nuclear counting, chemical and ecological equipment's has been set up at Kudankulam at the very beginning of construction activities to carry out pre operational and baseline radioactivity measurements. Construction activities for the two VVER type 1000 MWe reactors at the site are progressing ahead of schedule and the first unit is slated to be critical in the year 2007. This paper presents the results of environmental radiological surveillance carried out for the last one year in Kudankulam environs. General radiation background in the area varies in the range of 0.1 - 0.7 μGy/h and elevated levels as high as 20 μGy/h are noticed in beach areas. The major contribution to the background radiation in high background areas comes from 232 Th and its daughter products. The concentrations of 40 K are of normal order and comparable to other NPP sites and normal background areas. The concentrations of fallout nuclides are very low and are at global fallout levels. (author)

  13. Review of potential host rocks for radioactive waste disposal in the southeast United States-Southern Piedmont subregion

    International Nuclear Information System (INIS)

    1980-10-01

    A literature study was conducted on the geology of the Southern Piedmont province in the states of Maryland, Virginia, North Carolina, South Carolina, and Georgia. The purpose was to identify geologic areas potentially suitable for containment of a repository for the long-term isolation of solidified radioactive waste. The crystalline rocks of the Southern Piedmont province range in age from Precambrian to Paleozoic, and are predominantly slates, phyllites, argillites, schists, metavolcanics, gneisses, gabbros, and granites. These rock units were classified as either favorable, potentially favorable, or unfavorable as potential study areas based on an evaluation of the geologic, hydrologic, and geotechnical characteristics. No socio-economic factors were considered. Rocks subjected to multiple periods of deformation and metamorphism, or described as highly fractured, or of limited areal extent were generally ranked as unfavorable. Potentially favorable rocks are primarily the high-grade metamorphic gneisses and granites. Sixteen areas were classified as being favorable for additional study. These areas are primarily large igneous granite plutons as follows: the Petersburg granite in Virginia; the Rolesville-Castallia, Churchland, and Landis plutons in North Carolina; the Liberty Hill, Winnsboro, and Ogden plutons in South Carolina; and the Siloam, Elberton, and six unnamed granite plutons in Georgia

  14. Kan die kernwapenwedloop deur kern-wapenbeheer beëindig word?

    Directory of Open Access Journals (Sweden)

    A. W. van Tonder

    1983-03-01

    Full Text Available The slogans of the "walkers for peace " in the Uniled Slates of America anti in Western Europe (and also in South Africa against the proliferation of nuclear weapons and nuclear technology as well as the growing probability of a nuclear war in the light of president Reagan's rearmament plan, arc born of the numerous failures of nuclear disarmament and arms control. The ever- increasing danger that goes along with nuclear proliferation in the sense of weapon production and the handling of radioactive waste urges us to look more seriously than ever at nuclear technology. The article deals with some of the efforts to control the proliferation process as well as efforts to limit or reduce nuclear arms. Some essential  factors that negatively influence the discussions are pointed out and finally it is concluded that because of the sin-induced brokenness of man’s heart, control over nuclear arms proliferation has just partial success. The abolition of weapon production and total disarm­ ament are ideals that will, in this era that precedes the second coming of Christ, not be fulfilled. Thus, the nuclear arms race will inevitably continue.

  15. Migration of gases through fractured argillaceous rocks: experimental work at the Reskajeage Farm Quarry site, Cornwall

    International Nuclear Information System (INIS)

    Elliot, T.; Tomlinson, M.J.; Holbrough, D.J.; Searle, D.M.; Foxford, K.A.

    1989-03-01

    The objective of the fieldwork in the Cornish slate site was to attempt in-situ testing of gas permeabilities of single fracture systems in the formation using a downhole packer. Complementary hydraulic studies at the same site are currently in process, conducted by B Watkins of Elcon Western (electrical) Ltd, Redruth. Two boreholes, BH2 and BH14 have been gas flow tested at depths between 9.85-13.30 m and 22.40-28.00 m, respectively, using oxygen-free nitrogen. Altogether 24 flow sections have been logged and continuously flow-tested over periods ranging from 1-10 hours. Seven of these flow sections were tested until steady-state flow conditions had been achieved, and at six of these levels rising/falling pressure tests were then conducted. Pressure decay tests have been performed at four test levels which had been logged as having little or no measurable gas flow. For both boreholes the recovered core has been fully logged for fracture and lithological variations, and the identified flow sections have been correlated with these logs. In the case of BH14, successful impression packering of fracture/vein patterns in the borehole wall from 5.01-18.02 m depth has been made. The fractures recorded in the impressions have been correlated with fractures logged in the recovered core over the same section of the borehole. (author)

  16. The origin and relation among hot and cold CO{sub 2}-rich mineral waters in Vilarelho da Raia - Pedras Salgadas region, northern Portugal: A geochemical approach

    Energy Technology Data Exchange (ETDEWEB)

    Marques, J.M.; Aires-Barros, L.; Graca, R.C. [Technical Univ. of Lisbon, Lisboa (Portugal)

    1996-12-31

    Coupled isotopic and chemical studies, carried out on hot and cold CO{sub 2}-rich mineral waters discharging in Vilarelho da Raia - Pedras Salgadas region (northern Portugal), have been adopted to purpose some hypothesis on the origin and path-ways of fluids emerging along one of the major regional NNE-trending faults (the so called {open_quotes}Chaves Depression{close_quotes}). Chemical and isotopic ({delta}{sup 18}O and {delta}D) composition of Vilarelho da. Raia cold waters indicate that these waters could be traced as a ramification of the Chaves thermal waters. The enrichment in {sup 18}O and D content in Vidago and Pedras Salgadas cold waters could be attributed either to different recharge altitudes or mixing between deep regional waters with more recent waters derived from local infiltration, in accordance with {sup 3}H activity. Geothermometric interpretation indicates that hot and cold mineral waters have had deep circulation. Model calculations to estimate circulation depth of the groundwater flow system are also indicate deep (about 4km) circulation. Regarding the origin of CO{sub 2} in the thermal and cold mineral waters, two hypothesis could be considered: deep-seated (mantle degassing) or rock (graphitic slates) leaching.

  17. Proposed equation of state experimental program at NOVA/NIF

    International Nuclear Information System (INIS)

    Holmes, N.C.; Cauble, R.; Celliers, P.; Collins, G.; DaSilva, L.; Hammel, B.; Stewart, R.; Strand, O.; Sullivan, A.

    1996-03-01

    The high pressure equations of state of materials must be accurately known for confident design, simulation, and interpretation of ICF target experiments and for weapons. Here, the authors sketch out a program to perform precise and accurate equation of state (EOS) experiments using large, high-power lasers. The program is divided into three phases: (1) a driver qualification program which will determine the necessary drive and target design parameters; (2) characterization of low and high-Z standard materials; (3) accurate impedance-match experiments to determine equations of state of materials of interest relative to the qualified standards. Novel methods are proposed for the first phase which are an order of magnitude more sensitive than those applied previously. They identify and describe the choices for standards and the samples slated for initial studies. In all cases, their goal is to obtain data that is of sufficiently high quality to serve for design purposes and to validate theories of material response at high pressures of the order of 1--10 TPa. This is particularly important right now, for materials such as CH plastics and hydrogen (DT). In addition, they will suggest a program for EOS measurements for P > 10 TPa, the region of maximum theoretical EOS uncertainty for many materials

  18. The Art and Science of Systems Engineering

    Science.gov (United States)

    Singer, Christopher E.

    2009-01-01

    The National Aeronautics and Space Administration (NASA) was established in 1958, and its Marshall Space Flight Center was founded in 1960, as space-related work was transferred from the Army Ballistic Missile Agency at Redstone Arsenal, where Marshall is located. With this heritage, Marshall contributes almost 50 years of systems engineering experience with human-rated launch vehicles and scientific spacecraft to fulfill NASA's mission exploration and discovery. These complex, highly specialized systems have provided vital platforms for expanding the knowledge base about Earth, the solar system, and cosmos; developing new technologies that also benefit life on Earth; and opening new frontiers for America's strategic space goals. From Mercury and Gemini, to Apollo and the Space Shuttle, Marshall's systems engineering expertise is an unsurpassed foundational competency for NASA and the nation. Current assignments comprise managing Space Shuttle Propulsion systems; developing environmental control and life support systems and coordinating science operations on the International Space Station; and a number of exploration-related responsibilities. These include managing and performing science missions, such as the Lunar Crater Observation and Sensing Satellite and the Lunar Reconnaissance Orbiter slated to launch for the Moon in April 2009, to developing the Ares I crew launch vehicle upper stage and integrating the vehicle stack in house, as well as designing the Ares V cargo launch vehicle and contributing to the development of the Altair Lunar Lander and an International Lunar Network with communications nodes and other infrastructure.

  19. From the Island of the Blue Dolphins: A unique 19th century cache feature from San Nicolas Island, California

    Science.gov (United States)

    Erlandson, Jon M.; Thomas-Barnett, Lisa; Vellanoweth, René L.; Schwartz, Steven J.; Muhs, Daniel R.

    2013-01-01

    A cache feature salvaged from an eroding sea cliff on San Nicolas Island produced two redwood boxes containing more than 200 artifacts of Nicoleño, Native Alaskan, and Euro-American origin. Outside the boxes were four asphaltum-coated baskets, abalone shells, a sandstone dish, and a hafted stone knife. The boxes, made from split redwood planks, contained a variety of artifacts and numerous unmodified bones and teeth from marine mammals, fish, birds, and large land mammals. Nicoleño-style artifacts include 11 knives with redwood handles and stone blades, stone projectile points, steatite ornaments and effigies, a carved stone pipe, abraders and burnishing stones, bird bone whistles, bone and shell pendants, abalone shell dishes, and two unusual barbed shell fishhooks. Artifacts of Native Alaskan style include four bone toggling harpoons, two unilaterally barbed bone harpoon heads, bone harpoon fore-shafts, a ground slate blade, and an adze blade. Objects of Euro-American origin or materials include a brass button, metal harpoon blades, and ten flaked glass bifaces. The contents of the cache feature, dating to the early-to-mid nineteenth century, provide an extraordinary window on a time of European expansion and global economic development that created unique cultural interactions and social transformations.

  20. Plenary - safety culture and its relationship to economic value in the competitive market: a global perspective. Panel Discussion

    International Nuclear Information System (INIS)

    Sellman, Michael B.

    2001-01-01

    Full text of publication follows: These are times of great optimism within the nuclear power industry-the likes of which it has not experienced in more than two decades. Increased demand for electricity and continued environmental concerns have highlighted the worldwide need for a sustainable nuclear industry and have opened public dialogue about the possibility of the construction of new nuclear power plants. The recent power crisis in California and power shortages elsewhere have heightened this renewed interest in nuclear power. This new optimism within the industry must be backed by solid public support for the industry to once again flourish. This support will only come from absolute public confidence in the safety of nuclear power and the industry's ability to operate responsibly. Safety and safety culture are the foundation for the future growth of this industry, and thus, it is the overall theme of this conference and the major theme to be addressed by this distinguished slate of plenary speakers. Introductions: Thomas J. Lewis, Director, Administrations, Nuclear Management Company and Assistant General Chair. Welcome and Opening Remarks: James Lake, President, American Nuclear Society, Richard Abdoo, Chair of the Board and CEO, Wisconsin Electric Company. Setting the Stage for Safety Culture and Its Relationship to Economic Value: Michael B. Sellman, General Chair, 2001 Annual Meeting. Presentations: Commissioner Jeffrey Merrifield, U.S. Nuclear Regulatory Commission; Professor Shunsuke Kondo, University of Tokyo-Japan; David W. Bersoff, Director of the Yankelovich Monitor. (authors)

  1. Use of various types of carbon-containing raw materials to produce thermal energy

    Directory of Open Access Journals (Sweden)

    В. Б. Кусков

    2016-08-01

    Full Text Available Many types of carbon-containing organic compounds and all possible carbon-containing products or wastes in low demand can be used to produce thermal energy. A technology has been developed for producing highly flammable briquettes on the basis of bituminous coal. These briquettes have a special incendiary layer. It is easily ignites from low energy heat sources (e.g. matches, and then flame spreads to the rest of briquette. Use of coal slacks and paper wastes as carbon-containing components playing the role of binders provides an opportunity to get a fuel briquette easy in terms of production and plain in composition while at the same time dispose of coal and paper wastes. Such briquettes may also have a special incendiary layer. Technology for fuel briquettes production from wood and slate wastes employed no binding agents, as wood products acted as binders. Thus technologies have been developed to produce fuel briquettes from various carbon-containing materials in low demand. The briquettes are intended for household boilers, fireplaces, different ovens in order to cook food, heat residential and utility premises, cabins, etc.

  2. The ammonium content in the Malayer igneous and metamorphic rocks (Sanandaj-Sirjan Zone, Western Iran)

    Science.gov (United States)

    Ahadnejad, Vahid; Hirt, Ann Marie; Valizadeh, Mohammad-Vali; Bokani, Saeed Jabbari

    2011-04-01

    The ammonium (NH4+) contents of the Malayer area (Western Iran) have been determined by using the colorimetric method on 26 samples from igneous and metamorphic rocks. This is the first analysis of the ammonium contents of Iranian metamorphic and igneous rocks. The average ammonium content of metamorphic rocks decreases from low-grade to high-grade metamorphic rocks (in ppm): slate 580, phyllite 515, andalusite schist 242. In the case of igneous rocks, it decreases from felsic to mafic igneous types (in ppm): granites 39, monzonite 20, diorite 17, gabbro 10. Altered granitic rocks show enrichment in NH4+ (mean 61 ppm). The high concentration of ammonium in Malayer granites may indicate metasedimentary rocks as protoliths rather than meta-igneous rocks. These granitic rocks (S-types) have high K-bearing rock-forming minerals such as biotite, muscovite and K-feldspar which their potassium could substitute with ammonium. In addition, the high ammonium content of metasediments is probably due to inheritance of nitrogen from organic matter in the original sediments. The hydrothermally altered samples of granitic rocks show highly enrichment of ammonium suggesting external sources which intruded additional content by either interaction with metasedimentary country rocks or meteoritic solutions.

  3. Land use and second-generation biofuel feedstocks: The unconsidered impacts of Jatropha biodiesel in Rajasthan, India

    International Nuclear Information System (INIS)

    Findlater, K.M.; Kandlikar, M.

    2011-01-01

    Governments around the world see biofuels as a common solution to the multiple policy challenges posed by energy insecurity, climate change and falling farmer incomes. The Indian government has enthusiastically adopted a second-generation feedstock - the oilseed-bearing shrub, Jatropha curcas - for an ambitious national biodiesel program. Studies estimating the production capacity and potential land use implications of this program have typically assumed that the 'waste land' slated for Jatropha production has no economic value and that no activities of note will be displaced by plantation development. Here we examine the specific local impacts of rapid Jatropha plantation development on rural livelihoods and land use in Rajasthan, India. We find that in Jhadol Tehsil, Jatropha is planted on both government and private land, and has typically displaced grazing and forage collection. For those at the socioeconomic margins, these unconsidered impacts counteract the very benefits that the biofuel programs aim to create. The Rajasthan case demonstrates that local land-use impacts need to be integrated into decision-making for national targets and global biofuel promotion efforts. - Highlights: → Hardy biofuel crops like Jatropha replace edible feedstocks that use arable land. → In Rajasthan, Jatropha displaces grazing and forage on both public and private land. → As Jatropha plantations mature, the loss of grass becomes more pronounced. → Unconsidered impacts negate the benefits that the biodiesel program aims to create. → Local land-use impacts need to be integrated into decision-making.

  4. Land use and second-generation biofuel feedstocks: The unconsidered impacts of Jatropha biodiesel in Rajasthan, India

    Energy Technology Data Exchange (ETDEWEB)

    Findlater, K.M. [Institute for Resources Environment and Sustainability, University of British Columbia, 429-2202 Main Mall, Vancouver, BC, V6T1Z4 (Canada); Kandlikar, M., E-mail: milind.k@ubc.ca [Liu Institute for Global Studies, University of British Columbia, 6476 NW Marine Drive, Vancouver, BC, V6T1Z2 (Canada)

    2011-06-15

    Governments around the world see biofuels as a common solution to the multiple policy challenges posed by energy insecurity, climate change and falling farmer incomes. The Indian government has enthusiastically adopted a second-generation feedstock - the oilseed-bearing shrub, Jatropha curcas - for an ambitious national biodiesel program. Studies estimating the production capacity and potential land use implications of this program have typically assumed that the 'waste land' slated for Jatropha production has no economic value and that no activities of note will be displaced by plantation development. Here we examine the specific local impacts of rapid Jatropha plantation development on rural livelihoods and land use in Rajasthan, India. We find that in Jhadol Tehsil, Jatropha is planted on both government and private land, and has typically displaced grazing and forage collection. For those at the socioeconomic margins, these unconsidered impacts counteract the very benefits that the biofuel programs aim to create. The Rajasthan case demonstrates that local land-use impacts need to be integrated into decision-making for national targets and global biofuel promotion efforts. - Highlights: > Hardy biofuel crops like Jatropha replace edible feedstocks that use arable land. > In Rajasthan, Jatropha displaces grazing and forage on both public and private land. > As Jatropha plantations mature, the loss of grass becomes more pronounced. > Unconsidered impacts negate the benefits that the biodiesel program aims to create. > Local land-use impacts need to be integrated into decision-making.

  5. Range war: IPALCO's bid for PSI resources

    International Nuclear Information System (INIS)

    Studness, C.M.

    1993-01-01

    IPALCO Enterprises Inc. announced a hostile, unsolicited bid to acquire PSI Resources on March 15. IPALCO's bid for PSI is aggressive and well thought out, which befits the strong incentive that it had to take action. Besides topping Cincinnati Gas ampersand Electric's offering price made late last year, IPALCO took the initiative on three other fronts. First, it filed a lawsuit in federal court in Indianapolis to block the merger between PSI and Cincinnati. The suit claims that the proposed merger violates Indiana law and that PSI and Cincinnati have made false and misleading statements about the benefits of their proposed merger. Second, IPALCO announced it will oppose the merger between PSI and Cincinnati in proceedings before Indiana regulators. Third, IPALCO said it plans to nominate a slate of five candidates to stand election for PSI's Board of Directors at the company's annual shareholders meeting this spring. However, these initiatives and IPALCO's accompanying appeal to Hoosier loyality are little more than diversionary tactics. In the final analysis, whether PSI merges with IPALCO or with Cincinnati will depend rather simply on who is willing to make the highest bid

  6. USDA Forest Service Roadless Areas: Potential Biodiversity Conservation Reserves

    Directory of Open Access Journals (Sweden)

    Colby Loucks

    2003-12-01

    Full Text Available In January 2001, approximately 23 x 106 ha of land in the U.S. National Forest System were slated to remain roadless and protected from timber extraction under the Final Roadless Conservation Rule. We examined the potential contributions of these areas to the conservation of biodiversity. Using GIS, we analyzed the concordance of inventoried roadless areas (IRAs with ecoregion-scale biological importance and endangered and imperiled species distributions on a scale of 1:24,000. We found that more than 25% of IRAs are located in globally or regionally outstanding ecoregions and that 77% of inventoried roadless areas have the potential to conserve threatened, endangered, or imperiled species. IRAs would increase the conservation reserve network containing these species by 156%. We further illustrate the conservation potential of IRAs by highlighting their contribution to the conservation of the grizzly bear (Ursos arctos, a wide-ranging carnivore. The area created by the addition of IRAs to the existing system of conservation reserves shows a strong concordance with grizzly bear recovery zones and habitat range. Based on these findings, we conclude that IRAs belonging to the U.S. Forest Service are one of the most important biotic areas in the nation, and that their status as roadless areas could have lasting and far-reaching effects for biodiversity conservation.

  7. Overview and Status of the Ceph File System

    CERN Multimedia

    CERN. Geneva

    2017-01-01

    The Ceph file system (CephFS) is the POSIX-compatible distributed file system running on top of Ceph's powerful and stable object store. This presentation will give a general introduction of CephFS and detail the recent work the Ceph team has done to improve its stability and usability. In particular, we will cover directory fragmentation, multiple active metadata servers, and directory subtree pinning to metadata servers, features slated for stability in the imminent Luminous release. This talk will also give an overview of how we are measuring performance of multiple active metadata servers using large on-demand cloud deployments. The results will highlight how CephFS distributes metadata load across metadata servers to achieve scaling. About the speaker Patrick Donnelly is a software engineer at Red Hat, Inc. currently working on the Ceph distributed file system. In 2016 he completed his Ph.D. in computer science at the University of Notre Dame with a dissertation on the topic of file transfer management...

  8. Techno-Economic Evaluation of Technologies to Mitigate Greenhouse Gas Emissions at North American Refineries.

    Science.gov (United States)

    Motazedi, Kavan; Abella, Jessica P; Bergerson, Joule A

    2017-02-07

    A petroleum refinery model, Petroleum Refinery Life-cycle Inventory Model (PRELIM), that estimates energy use and CO 2 emissions was modified to evaluate the environmental and economic performance of a set of technologies to reduce CO 2 emissions at refineries. Cogeneration of heat and power (CHP), carbon capture at fluid catalytic cracker (FCC) and steam methane reformer (SMR) units, and alternative hydrogen production technologies were considered in the analysis. The results indicate that a 3-44% reduction in total annual refinery CO 2 emissions (2-24% reductions in the CO 2 emissions on a per barrel of crude oil processed) can be achieved in a medium conversion refinery that processes a typical U.S. crude slate obtained by using the technologies considered. A sensitivity analysis of the quality of input crude to a refinery, refinery configuration, and prices of natural gas and electricity revealed how the magnitude of possible CO 2 emissions reductions and the economic performance of the mitigation technologies can vary under different conditions. The analysis can help inform decision making related to investment decisions and CO 2 emissions policy in the refining sector.

  9. Product Life Cycle of the Manufactured Home Industry

    Directory of Open Access Journals (Sweden)

    Gavin Wherry

    2014-09-01

    Full Text Available Residential construction consumes an estimated 26 percent of the total U.S. wood harvest and thus plays an important role in the forest products value chain. While being a relatively small part of the U.S. residential construction market, the factory-built residential housing industry, originating from manufactured homes (e.g. mobile homes, is embracing emerging industry segments such as modular or panelized homes. Since indications exist that factory-built home production is slated to gain a more prominent role in the U.S. construction markets at the cost of traditional stick-built production, the factory-built home industry sub-segment is of considerable importance to the forest products industry. This research looks at manufactured home producers as a benchmark for analyzing the current economic state of the industry and discusses competitive strategies. The analysis concludes, through macroeconomic modeling, that manufactured homes are in the declining stage of their product life cycle due to changes to the U.S. residential construction sector and the factory-built home industry and by advancements of rival industry-segments. As market share continues to decline, firms operating in this industry-segment seek to either hedge their losses through product diversification strategies or remain focused on strategically repositioning the manufactured home segment.

  10. The Positive Impacts Of American Reinvestment And Recovery Act (ARRA) Funding To The Waste Management Program On Hanford's Plateau Remediation Project

    International Nuclear Information System (INIS)

    Blackford, L.T.

    2010-01-01

    In April 2009, the Department of Energy (DOE) Richland Operations Office (RL) was allocated $1.6 billion (B) in ARRA funding to be applied to cleanup projects at the Hanford Site. DOE-RL selected projects to receive ARRA funding based on 3-criteria: creating/saving jobs, reducing the footprint of the Hanford Site, and reducing life-cycle costs for cleanup. They further selected projects that were currently covered under regulatory documents and existing prime contracts, which allowed work to proceed quickly. CH2M HILL Plateau Remediation Company (CHPRC) is a prime contractor to the DOE focused on the environmental cleanup of the DOE Hanford Site Central Plateau. CHPRC was slated to receive $1.36B in ARRA funding. As of January, 2010, CHPRC has awarded over $200 million (M) in subcontracts (64% to small businesses), created more that 1,100 jobs, and touched more than 2,300 lives - all in support of long-term objectives for remediation of the Central Plateau, on or ahead of schedule. ARRA funding is being used to accelerate and augment cleanup activities already underway under the baseline Plateau Remediation Contract (PRC). This paper details challenges and accomplishments using ARRA funding to meet DOE-RL objectives of creating/saving jobs, expediting cleanup, and reducing lifecycle costs for cleanup during the first months of implementation.

  11. Making the grid the backup: Utility applications for fuel cell power

    Energy Technology Data Exchange (ETDEWEB)

    Eklof, S.L. [Sacramento Municipal Utility District (SMUD), Sacramento, CA (United States)

    1996-12-31

    Fuel cells are recognized as a versatile power generation option and accepted component of SMUD`s ART Program. SMUD has received wide support and recognition for promoting and implementing fuel cell power plants, as well as other innovative generation, based primarily on technological factors. Current economic and technical realities in the electric generation market highlight other important factors, such as the cost involved to develop a slate of such resources. The goal now is to develop only those select quality resources most likely to become commercially viable in the near future. The challenge becomes the identification of candidate technologies with the greatest potential, and then matching the technologies with the applications that will help to make them successful. Utility participation in this development is critical so as to provide the industry with case examples of advanced technologies that can be applied in a way beneficial to both the utility and its customers. The ART resource acquisitions provide the experience base upon which to guide this selection process, and should bring about the cost reductions and reliability improvements sought.

  12. GIS-based landslide susceptibility mapping for the 2005 Kashmir earthquake region

    Science.gov (United States)

    Kamp, Ulrich; Growley, Benjamin J.; Khattak, Ghazanfar A.; Owen, Lewis A.

    2008-11-01

    The Mw 7.6 October 8, 2005 Kashmir earthquake triggered several thousand landslides throughout the Himalaya of northern Pakistan and India. These were concentrated in six different geomorphic-geologic-anthropogenic settings. A spatial database, which included 2252 landslides, was developed and analyzed using ASTER satellite imagery and geographical information system (GIS) technology. A multi-criterion evaluation was applied to determine the significance of event-controlling parameters in triggering the landslides. The parameters included lithology, faults, slope gradient, slope aspect, elevation, land cover, rivers and roads. The results showed four classes of landslide susceptibility. Furthermore, they indicated that lithology had the strongest influence on landsliding, particularly when the rock is highly fractured, such as in shale, slate, clastic sediments, and limestone and dolomite. Moreover, the proximity of the landslides to faults, rivers, and roads was also an important factor in helping to initiate failures. In addition, landslides occurred particularly in moderate elevations on south facing slopes. Shrub land, grassland, and also agricultural land were highly susceptible to failures, while forested slopes had few landslides. One-third of the study area was highly or very highly susceptible to future landsliding and requires immediate mitigation action. The rest of the region had a low or moderate susceptibility to landsliding and remains relatively stable. This study supports the view that (1) earthquake-triggered landslides are concentrated in specific zones associated with event-controlling parameters; and (2) in the western Himalaya deforestation and road construction contributed significantly to landsliding during and shortly after earthquakes.

  13. Polyester projects for India, Pakistan

    International Nuclear Information System (INIS)

    Siddiqi, R.

    1993-01-01

    India's Indo Rama Synthetics (Bombay) is planning a $186-million integrated polyester fiber and filament complex at Nagpur, Maharashtra. The complex will have annual capacities for 38,000 m.t. of polyester chips by polycondensation, 25,000 m.t. of polyester staple fiber, and 12,000 m.t. of polyester blended yarn. The company is negotiating with the main world suppliers of polycondensation technology. The first stage of the project is slated to begin production by the end of this year and be fully completed by 1994. In Pakistan, National Fibers Ltd. (PNF; Karachi) has signed a deal with Zimmer (Frankfurt) for technology, procurement, construction, and support work to expand polyester staple fiber capacity from 14,000 m.t./year to 52,000 m.t./year. The technology involves a continuous polymerization process. The project also calls for improvements to PNF's existing batch plant. It is scheduled for completion by the end of 1994. Total cost of the project is estimated at Rs1.745 billion ($70 million), out of which the foreign exchange component is Rs1.05 billion. The Islamic Development Bank (Jeddah; Saudi Arabia) has already approved a $27-million slice of the financing, while the balance of the foreign exchange loan is being arranged through suppliers credit. Local currency loans will be provided by other financial institutions in Pakistan

  14. In Brief: Hidden environment and health costs of energy

    Science.gov (United States)

    Showstack, Randy

    2009-10-01

    The hidden costs of energy production and use in the United States amounted to an estimated $120 billion in 2005, according to a 19 October report by the U.S. National Research Council. The report, “Hidden Costs of Energy: Unpriced Consequences of Energy Production and Use,” examines hidden costs, including the cost of air pollution damage to human health, which are not reflected in market prices of energy sources, electricity, or gasoline. The report found that in 2005, the total annual external damages from sulfur dioxide, nitrogen oxides, and particulate matter created by coal-burning power plants that produced 95% of the nation's coal-generated electricity were about $62 billion, with nonclimate damages averaging about 3.2 cents for every kilowatt-hour of energy produced. It is estimated that by 2030, nonclimate damages will fall to 1.7 cents per kilowatt-hour. The 2030 figure assumes that new policies already slated for implementation are put in place.

  15. Assessing the elements mobility through the regolith and their potential as tracers for hydrological processes

    Science.gov (United States)

    Moragues-Quiroga, Cristina; Hissler, Christophe; Chabaux, François; Legout, Arnaud; Stille, Peter

    2017-04-01

    Regoliths encompass different materials from the fresh bedrock to the top of the organic horizons. The regolith is a major component of the critical zone where fluxes of water, energy, solutes and matter occur. Therefore, its bio-physico-chemical properties drastically impact the water that percolates and/or stores in its different parts (organic and mineral soil horizons, and weathered and fractured bedrock). In order to better understand the critical zone functioning, we propose to assess the interaction between chemical elements from the regolith matrix and water during drainage infiltration. For this, we focus firstly on the potential mobility of different groups of major and trace elements according to a leaching experiment made on 10 different layers of a 7.5 m depth slate regolith, which covers a large part of the Rhenish Massif. Secondly, we carried out Sr-Nd-Pb-U-Th isotope analyses for 5 of these samples in both the untreated and leached samples. Given the specific chemical and mineralogical composition of each sampled material, our approach enables to trace the origin of major and trace elements and eventually assess their mobility. The results deliver valuable information on exchange processes at the water-mineral interface in the different zones of the regolith, which could improve the selection of tracers for the study of hydrological processes.

  16. Major Refurbishment of the University of Florida Training Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Joradn, Kelly; Berglund, Matthew; Shea, Brian [Univ., of Florida, Florida (United States)

    2013-07-01

    The research reactor fleet is aging with few replacements being built. At the same time the technology for refurbishment of the older reactors has advanced well beyond that of currently installed equipment. The disparity between new and old technology results in an inability to find simple replacements for the older, highly integrated components. The lack of comprehensive guidance for digital equipment adds to the technical problems of installing individual replacement parts. Up to this point, no U. S. facilities have attempted a complete modernization effort because of the time commitment, financial burden, and licensing required for a total upgrade. The University of Florida Training Reactor is tackling this problem with a replacement of nearly all of the major facility sub-systems, including electrical distribution, reactor controls, nuclear instrumentation, security, building management, and environmental controls. This approach offers increased flexibility over the piece-by-piece replacement method by leveraging modern control systems based on global standards and capable of good data interchange with higher levels of redundancy. The UFTR reviewed numerous technologies to arrive at the final system architecture and this 'clean-slate' installation methodology. It is this concept of total system replacement and strict use of modular, open-standards technology that has allowed for a facility design that will be easy to install, maintain, and build upon over time.

  17. Site characterization report for Building 3506 at Oak Ridge National Laboratory, Oak Ridge, Tennessee. Environmental Restoration Program

    International Nuclear Information System (INIS)

    1994-07-01

    Building 3506, also known as the Waste Evaporator Facility, is a surplus facility at Oak Ridge National Laboratory (ORNL) slated for decontamination and decommissioning (D ampersand D). The building is located in the ORNL main plant area, to the west of the South Tank Farm and near the intersection of Central Avenue and Third Street. Characterization tasks consisted of three main activities: inspections, radiological measurements, and radiological and chemical sampling and analysis. Inspection reports document general facility conditions, as-built information, and specialized information such as structural evaluations. Radiological measurements define the quantity and distribution of radioactive contaminants; this information is used to calibrate a dose model of the facility and estimate the total activity, in curies, of each major radioactive isotope. The radiological information from sample analyses is used to refine the radiological model of the facility, and the radionuclide and hazardous chemical analyses are used for waste management planning. This report presents data from the field investigation and laboratory analyses in the form of a site description, as-built drawings, summary tables of radiological and chemical contaminant concentrations, and a waste volume estimate

  18. Discovery of Wolitu Pb-Zn deposit through geochemical prospecting under loess cover in Inner Mongolia, China

    Directory of Open Access Journals (Sweden)

    Fan Yang

    2017-09-01

    Full Text Available We report the finding of the Wolitu Pb-Zn deposit in Inner Mongolia, China, through a series of geochemical surveys. The Wolitu area, located in the loess-cover area in the Hure Banner, Tongliao City, Inner Mongolia, and neighboring the Horqin Sandy Land to the north, had no previous history of Pb-Zn mining or record of Pb-Zn mineralization. Our study identified a large Pb-Zn anomaly with potential zones of mineralization by stream sediment survey. Random rock sampling reveals limonitization at sporadic outcrops in the gullies. The high concentrations of Pb in the residual debris provided guidelines to fix the position for exploratory trench. Oxidized concealed orebodies were identified by trenching. Blind orebodies in veins hosted within the structural zone between slates and marbles of the upper Carboniferous Shizuizi Formation and the Permian granite were discovered by drilling. It is computed that the ore reserve may reach up to 540,000 tones with Pb grade of 1.27% and Zn of 1.9%. This case study is an excellent example for identifying potential polymetallic deposits in loess covered terrains using geochemical exploration.

  19. Constraints and prospects of uranium exploration in Himalaya

    International Nuclear Information System (INIS)

    Singh, Rajendra

    1994-01-01

    Exploration for uranium in the Himalaya over the last thirty years has brought to light five distinct types of mineralisation, namely, vein-type, hydrothermal shear controlled-type, disseminated-type, syngenetic-type, and sandstone-type. The first three are associated with lower to middle proterozoic metasedimentary rocks, metabasic rocks, and granitoids of the lesser Himalaya in close proximity to the main central thrust (MCT). The carbonaceous slates of Haimanta group (late proterozoic to eocambrian) and the Mussoorie phosphorites (eocambrian) represent the syngenetic types. The sandstone-type is associated with the late tertiary Siwaliks of the northwestern Himalaya. The constraints in geology and uranium exploration in the Himalaya have been briefly discussed and principal uranium occurrences in relation to their tectonic environment and genesis listed. The need for geochemical characterization of the Himalayan granitoids and the metabasics related to known uranium mineralisation and new areas have been suggested. Integrated application of radiometric, geochemical and geophysical methods of prospecting and remote sensing techniques in regional geological correlation, identification of subtle rock alterations associated with mineralized zones, geologic structures, and deep crustal lineaments have been advocated. A case for the exploration of the areas of lesser Himalaya outside the MCT has been made out so as to locate hitherto unknown types of uranium deposits including, strata bound, metamorphic, and intra granitic types, possibly with better depth persistence. (author). 57 refs., 1 fig., 2 tabs

  20. Retardation of radionuclide transport by fracture flow in granite and argillaceous rocks

    International Nuclear Information System (INIS)

    Bradbury, M.H.; Green, A.

    1985-11-01

    Laboratory techniques have been developed for the measurement of diffusion rates and permeabilities through highly consolidated rock samples. The work has predominantly concentrated on the generation of diffusion data for slates and granites in particular. Rock properties fundamental to mass transfer processes have been obtained. Diffusion rates have been measured through weathered granite fissure surfaces and as a function of distance from such surfaces on core samples obtained from Troon, Cornwall. Pore connectivity over metre distances in granite cores has been shown to exist and diffusion coefficients were measured as a function of confining pressure in a specially designed rig. The Dsub(i) (intrinsic diffusion coefficient) values determined at ambient pressure were approximately a factor of 2 greater than those measured at pressures equivalent to 500 m of rock overburden. Some initial experiments on the accessibility of the pore space in granites to colloids based on a permeability technique indicated that such particles neither blocked pores nor penetrated through 15 mm thick samples over times of the order 2 to 3 thousand hours. Diffusion rates through samples of Canadian granites, some of which contained weathered fissure surfaces, were measured. (author)

  1. The LLNL portable tritium processing system

    International Nuclear Information System (INIS)

    Anon.

    1995-01-01

    The end of the Cold War significantly reduced the need for facilities to handle radioactive materials for the US nuclear weapons program. The LLNL Tritium Facility was among those slated for decommissioning. The plans for the facility have since been reversed, and it remains open. Nevertheless, in the early 1990s, the cleanup (the Tritium Inventory Removal Project) was undertaken. However, removing the inventory of tritium within the facility and cleaning up any pockets of high-level residual contamination required that we design a system adequate to the task and meeting today's stringent standards of worker and environmental protection. In collaboration with Sandia National Laboratory and EG ampersand G Mound Applied Technologies, we fabricated a three-module Portable Tritium Processing System (PTPS) that meets current glovebox standards, is operated from a portable console, and is movable from laboratory to laboratory for performing the basic tritium processing operations: pumping and gas transfer, gas analysis, and gas-phase tritium scrubbing. The Tritium Inventory Removal Project is now in its final year, and the portable system continues to be the workhorse. To meet a strong demand for tritium services, the LLNL Tritium Facility will be reconfigured to provide state-of-the-art tritium and radioactive decontamination research and development. The PTPS will play a key role in this new facility

  2. AVGS, AR and D for Satellites, ISS, the Moon, Mars and Beyond

    Science.gov (United States)

    Hintze, Geoffrey C.; Cornett, Keith G.; Rahmatipour, Michael H.; Heaton, Andrew F.; Newman, Larry E.; Fleischmann, Kevin D.; Hamby, Byron J.

    2007-01-01

    With the continuous need to rotate crew and re-supply the International Space Station (ISS) and the desire to return humans to the Moon and for the first time, place humans on Mars, NASA must develop a more robust and highly reliable capability to perform Autonomous Rendezvous and Capture (AR&C) because, unlike the Apollo missions, NASA plans to send the entire crew to the Lunar or Martian surface and must be able to dock with the Orion spacecraft upon return. In 1997, NASA developed the Video Guidance Sensor (VGS) which was flown and tested on STS-87 and STS-95. In 2001, NASA designed and built a more enhanced version of the VGS, called the Advanced Video Guidance Sensor (AVGS). The AVGS offered significant technology improvements to the precursor VGS design. This paper will describe the AVGS as it was in the DART mission of 2005 and the Orbital Express mission of 2007. The paper will describe the capabilities and design concepts of the AVGS as it was flown on the DART 2005 Mission and the DARPA Orbital Express Mission slated to fly in 2007. The paper will cover the Flight Software, problems encountered, testing for Orbital Express and where NASA is going in the future.

  3. Minority politics in the house of medicine: the physicians forum and the New York County Medical Society, 1938-1965.

    Science.gov (United States)

    Brickman, J P

    1999-01-01

    The late 1930s challenged laissez-faire medicine. Recognition of serious inadequacies in the distribution of medical services stirred activists who questioned fee-for-service delivery and posited a national health program, including health insurance. The AMA and its components--state and county medical societies--counterattacked, mobilizing money and their powerful political arsenal to fight government intrusion in private medicine. The Physicians Forum, initially under the leadership of Ernst P. Boas, emerged as a formidable element within the New York County Medical Society (the largest component of the AMA). The Forum provoked discussion of medical indigence and economics, upsetting the Society leadership with independent candidate slates and telling the public that doctors spoke with more than one voice. For 25 years, the Physicians Forum altered the dynamics of the Medical Society of the County of New York. While the Forum effort to institutionalize minority opinion in the councils of medicine failed, the interchange between County regulars and Forum insurgents broadened the medical reform agenda and moved the County Society in directions that historically it had avoided. Although medical economics formed an unbridgeable chasm between County regulars and rebels, Forum members demonstrated that medicine was not monolithic, that "majority opinion [was not] ... unanimous opinion," and that doctors must speak to issues of medical and social policy.

  4. Comparison of mechanical concepts for $Nb_3Sn$ high field accelerator magnets

    CERN Document Server

    AUTHOR|(CDS)2084469; Peter, Schmolz

    Several magnets using Nb$_{3}$Sn as conductor are currently developed at CERN; these magnets are either slated for future updates of the LHC or for research purposes relating to future accelerators. The mechanical structure is one of the challenging aspects of superconducting high-field magnets. The main purpose of the mechanical structure is to keep the coils in compression till the emergence of the highest electromagnetic forces that are developed in the ultimate field of the magnet. Any loss of pre-compression during the magnet’s excitation would cause too large deformation of the coil and possibly a quench in the conductor owing to relative movements of strands in contact associated with excessive local heat release. However, too high pre-compression would overstrain the conductor and thereby limit the performance of the magnet. This thesis focuses on the mechanical behaviour of three of these magnets. All of them are based on different mechanical designs, “bladder and key” and “collar-based”, ...

  5. Contribución al estudio litológico de los materiales empleados en monumentos de Córdoba de distintas épocas

    Directory of Open Access Journals (Sweden)

    Barrios-Neira, J.

    2003-12-01

    Full Text Available This work studies the different types of construction materials in monuments in Cordova during different eras and cultures. Usual techniques have been used to determine mineralogical, chemical and petrostructural elements, etc. The most used materials are biocalcarenites from the Miocene period. Other materials include Cambrian limestone, Tithonian limestone, marble, granite, slate, bricks, pressed earth, etc. Monuments are cited from Roman and Arabic eras, and from the 8th to the 19th and 20th century.En este trabajo se estudian los diferentes tipos de materiales de construcción en monumentos de Córdoba durante distintas épocas y culturas. Se han utilizado las técnicas habituales para la determinación mineralógica, química , petroestructural, etc. Los materiales más empleados son las biocalcarenitas del Mioceno. También se han empleado calizas cámbricas, calizas del Titónico, mármoles, granitos, esquistos, ladrillos, tierra prensada, etc. Se citan algunos monumentos realizados en las épocas: romana, árabe, s. XIII al XIX y s. XX.

  6. Comparison of Four Nitrate Removal Kinetic Models in Two Distinct Wetland Restoration Mesocosm Systems

    Directory of Open Access Journals (Sweden)

    Tiffany L. Messer

    2017-07-01

    Full Text Available The objective of the study was to determine the kinetic model that best fit observed nitrate removal rates at the mesocosm scale in order to determine ideal loading rates for two future wetland restorations slated to receive pulse flow agricultural drainage water. Four nitrate removal models were investigated: zero order, first order decay, efficiency loss, and Monod. Wetland mesocosms were constructed using the primary soil type (in triplicate at each of the future wetland restoration sites. Eighteen mesocosm experiments were conducted over two years across seasons. Simulated drainage water was loaded into wetlands as batches, with target nitrate-N levels typically observed in agricultural drainage water (between 2.5 and 10 mg L−1. Nitrate-N removal observed during the experiments provided the basis for calibration and validation of the models. When the predictive strength of each of the four models was assessed, results indicated that the efficiency loss and first order decay models provided the strongest agreement between predicted and measured NO3-N removal rates, and the fit between the two models were comparable. Since the predictive power of these two models were similar, the less complicated first order decay model appeared to be the best choice in predicting appropriate loading rates for the future full-scale wetland restorations.

  7. Disposal of TRU Waste from the PFP in pipe overpack containers to WIPP Including New Security Requirements

    International Nuclear Information System (INIS)

    HOPKINS, A.M.

    2003-01-01

    The Department of Energy is responsible for the safe management and cleanup of the DOE complex. As part of the cleanup and closure of the Plutonium Finishing Plant (PFP) located on the Hanford site, the nuclear material inventory was reviewed to determine the appropriate disposition path. Based on the nuclear material characteristics, the material was designated for stabilization and packaging for long term storage and transfer to the Savannah River Site, or a decision for discard was made. The discarded material was designated as waste material and slated for disposal to the Waste Isolation Pilot Plant (WIPP). Prior to preparing any residue wastes for disposal at the WIPP, several major activities need to be completed. As detailed a processing history as possible of the material including origin of the waste must be researched and documented. A technical basis for termination of safeguards on the material must be prepared and approved. Utilizing process knowledge and processing history, the material must be characterized, sampling requirements determined, acceptable knowledge package and waste designation completed prior to disposal. All of these activities involve several organizations including the contractor, DOE, state representatives and other regulators such as EPA. At PFP, a process has been developed for meeting the many, varied requirements and successfully used to prepare several residue waste streams including Rocky Flats incinerator ash, hanford incinerator ash and Sand, Slag and Crucible (SS and C) material for disposal. These waste residues are packed into Pipe Overpack Containers for shipment to the WIPP

  8. A Two-Ocean Bouillabaisse: Science, Politics, and the Central American Sea-Level Canal Controversy.

    Science.gov (United States)

    Keiner, Christine

    2017-11-01

    As the Panama Canal approached its fiftieth anniversary in the mid-1960s, U.S. officials concerned about the costs of modernization welcomed the technology of peaceful nuclear excavation to create a new waterway at sea level. Biologists seeking a share of the funds slated for radiological-safety studies called attention to another potential effect which they deemed of far greater ecological and evolutionary magnitude - marine species exchange, an obscure environmental issue that required the expertise of underresourced life scientists. An enterprising endeavor to support Smithsonian naturalists, especially marine biologists at the Smithsonian Tropical Research Institute in Panama, wound up sparking heated debates - between biologists and engineers about the oceans' biological integrity and among scientists about whether the megaproject represented a research opportunity or environmental threat. A National Academy of Sciences panel chaired by Ernst Mayr failed to attract congressional funding for its 10-year baseline research program, but did create a stir in the scientific and mainstream press about the ecological threats that the sea-level canal might unleash upon the Atlantic and Pacific. This paper examines how the proposed megaproject sparked a scientific and political conversation about the risks of mixing the oceans at a time when many members of the scientific and engineering communities still viewed the seas as impervious to human-facilitated change.

  9. Biointrusion test plan for the Permanent Isolation Surface Barrier Prototype

    International Nuclear Information System (INIS)

    Link, S.O.; Cadwell, L.L.; Brandt, C.A.; Downs, J.L.; Rossi, R.E.; Gee, G.W.

    1994-04-01

    This document provides a testing and monitoring plan for the biological component of the prototype barrier slated for construction at the Hanford Site. The prototype barrier is an aboveground structure engineered to demonstrate the basic features of an earthen cover system. It is designed to permanently isolate waste from the biosphere. The features of the barrier include multiple layers of soil and rock materials and a low-permeability asphalt sublayer. The surface of the barrier consists of silt loam soil, covered with plants. The barrier sides are reinforced with rock or coarse earthen-fill to protect against wind and water erosion. The sublayers inhibit plant and animal intrusion and percolation of water. A series of tests will be conducted on the prototype barrier over the next several years to evaluate barrier performance under extreme climatic conditions. Plants and animals will play a significant role in the hydrologic and water and wind erosion characteristics of the prototype barrier. Studies on the biological component of the prototype barrier will include work on the initial revegetation of the surface, continued monitoring of the developing plant community, rooting depth and dispersion in the context of biointrusion potential, the role of plants in the hydrology of the surface and toe regions of the barrier, the role of plants in stabilizing the surface against water and wind erosion, and the role of burrowing animals in the hydrology and water and wind erosion of the barrier

  10. Proceedings of RIKEN BNL Research Center Workshop: The Approach to Equilibrium in Strongly Interacting Matter. Volume 118

    Energy Technology Data Exchange (ETDEWEB)

    Liao, J. [Brookhaven National Lab. (BNL), Upton, NY (United States); Venugopalan, R. [Brookhaven National Lab. (BNL), Upton, NY (United States); Berges, J. [Brookhaven National Lab. (BNL), Upton, NY (United States); Blaizot, J. -P. [Brookhaven National Lab. (BNL), Upton, NY (United States); Gelis, F. [Brookhaven National Lab. (BNL), Upton, NY (United States)

    2014-04-09

    The RIKEN BNL Research Center (RBRC) was established in April 1997 at Brookhaven National Laboratory*. It is funded by the ''Rikagaku Kenkyusho'' (RIKEN, The Institute of Physical and Chemical Research) of Japan and the U. S. Department of Energy’s Office of Science. The RBRC is dedicated to the study of strong interactions, including spin physics, lattice QCD, and RHIC physics through the nurturing of a new generation of young physicists. The RBRC has theory, lattice gauge computing and experimental components. It is presently exploring the possibility of an astrophysics component being added to the program. The purpose of this Workshop is to critically review the recent progress on the theory and phenomenology of early time dynamics in relativistic heavy ion collisions from RHIC to LHC energies, to examine the various approaches on thermalization and existing issues, and to formulate new research efforts for the future. Topics slated to be covered include Experimental evidence for equilibration/isotropization, comparison of various approaches, dependence on the initial conditions and couplings, and turbulent cascades and Bose-Einstein condensation.

  11. Exobiological implications of dust aggregation in planetary atmospheres: An experiment for the gas-grain simulation facility

    Science.gov (United States)

    Huntington, J. L.; Schwartz, D. E.; Marshall, J. R.

    1991-01-01

    The Gas-Grain Simulation Facility (GGSF) will provide a microgravity environment where undesirable environmental effects are reduced, and thus, experiments involving interactions between small particles and grains can be more suitably performed. Slated for flight aboard the Shuttle in 1992, the ESA glovebox will serve as a scientific and technological testbed for GGSF exobiology experiments as well as generating some basic scientific data. Initial glovebox experiments will test a method of generating a stable, mono-dispersed cloud of fine particles using a vibrating sprinkler system. In the absence of gravity and atmospheric turbulence, it will be possible to determine the influence of interparticle forces in controlling the rate and mode of aggregation. The experimental chamber can be purged of suspended matter to enable multiple repetitions of the experiments. Of particular interest will be the number of particles per unit volume of the chamber, because it is suspected that aggregation will occur extremely rapidly if the number exceeds a critical value. All aggregation events will be recorded on high-resolution video film. Changes in the experimental procedure as a result of surprise events will be accompanied by real-time interaction with the mission specialist during the Shuttle flight.

  12. Optimization of refinery product blending by using linear programming

    International Nuclear Information System (INIS)

    Ristikj, Julija; Tripcheva-Trajkovska, Loreta; Rikaloski, Ice; Markovska, Liljana

    1999-01-01

    The product slate of a simple refinery consists mainly of liquefied petroleum gas, leaded and unleaded gasoline, jet fuel, diesel fuel, extra light heating oil and fuel oil. The quality of the oil products (fuels) for sale has to comply with the adopted standards for liquid fuels, and the produced quantities have to be comply with the market needs. The oil products are manufactured by blending two or more different fractions which quantities and physical-chemical properties depend on the crude oil type, the way and conditions of processing, and at the same time the fractions are used to blend one or more products. It is in producer's interest to do the blending in an optimal way, namely, to satisfy the requirements for the oil products quality and quantity with a maximal usage of the available fractions and, of course, with a maximal profit out of the sold products. This could be accomplished by applying linear programming, that is by using a linear model for oil products blending optimization. (Author)

  13. Tablet PC interaction with digital micromirror device (DMD)

    Science.gov (United States)

    Refai, Hakki H.; Dahshan, Mostafa H.; Sluss, James J., Jr.

    2007-02-01

    Digital light processing (DLP) is an innovative display technology that uses an optical switch array, known as a digital micromirror device (DMD), which allows digital control of light. To date, DMDs have been used primarily as high-speed spatial light modulators for projector applications. A tablet PC is a notebook or slate-shaped mobile PC. Its touch screen or digitizing tablet technology allows the user to operate the notebook with a stylus or digital pen instead of using a keyboard or mouse. In this paper, we describe an interface solution that translates any sketch on the tablet PC screen to an identical mirror-copy over the cross-section of the DMD micromirrors such that the image of the sketch can be projected onto a special screen. An algorithm has been created to control each single micromirror of the hundreds of thousands of micromirrors that cover the DMD surface. We demonstrate the successful application of a DMD to a high-speed two-dimensional (2D) scanning environment, acquiring the data from the tablet screen and launching its contents to the projection screen; with very high accuracy up to 13.68 μm x 13.68 μm of mirror pitch.

  14. SMUD: a utility helping create the solar century

    International Nuclear Information System (INIS)

    Osborn, D.

    2000-01-01

    An overview of the work of the Sacramento Municipal Utility District (SMUD) in supplying electricity and energy to customers in California is presented, and details are given of the Sustained, Orderly Development and Commercialisation (SODC) strategy of SMUD which is one of the largest public utilities in the USA. The partnership of SMUD with its customers hosting SMUD owned PV roof systems launched in the PV Pioneer 1 Programme in 1993, and the PV Pioneer 2 Programme which offered customers the ability to own their rooftop solar power plants are discussed along with the Neighbourhood PV Pioneers involving the combination of household rooftop PV systems with systems on the roofs of commercial buildings, and the PV systems over parking lots offering shade to cars while producing energy. Building integrated PV (BIPV) systems, the Powerlight PV roofing system installed on the Western Area power Administration office building, Atlantis SunSlate energy roofs, SMUD's commercial BIPV programme, and substation-sited PV systems using solar trackers and supplying Sacramento with power are among the projects described. The economic benefits of the Sacramento PV factory and niche market applications are considered

  15. Office of River Protection Integrated Safety Management System Phase 1 Verification Corrective Action Plan; FINAL

    International Nuclear Information System (INIS)

    CLARK, D.L.

    1999-01-01

    The purpose of this Corrective Action Plan is to demonstrate the OW planned and/or completed actions to implement ISMS as well as prepare for the RPP ISMS Phase II Verification scheduled for August, 1999. This Plan collates implied or explicit ORP actions identified in several key ISMS documents and aligns those actions and responsibilities perceived necessary to appropriately disposition all ISM Phase II preparation activities specific to the ORP. The objective will be to complete or disposition the corrective actions prior to the commencement of the ISMS Phase II Verification. Improvement products/tasks not slated for completion prior to the RPP Phase II verification will be incorporated as corrective actions into the Strategic System Execution Plan (SSEP) Gap Analysis. Many of the business and management systems that were reviewed in the ISMS Phase I verification are being modified to support the ORP transition and are being assessed through the SSEP. The actions and processes identified in the SSEP will support the development of the ORP and continued ISMS implementation as committed to be complete by end of FY-2000

  16. Office of River Protection Integrated Safety Management System Phase 1 Verification Corrective Action Plan

    International Nuclear Information System (INIS)

    CLARK, D.L.

    1999-01-01

    The purpose of this Corrective Action Plan is to demonstrate the OW planned and/or completed actions to implement ISMS as well as prepare for the RPP ISMS Phase II Verification scheduled for August, 1999. This Plan collates implied or explicit ORP actions identified in several key ISMS documents and aligns those actions and responsibilities perceived necessary to appropriately disposition all ISM Phase II preparation activities specific to the ORP. The objective will be to complete or disposition the corrective actions prior to the commencement of the ISMS Phase II Verification. Improvement products/tasks not slated for completion prior to the RPP Phase II verification will be incorporated as corrective actions into the Strategic System Execution Plan (SSEP) Gap Analysis. Many of the business and management systems that were reviewed in the ISMS Phase I verification are being modified to support the ORP transition and are being assessed through the SSEP. The actions and processes identified in the SSEP will support the development of the ORP and continued ISMS implementation as committed to be complete by end of FY-2000

  17. Building the "fable hospital"--the CEO's perspective: an interview with Michael H. Covert, president and chief executive officer, Palomar Pomerado Health. Interview by David A Tam.

    Science.gov (United States)

    Covert, Michael

    2012-01-01

    Hospital construction is a significant event in any health system. The financial implications are great, especially at a time of shrinking capital resources. Personnel are affected, as are the processes to perform their tasks. Often, new facilities are catalysts that change organizational culture; it has been clearly shown that new facilities have a positive impact on patient satisfaction scores. The members of the C-suite of a hospital/health system play important roles in construction projects. However, no one is more critical to the success of such major endeavors than the chief executive officer (CEO). The CEO sets the tone for the project, giving direction to the design and construction process that may have implications for the rest of the organization. Palomar Pomerado Health (PPH) is the largest public health district in California. In 2002, the PPH governing board authorized the creation of a new facility master plan for the district, which included the construction of a replacement facility for its tertiary care trauma center. The new Palomar Medical Center is slated to open in August 2012. HERD had the opportunity to speak with PPH CEO Michael H. Covert on the role of the CEO in the building of this "fable hospital".

  18. THE ADIABATIC DEMAGNETIZATION REFRIGERATOR FOR THE MICRO-X SOUNDING ROCKET TELESCOPE

    International Nuclear Information System (INIS)

    Wikus, P.; Bagdasarova, Y.; Figueroa-Feliciano, E.; Leman, S. W.; Rutherford, J. M.; Trowbridge, S. N.; Adams, J. S.; Bandler, S. R.; Eckart, M. E.; Kelley, R. L.; Kilbourne, C. A.; Porter, F. S.; Doriese, W. B.; McCammon, D.

    2010-01-01

    The Micro-X Imaging X-ray Spectrometer is a sounding rocket payload slated for launch in 2011. An array of Transition Edge Sensors, which is operated at a bath temperature of 50 mK, will be used to obtain a high resolution spectrum of the Puppis-A supernova remnant. An Adiabatic Demagnetization Refrigerator (ADR) with a 75 gram Ferric Ammonium Alum (FAA) salt pill in the bore of a 4 T superconducting magnet provides a stable heat sink for the detector array only a few seconds after burnout of the rocket motors. This requires a cold stage design with very short thermal time constants. A suspension made from Kevlar strings holds the 255 gram cold stage in place. It is capable of withstanding loads in excess of 200 g. Stable operation of the TES array in proximity to the ADR magnet is ensured by a three-stage magnetic shielding system which consists of a superconducting can, a high-permeability shield and a bucking coil. The development and testing of the Micro-X payload is well underway.

  19. A Canadian refiner's perspective of synthetic crudes

    International Nuclear Information System (INIS)

    Halford, T.L.; McIntosh, A.P.; Rasmussen

    1997-01-01

    Some of the factors affecting a refiner's choice of crude oil include refinery hardware, particularly gas oil crackers, products slate and product specifications, crude availability, relative crude price and crude quality. An overview of synthetic crude, the use of synthetic crude combined with other crudes and a comparison of synthetic crude with conventional crude oil was given. The two main users of synthetic crude are basically two groups of refiners, those large groups who use synthetic crude combined with other crudes, and a smaller group who run synthetic crude on specially designed units as a sole feed. The effects of changes in fuel legislation were reviewed. It was predicted that the changes will have a mixed impact on the value of synthetic crude, but low sulphur diesel regulations and gasoline sulphur regulations will make current synthetic crudes attractive. The big future change with a negative impact will be diesel cetane increases to reduce engine emissions. This will reduce synthetic crude attractiveness due to distillate yields and quality and high gas oil yields. Similarly, any legislation limiting aromatics in diesel fuel will also make synthetic crudes less attractive. Problems experienced by refiners with hardware dedicated to synthetic crude (salt, naphthenic acid, fouling, quality variations) were also reviewed. 3 tabs

  20. The energy supply and demand outlook in the Asia-Pacific region

    International Nuclear Information System (INIS)

    Fesharaki, F.

    1993-01-01

    The 1980s witnessed spectacular growth rates in the Asia-Pacific region. While the relationship between economic growth and energy consumption is not necessarily one-to-one, energy is a required input for economic activity and trade. Energy demand growth in the Asia-Pacific region has been accordingly rapid. At this point in history, oil and economic growth are so inter-related that changes in one invariably have major repercussions on the other. During the coming decade, continued economic growth is foreseen for the Asia-Pacific region, coupled with the fastest rate of oil demand growth of any region on earth. Pressure will come to bear on the regional oil and gas markets, since demand growth will take place concurrently with a decline in the availability of local, low-sulfur crudes. The region will become even more dependent on imports of Middle Eastern crude, which will result in a higher-sulfur crude slate. Moreover, we anticipate that the existing and planned refinery complexes will lack the capacity and the flexibility to fully satisfy product demand. The consequence will be a higher level of refined product imports. The paper looks in greater detail at the supply and demand situation with respect to oil and natural gas, at regional oil import dependency and refining capacity. (10 figures). (author)

  1. Exploration of Uranium in Simpang Kanan, East Aceh, Preliminary Prospecting Stages

    International Nuclear Information System (INIS)

    Djalil, A; Sutriyono, A; Sajiyo

    1998-01-01

    Exploration of uranium in simpang kanan, east aceh, preliminary prospecting stages. The research has been carried out to obtain the knowledge of geology, radiometry and geochemistry in relation with U prospect development. Based on the similarity of lithology in takengon sector which indicates the existence of uranium mineralization. Research method consist of geological observation, radiometric measurements of outcrops, boulders and stream sediment and heavy mineral samples. Laboratory analysis consist of petrography, autoradiography and uranium content analysis of stream sediment and rock samples. The lithology consist of slate, quartzite, marble, granite, dacite, limestone, carbonaceous sandstone, black claystone, sandstone, siltstone, carbonaceous siltstone. This area found, has been folded with the folding axis direction of NW-SE. Fault structures are generally formed as strike slip fault and several location as normal fault and heavy minerals anomalous was interpreted from granite and sandstone- siltstone. Occurrences of the geochemical anomaly, lithology and geological structures, there has been shown that few location is being the prospect area covered about 70 km of 1800km prospecting area, so it is suggested that in those related prospect area should be performed further observation

  2. New Rhodotron and X-ray applications

    International Nuclear Information System (INIS)

    Morel, F.

    1991-01-01

    Food processing application possibilities seemed to have come to a virtual standstill. Obstacles to further development, of course, were: -legislation, - industrial strategy, - psychological refusal on the part of consumers of ionized foods. And suddenly, Legislation, not unlike that in the UK, takes a modern view of matters, CEA launches its Rhodotron late 1990, and Aerial publishes its work on X-rays. A breakthrough. The article below is a roundup of recent developments in the field of food processing ionization, both as regards technology and applications. Major inventions are: (1) CEA's new industrial electron accelerator. This compact, simple and economical unit is perfectly suited for production line operations and, (2) a high-penetration, high-conversion X-ray method squaling Cobalt 6 penetration. Legislation, however, is one of the factors that will determine the ionization market's development. Laws are more or less restrictive depending upon country. Two-tier legislation is an often-heard expression. Talks slated for the second half of this year at Brussels might clear matters up somewhat. Marketing-wise, the absence of references for products requiring long development lead times is a major obstacle to sales. Dry and deep-frozen product problems, though, have been practically solved

  3. A study of U-Pb isotopic evolutionary system in Chanziping uranium deposit

    International Nuclear Information System (INIS)

    Xu Weichang; Huang Shijie; Xia Yuliang.

    1988-01-01

    Chanziping uranium deposit occurred in the black siliceous slate of Lower cambrian. The uranium mineralization was controlled by both interstratified fault belt and the ore-bearing beds. Based on the study of the U-Pb isotopic system of the various rocks, ores and minerals in the ore-bearing beds, the authors find out the obvious disequilibrium of U-Pb isotopic composition in most rock samples which indicates the loss of uranium form the ore-bearing beds and surrounding granite. Its counting loss ranges from 30 to 80%. The age of rich ores of the U-Pb concordance diagram and the U-Pb three stage model are t 1 = 523 ± 19M. Y. , t 2 = 22 ± 2 M.Y.. The isochronal ages for pitchblend are 75 ± 4 M.Y., 43 ± 7 M.Y., and for rock is 416 M.y.. These data shows that the uranium in ore-bearing beds was mainly derived from the ore-bearing beds itself and partly from the surrounding granite. The ore deposit can be considered to be of stratabound uranium deposit of sedimentation and late transformation type

  4. Petroleum movements and investments in the refining industry: The impact of worldwide environmental regulations

    International Nuclear Information System (INIS)

    Guariguata U., G.

    1995-01-01

    Since the enactment of the US Clean Air Act Amendments of 1990, the worldwide refining industry has aligned itself to become increasing attuned to the future well-being of the environment. Refiners must now develop strategies which address careful selection of crude slates, significant increases and changes in product movements, and upgrading of facilities to meet growing demand--in short, strategies which allow them to make substantial increases in capital investments. The objective of this paper is to determine the regional capital investments refiners must make in order to comply with environmental legislation. The methodology in making this determination was founded on a comprehensive analysis of worldwide petroleum supply/demand and distribution patterns for the coming five years, and included evaluation of a set of linear programming (LP) models based on forecasts for regional product demands and projections of regional specifications. The models considered two scenarios, in which either (1) refinery expansion occurs chiefly in the market consuming regions, or (2) crude producers take control of incremental crude volumes and further expand their planned refining projects and the marketing of refined products. The results of these models, coupled with an understanding of geopolitical situations and economic analyses, provided estimates for capital expenditures for the coming decade. In specific, the following issues were addressed, and are discussed in this paper: refined product trade outlook; crude supply; crude quality; shipping; and capital investments

  5. Colloquium paper: adaptive specializations, social exchange, and the evolution of human intelligence.

    Science.gov (United States)

    Cosmides, Leda; Barrett, H Clark; Tooby, John

    2010-05-11

    Blank-slate theories of human intelligence propose that reasoning is carried out by general-purpose operations applied uniformly across contents. An evolutionary approach implies a radically different model of human intelligence. The task demands of different adaptive problems select for functionally specialized problem-solving strategies, unleashing massive increases in problem-solving power for ancestrally recurrent adaptive problems. Because exchange can evolve only if cooperators can detect cheaters, we hypothesized that the human mind would be equipped with a neurocognitive system specialized for reasoning about social exchange. Whereas humans perform poorly when asked to detect violations of most conditional rules, we predicted and found a dramatic spike in performance when the rule specifies an exchange and violations correspond to cheating. According to critics, people's uncanny accuracy at detecting violations of social exchange rules does not reflect a cheater detection mechanism, but extends instead to all rules regulating when actions are permitted (deontic conditionals). Here we report experimental tests that falsify these theories by demonstrating that deontic rules as a class do not elicit the search for violations. We show that the cheater detection system functions with pinpoint accuracy, searching for violations of social exchange rules only when these are likely to reveal the presence of someone who intends to cheat. It does not search for violations of social exchange rules when these are accidental, when they do not benefit the violator, or when the situation would make cheating difficult.

  6. Electron beam-curing coating for pressed cement roof tiles with high-build and excellent durability

    International Nuclear Information System (INIS)

    Maruyama, Tsutomu; Kiyata, Hiroaki

    1979-01-01

    Thick slate has expanded the demand steadily and spread to whole Japan except the northernmost part as a roof material, because it deals with rain water well, its strength, coldness resistance and endurance are excellent, and it can be worked easily. The ornamental finishing by urethane coating is not satisfactory in view of the improvement of productivity and the measures to pollution as well as the design and color. In order to meet this background, new coating has been sought, and electron beam-curing coating seems to be most suitable to cement roof tiles. The history and the present state of cement roof tiles are explained. About 700 tons/month of the coating for cement roof tiles is used at present, and acryl resin coating occupies about 75%, while urethane resin coating is used in Kyushu relatively more. The urethane coating is applied in shops by electrostatic coating, but the acryl coating is mostly applied in sites after tiling over. Electron beam curing used electron beam of 200 keV, and polymerization starts from the radicals formed through ionization, excitation and neutralization. The features of electron beam-curing coating are good adhesion to roof tiles, keeping luster and endurance to discoloration, strong film and feeling like porcelain, drying at normal temperature, productivity and economy. (J.P.N.)

  7. Superhilac upgrade project

    International Nuclear Information System (INIS)

    Feinberg, B.; Brown, I.G.

    1985-05-01

    This project will increase the uranium output of the Bevalac heavy-ion facility from the currently available 10 7 to 5 x 10 7 ions/pulse, allowing accurate Lamb shift measurements to be made in U 90+ and U 91+ with important applications to the testing of quantum electrodynamics and the development of an x-ray laser. The injected beam intensity will be increased to make better use of the 10emA output space-charge limit of the Wideroe linac. Components will include a new high current MEtal Vapor Vacuum Arc (MEVVA) ion source along with an improved high current, high voltage Cockcroft-Walton power supply to handle the increased beam current. The Low Energy Beam Transport (LEBT) line will be upgraded with additional focusing to manage the increased space-charge forces and with an improved vacuum to reduce charge exchange losses. Finally, the phase matching between the 23MHz Wideroe linac and the 70MHz Alvarez linac will be improved by the addition of the appropriate buncher cavities. Physics design is underway and detailed engineering is scheduled to begin in October 1985, with installation slated for the 1986 summer shutdown

  8. A proliferation of nuclear waste for the Southeast.

    Science.gov (United States)

    Alvarez, Robert; Smith, Stephen

    2007-12-01

    The U.S. Department of Energy's (DOE) Global Nuclear Energy Partnership (GNEP) is being promoted as a program to bring about the expansion of worldwide nuclear energy. Here in the U.S. much of this proposed nuclear power expansion is slated to happen in the Southeast, including here in South Carolina. Under the GNEP plan, the United States and its nuclear partners would sell nuclear power plants to developing nations that agree not to pursue technologies that would aid nuclear weapons production, notably reprocessing and uranium enrichment. As part of the deal, the United States would take highly radioactive spent ("used") fuel rods to a reprocessing center in this country. Upon analysis of the proposal, it is clear that DOE lacks a credible plan for the safe management and disposal of radioactive wastes stemming from the GNEP program and that the high costs and possible public health and environmental impacts from the program pose significant risks, especially to this region. Given past failures to address waste problems before they were created, DOE's rush to invest major public funds for deployment of reprocessing should be suspended.

  9. Mapping rock forming minerals at Boundary Canyon, Death Valey National Park, California, using aerial SEBASS thermal infrared hyperspectral image data

    Science.gov (United States)

    Aslett, Zan; Taranik, James V.; Riley, Dean N.

    2018-02-01

    Aerial spatially enhanced broadband array spectrograph system (SEBASS) long-wave infrared (LWIR) hyperspectral image data were used to map the distribution of rock-forming minerals indicative of sedimentary and meta-sedimentary lithologies around Boundary Canyon, Death Valley, California, USA. Collection of data over the Boundary Canyon detachment fault (BCDF) facilitated measurement of numerous lithologies representing a contact between the relatively unmetamorphosed Grapevine Mountains allochthon and the metamorphosed core complex of the Funeral Mountains autochthon. These included quartz-rich sandstone, quartzite, conglomerate, and alluvium; muscovite-rich schist, siltstone, and slate; and carbonate-rich dolomite, limestone, and marble, ranging in age from late Precambrian to Quaternary. Hyperspectral data were reduced in dimensionality and processed to statistically identify and map unique emissivity spectra endmembers. Some minerals (e.g., quartz and muscovite) dominate multiple lithologies, resulting in a limited ability to differentiate them. Abrupt variations in image data emissivity amongst pelitic schists corresponded to amphibolite; these rocks represent gradation from greenschist- to amphibolite-metamorphic facies lithologies. Although the full potential of LWIR hyperspectral image data may not be fully utilized within this study area due to lack of measurable spectral distinction between rocks of similar bulk mineralogy, the high spectral resolution of the image data was useful in characterizing silicate- and carbonate-based sedimentary and meta-sedimentary rocks in proximity to fault contacts, as well as for interpreting some mineral mixtures.

  10. Bulding and Ornamental Stone in the History of St Petersburg Architecture

    Science.gov (United States)

    Bulakh, Andrey

    2013-04-01

    First, the Our Lady of Kazan Orthodox Cathedral and some mansions are used to demonstrate Russian stones in the architectural décor of St Petersburg, XVIII-XX cc. These rocks are granites from Vyborg and Sortavala, lime tufa from Gatchina, marbles from Ruskeala and Juven at the Ladoga Lake, Tivdian marble, Shokshian quartzite, and black aspid slate of the Onega Lake. Later German and Polish sandstones and Finnish soap stone came to the city. Second, there is given a review of rock types used in St Petersburg at XX-XXI cc. margins. They are granites, granosyenites, syenites, gneisses, marbles, limestones both from Russia and from abroad. Which ones are more usual? From what regions did Russian stone come? References: 1) A.G.Bulakh, N.B.Abakumova, J.V.Romanovsky. St Petersburg: a History in Stone. 2010. Print. House of St Petersburg State University. 173 p. 2) A.Ya. Tutakova, A.Z. Romanovskiy, A.G. Bulakh, V.I. Leer. Dimension Stone of the Leningrad Region. Granites of the Karelia Isthmus in Architecture of the Modern St Petersburg. 2011. St Petersburg. 78 p. (In Russian).

  11. Integration of thermal digital 3D model and a MASW (Multichannel Analysis of Surface Wave) as a means of improving monitoring of spoil tip stability

    Science.gov (United States)

    Lewińska, Paulina; Matuła, Rafał; Dyczko, Artur

    2018-01-01

    Spoil tips are anthropogenic terrain structures built of leftover (coal) mining materials. They consist mostly of slate and sandstone or mudstone but also include coal and highly explosive coal dust. Coal soil tip fires cause an irreversible degradation to the environment. Government organizations notice the potential problem of spoil tip hazard and are looking for ways of fast monitoring of their temperature and inside structure. In order to test new monitoring methods an experimental was performed in the area of spoil tip of Lubelski Węgiel "Bogdanka" S.A. A survey consisted of creating a 3D discreet thermal model. This was done in order to look for potential fire areas. MASW (Multichannel analysis of surface wave) was done in order to find potential voids within the body of a tip. Existing data was digitalized and a 3D model of object's outside and inside was produced. This article provides results of this survey and informs about advantages of such an approach.

  12. Two-dimensional gas chromatography-online hydrogenation for improved characterization of petrochemical samples.

    Science.gov (United States)

    Potgieter, H; Bekker, R; Govender, A; Rohwer, E

    2016-05-06

    The Fischer-Tropsch (FT) process produces a variety of hydrocarbons over a wide carbon number range and during subsequent product workup a large variety of synthetic fuels and chemicals are produced. The complexity of the product slate obtained from this process is well documented and the high temperature FT (HT-FT) process products are spread over gas, oil and water phases. The characterization of these phases is very challenging even when using comprehensive two-dimensional gas chromatography time-of-flight mass spectrometry (GC×GC-TOFMS). Despite the increase in separation power, peak co-elution still occurs when samples containing isomeric compounds are analysed by comprehensive two dimensional GC. The separation of isomeric compounds with the same double bond equivalents is especially difficult since these compounds elute in a similar position on the GC×GC chromatogram and have identical molecular masses and similar fragmentation patterns in their electron ionization (EI) mass spectra. On-line hydrogenation after GC×GC separation is a possible way to distinguish between these isomeric compounds since the number of rings and alkene double bonds can be determined from the mass spectra of the compounds before and after hydrogenation. This paper describes development of a GC×GC method with post column hydrogenation for the determination of the backbone of cyclic/olefinic structures enabling us to differentiate between classes like dienes and cyclic olefins in complex petrochemical streams. Copyright © 2016 Elsevier B.V. All rights reserved.

  13. Experiences in managing the Prometheus Project

    Science.gov (United States)

    Lehman, David H.; Clark, Karla B.; Cook, Beverly A.; Gavit, Sarah A.; Kayali, Sammy A.; McKinney, John C.; Milkovich, David C.; Reh, Kim R.; Taylor, Randall L.; Casani, John R.

    2006-01-01

    Congress authorized NASA?s Prometheus Project in February 2003, with the first Prometheus mission slated to explore the icy moons of Jupiter. The Project had two major objectives: (1) to develop a nuclear reactor that would provide unprecedented levels of power and show that it could be processed safely and operated reliably in space for long-duration, deep-space exploration and (2) to explore the three icy moons of Jupiter - Callisto, Ganymede, and Europa - and return science data that would meet the scientific goals as set forth in the Decadal Survey Report of the National Academy of Sciences. Early in Project planning, it was determined that the development of the Prometheus nuclear powered Spaceship would be complex and require the intellectual knowledge residing at numerous organizations across the country. In addition, because of the complex nature of the Project and the multiple partners, approaches beyond those successfully used to manage a typical JPL project would be needed. This paper1 will describe the key experiences in managing Prometheus that should prove useful for future projects of similar scope and magnitude

  14. Isotopic evidence for hydrothermal discharge into anoxic seawater, Sudbury basin, Ontario, Canada

    International Nuclear Information System (INIS)

    Whitehead, R.E.S.; Davies, J.F.

    1990-01-01

    The Errington and Vermilion sedex Zn-Cu-Pb deposits occur within hydrothermal carbonate and chert that form part of a carbonaceous slate unit, the contact unit, at the base of the Onwatin formation. Within the underlying Onaping formation sulphur and organic carbon increase upward but maintain S/C org ratios near 0.36, indicative of diagenetic sulphide formed by biogenic sulphate reduction, a process that also accounts for 13 C-depleted carbonates in these rocks. δ 34 S-values in pyrite are close to + 7 0/00 throughout the Onaping but decrease abruptly to +3 0/00 in the contact unit; this decrease coincides with the first appearance of S/C org >> 0.36. Both the decrease in δ 34 S and increase in S/C org ratios result from venting of hydrothermal sulphur into the water column. Fluid-inclusion homogenization temperatures average 170 deg C at the proposed vent site and 125 deg C in the distal contact unit sediment. The isotopic compositions of water, calculated using these temperatures and the isotopic compositions of carbonates, are - 1 0/00 for the sedex deposits at the vent site and - 3 0/00 in the distal sediments. (author). 56 refs., 1 tab., 7 figs

  15. Memory of the Present: Empathy and Identity in Young Adult Fiction

    Directory of Open Access Journals (Sweden)

    Maria Nikolajeva

    2014-11-01

    Full Text Available Recent studies in cognitive literary criticism have provided scholars of literature with new, stimulating approaches to literary texts and neuroscientists with new insights about human emotions, empathy, and memory through evidence from fiction. What have so far been largely neglected are the implications of cognitive criticism for the study of literature targeting a young audience, whose theory of mind and empathic skills are not yet fully developed. A cognitive approach to children's and young adult literature has to meet several challenges less relevant in general fiction. Firstly, how is a young fictional character's consciousness represented by an author whose cognitive and affective skills are ostensibly superior? Secondly, how do texts instruct their young readers to employ theory of mind in order to assess both the young protagonist's emotions and their understanding of other characters' emotions (higher-order mind-reading? Thirdly, how can fiction support young people's development of their theory of mind? The paper will discuss these issues with a particular focus on memory and identity, expressed textually through tense and narrative perspective. Drawing on work by Lisa Zunshine (2006 and Blackey Vermeule (2010, the predominantly theoretical argument will be illustrated by a contemporary young adult novel, Slated (2012, by Teri Terry.

  16. Petrographic characteristics of rocks with magnetite deposits of Vrbno (Jesieniki - Czech Republic

    Directory of Open Access Journals (Sweden)

    Miłosz A. Huber

    2011-11-01

    Full Text Available Introduction: The subject of this paper is a study the metamorphite shists from the old mines around the Mala Moravka-Karlova Studianka in which is magnetite ore, with ferrous chlorites present.Materials and methods: Samples were taken directly from the reservoir and the surrounding of the ore, then the samples were observed in the microscope in transmitted and reflected light, and were carried out X-ray analysis of XRD and SEM-EDS.Results: In the quartz-chlorite slates occur fibroblastic structure with numerous microfolds. X-ray analysis of rocks indicates the presence of calcite, quartz and ferrous chlorites of magnesium-ferrous group. The ore has a steel-gray color, granoblastic structure, layered, compact texture, sometimes with microfolds and deformations. The ore has a lenticular layers of quartz. Background of the ore are doubly and triply twinned magnetite and hematite idioblasts in some cases.Conclusions: The ore zone analysis indicates hydrothermal origin of the ore, which escaped to the earth surface by means of exhalations was deposited as sediment in clayey material. These deposits were metamorphosed in the chlorite facies.

  17. Functional characterization of detergent-decellularized equine tendon extracellular matrix for tissue engineering applications.

    Directory of Open Access Journals (Sweden)

    Daniel W Youngstrom

    Full Text Available Natural extracellular matrix provides a number of distinct advantages for engineering replacement orthopedic tissue due to its intrinsic functional properties. The goal of this study was to optimize a biologically derived scaffold for tendon tissue engineering using equine flexor digitorum superficialis tendons. We investigated changes in scaffold composition and ultrastructure in response to several mechanical, detergent and enzymatic decellularization protocols using microscopic techniques and a panel of biochemical assays to evaluate total protein, collagen, glycosaminoglycan, and deoxyribonucleic acid content. Biocompatibility was also assessed with static mesenchymal stem cell (MSC culture. Implementation of a combination of freeze/thaw cycles, incubation in 2% sodium dodecyl sulfate (SDS, trypsinization, treatment with DNase-I, and ethanol sterilization produced a non-cytotoxic biomaterial free of appreciable residual cellular debris with no significant modification of biomechanical properties. These decellularized tendon scaffolds (DTS are suitable for complex tissue engineering applications, as they provide a clean slate for cell culture while maintaining native three-dimensional architecture.

  18. The rhesus measurement system: A new instrument for space research

    Science.gov (United States)

    Schonfeld, Julie E.; Hines, John W.

    1993-01-01

    The Rhesus Research Facility (RRF) is a research environment designed to study the effects of microgravity using rhesus primates as human surrogates. This experimental model allows investigators to study numerous aspects of microgravity exposure without compromising crew member activities. Currently, the RRF is slated for two missions to collect its data, the first mission is SLS-3, due to fly in late 1995. The RRF is a joint effort between the United States and France. The science and hardware portions of the project are being shared between the National Aeronautics and Space Administration (NASA) and France's Centre National D'Etudes Spatiales (CNES). The RRF is composed of many different subsystems in order to acquire data, provide life support, environmental enrichment, computer facilities and measurement capabilities for two rhesus primates aboard a nominal sixteen day mission. One of these subsystems is the Rhesus Measurement System (RMS). The RMS is designed to obtain in-flight physiological measurements from sensors interfaced with the subject. The RMS will acquire, preprocess, and transfer the physiologic data to the Flight Data System (FDS) for relay to the ground during flight. The measurements which will be taken by the RMS during the first flight will be respiration, measured at two different sites; electromyogram (EMG) at three different sites; electroencephalogram (EEG); electrocardiogram (ECG); and body temperature. These measurements taken by the RMS will assist the research team in meeting the science objectives of the RRF project.

  19. The Sarnia complex: synergies and strategies

    International Nuclear Information System (INIS)

    Heath, M.; Chan, K.S.; Renne, G.; Raggett, C.

    1995-01-01

    A study was conducted to examine ways in which the oil refiners and petrochemical producers in the Sarnia Complex in Ontario could become more competitive with their counterparts in the United States through joint actions. Methods by which the petroleum industry could meet the challenges posed by changing environmental regulations were proposed. Five suggestions were advanced, i. e., (1) increase pipeline capacity and reduce refining and petrochemical feedstock shipping costs to Ontario, (2) joint ventures in existing or new facilities to produce higher value products, mainly petrochemicals, (3) major joint process integrations involving investment in significant new facilities to meet demand growth and maximize value of the product slate, (4) major joint process integrations to manufacture cleaner fuels, and (5) joint services and utilities integration. Of the joint actions identified by experts, those which were judged to be most plausible and had the greatest profit potential were: further cogeneration, distillate desulfurization, hydrogen production and pipelining, cryogenic recovery of light ends, styrene production and sharing services and utilities.68 refs., 7 tabs., 9 figs

  20. A Special Font for People with Dyslexia: Does it Work and, if so, why?

    Science.gov (United States)

    Marinus, Eva; Mostard, Michelle; Segers, Eliane; Schubert, Teresa M; Madelaine, Alison; Wheldall, Kevin

    2016-08-01

    In 2008 Christian Boer, a Dutch artist, developed a special font ("Dyslexie") to facilitate reading in children and adults with dyslexia. The font has received a lot of media attention worldwide (e.g., TheGuardian.com, Slate.com, TheAtlantic.com, USA Today, and io9.com). Interestingly, there is barely any empirical evidence for the efficacy of Dyslexie. This study aims to examine if Dyslexie is indeed more effective than a commonly used sans serif font (Arial) and, if so, whether this can be explained by its relatively large spacing settings. Participants were 39 low-progress readers who were learning to read in English. They were asked to read four different texts in four different font conditions that were all matched on letter display size (i.e., x-height), but differed in the degree to which they were matched for spacing settings. Results showed that low-progress readers performed better (i.e., read 7% more words per minute) in Dyslexie font than in standardly spaced Arial font. However, when within-word spacing and between-word spacing of Arial font was matched to that of Dyslexie font, the difference in reading speed was no longer significant. We concluded that the efficacy of Dyslexie font is not because of its specially designed letter shapes, but because of its particular spacing settings. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  1. Why we cannot conclude that sexual orientation is primarily a biological phenomenon.

    Science.gov (United States)

    Byne, W

    1997-01-01

    While all mental phenomena must have an ultimate biological substrate, the precise contribution of biological factors to the development of sexual orientation remains to be elucidated. Does biology merely provide the slate of neural circuitry upon which sexual orientation is inscribed by experience? Do biological factors directly wire the brain so that it will support a particular orientation? Or do biological factors influence sexual orientation only indirectly, perhaps by influencing personality variables that in turn influence how one interacts with and shapes the environment as it contributes to the social relationships and experiences that shape sexual orientation as it emerges developmentally? Recent neurostructural and genetic linkage evidence pertaining to sexual orientation must be viewed tentatively until it has been adequately corroborated and integrated with psychological and cultural models. Moreover, even a reliable and robust correlation between a biological marker and sexual orientation would be equally compatible with the second and third possibilities delineated above. Yet if the third possibility more closely approximates reality, the search for predisposing biological factors will result in incomplete and misleading findings until their interactions with environmental factors are taken into account and controlled for in adequate longitudinal studies.

  2. Development and Testing of a Magnetically Actuated Capsule Endoscopy for Obesity Treatment.

    Directory of Open Access Journals (Sweden)

    Thanh Nho Do

    Full Text Available Intra-gastric balloons (IGB have become an efficient and less invasive method for obesity treatment. The use of traditional IGBs require complex insertion tools and flexible endoscopes to place and remove the balloon inside the patient's stomach, which may cause discomfort and complications to the patient. This paper introduces a new ingestible weight-loss capsule with a magnetically remote-controlled inflatable and deflatable balloon. To inflate the balloon, biocompatible effervescent chemicals are used. As the source of the actuation is provided via external magnetic fields, the magnetic capsule size can be significantly reduced compared to current weight-loss capsules in the literature. In addition, there are no limitations on the power supply. To lose weight, the obese subject needs only to swallow the magnetic capsule with a glass of water. Once the magnetic capsule has reached the patient's stomach, the balloon will be wirelessly inflated to occupy gastric space and give the feeling of satiety. The balloon can be wirelessly deflated at any time to allow the magnetic capsule to travel down the intestine and exit the body via normal peristalsis. The optimal ratio between the acid and base to provide the desired gas volume is experimentally evaluated and presented. A prototype capsule (9.6mm x 27mm is developed and experimentally validated in ex-vivo experiments. The unique ease of delivery and expulsion of the proposed magnetic capsule is slated to make this development a good treatment option for people seeking to lose excess weight.

  3. Site characterization report for the Old Hydrofracture Facility at Oak Ridge National Laboratory, Oak Ridge, Tennessee

    International Nuclear Information System (INIS)

    1995-01-01

    Several Old Hydrofracture Facility (OHF) structures (i.e., Building 7852, the bulk storage bins, the pump house, water tank T-5, and pump P-3) are surplus facilities at Oak Ridge National Laboratory (ORNL) slated for decontamination and decommissioning (D and D). OHF was constructed in 1963 to allow experimentation and operations with an integrated solids storage, handling, mixing, and grout injection facility. It was shut down in 1980 and transferred to ORNL's Surveillance and Maintenance Program. The hydrofracture process was a unique disposal method that involved injecting waste materials mixed with grout and additives under pumping pressures of 2,000 psi or greater into a deep, low-permeability shale formation. The injected slurry spread along fractures and bedding planes for hundreds of feet from the injection points, forming thin grout sheets (often less than 1/8 in. thick). The grout ostensibly immobilized and solidified the liquid wastes. Site characterization activities were conducted in the winter and spring of 1994 to collect information necessary to plan the D and D of OHF structures. This site characterization report documents the results of the investigation of OHF D and D structures, presenting data from the field investigation and laboratory analyses in the form of a site description, as-built drawings, summary tables of radiological and chemical contaminant concentrations, and a waste volume estimate. 25 refs., 54 figs., 17 tabs

  4. Isolation and characterization of numerous novel phages targeting diverse strains of the ubiquitous and opportunistic pathogen Achromobacter xylosoxidans.

    Directory of Open Access Journals (Sweden)

    Johannes Wittmann

    Full Text Available The clinical relevance of nosocomially acquired infections caused by multi-resistant Achromobacter strains is rapidly increasing. Here, a diverse set of 61 Achromobacter xylosoxidans strains was characterized by MultiLocus Sequence Typing and Phenotype MicroArray technology. The strains were further analyzed in regard to their susceptibility to 35 antibiotics and to 34 different and newly isolated bacteriophages from the environment. A large proportion of strains were resistant against numerous antibiotics such as cephalosporines, aminoglycosides and quinolones, whereas piperacillin-tazobactam, ticarcillin, mezlocillin and imipenem were still inhibitory. We also present the first expanded study on bacteriophages of the genus Achromobacter that has been so far a blank slate with respect to phage research. The phages were isolated mainly from several waste water treatment plants in Germany. Morphological analysis of all of these phages by electron microscopy revealed a broad diversity with different members of the order Caudovirales, including the families Siphoviridae, Myoviridae, and Podoviridae. A broad spectrum of different host ranges could be determined for several phages that lysed up to 24 different and in part highly antibiotic resistant strains. Molecular characterisation by DNA restriction analysis revealed that all phages contain linear double-stranded DNA. Their restriction patterns display distinct differences underlining their broad diversity.

  5. A Catalog of Stellar Unified Properties (CATSUP) for 951 FGK-Stars within 30 pc

    Energy Technology Data Exchange (ETDEWEB)

    Hinkel, Natalie R.; Somers, Garrett [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States); Mamajek, Eric E. [Jet Propulsion Laboratory, California Institute of Technology, M/S 321-100, 4800 Oak Grove Drive, Pasadena, CA 91109 (United States); Turnbull, Margaret C. [Global Science Institute, P.O. Box 252, Antigo, WI 54409 (United States); Osby, Ella; Shkolnik, Evgenya L.; Desch, Steven J. [School of Earth and Space Exploration, Arizona State University, Tempe, AZ 85287 (United States); Smith, Graeme H. [University of California Observatories and Department of Astronomy and Astrophysics, University of California, Santa Cruz CA 95064 (United States); Klimasewski, Alexis, E-mail: natalie.hinkel@gmail.com [Department of Physics and Astronomy, University of Rochester, Rochester, NY 14627-0171 (United States)

    2017-10-10

    Almost every star in our Galaxy is likely to harbor a terrestrial planet, but accurate measurements of an exoplanet’s mass and radius demand accurate knowledge of the properties of its host star. The imminent TESS and CHEOPS missions are slated to discover thousands of new exoplanets. Along with WFIRST, which will directly image nearby planets, these surveys make urgent the need to better characterize stars in the nearby solar neighborhood (<30 pc). We have compiled the CATalog of Stellar Unified Properties (CATSUP) for 951 stars, including such data as: Gaia astrometry; multiplicity within stellar systems; stellar elemental abundance measurements; standardized spectral types; Ca ii H and K stellar activity indices; GALEX NUV and FUV photometry; and X-ray fluxes and luminosities from ROSAT , XMM, and Chandra . We use this data-rich catalog to find correlations, especially between stellar emission indices, colors, and galactic velocity. Additionally, we demonstrate that thick-disk stars in the sample are generally older, have lower activity, and have higher velocities normal to the galactic plane. We anticipate that CATSUP will be useful for discerning other trends among stars within the nearby solar neighborhood, for comparing thin-disk versus thick-disk stars, for comparing stars with and without planets, and for finding correlations between chemical and kinematic properties.

  6. DECONTAMINATION TECHNOLOGIES FOR FACILITY REUSE

    International Nuclear Information System (INIS)

    Bossart, Steven J.; Blair, Danielle M.

    2003-01-01

    As nuclear research and production facilities across the U.S. Department of Energy (DOE) nuclear weapons complex are slated for deactivation and decommissioning (D and D), there is a need to decontaminate some facilities for reuse for another mission or continued use for the same mission. Improved technologies available in the commercial sector and tested by the DOE can help solve the DOE's decontamination problems. Decontamination technologies include mechanical methods, such as shaving, scabbling, and blasting; application of chemicals; biological methods; and electrochemical techniques. Materials to be decontaminated are primarily concrete or metal. Concrete materials include walls, floors, ceilings, bio-shields, and fuel pools. Metallic materials include structural steel, valves, pipes, gloveboxes, reactors, and other equipment. Porous materials such as concrete can be contaminated throughout their structure, although contamination in concrete normally resides in the top quarter-inch below the surface. Metals are normally only contaminated on the surface. Contamination includes a variety of alpha, beta, and gamma-emitting radionuclides and can sometimes include heavy metals and organic contamination regulated by the Resource Conservation and Recovery Act (RCRA). This paper describes several advanced mechanical, chemical, and other methods to decontaminate structures, equipment, and materials

  7. Major Refurbishment of the University of Florida Training Reactor

    International Nuclear Information System (INIS)

    Joradn, Kelly; Berglund, Matthew; Shea, Brian

    2013-01-01

    The research reactor fleet is aging with few replacements being built. At the same time the technology for refurbishment of the older reactors has advanced well beyond that of currently installed equipment. The disparity between new and old technology results in an inability to find simple replacements for the older, highly integrated components. The lack of comprehensive guidance for digital equipment adds to the technical problems of installing individual replacement parts. Up to this point, no U. S. facilities have attempted a complete modernization effort because of the time commitment, financial burden, and licensing required for a total upgrade. The University of Florida Training Reactor is tackling this problem with a replacement of nearly all of the major facility sub-systems, including electrical distribution, reactor controls, nuclear instrumentation, security, building management, and environmental controls. This approach offers increased flexibility over the piece-by-piece replacement method by leveraging modern control systems based on global standards and capable of good data interchange with higher levels of redundancy. The UFTR reviewed numerous technologies to arrive at the final system architecture and this 'clean-slate' installation methodology. It is this concept of total system replacement and strict use of modular, open-standards technology that has allowed for a facility design that will be easy to install, maintain, and build upon over time

  8. A review of gasoline retailing Canada vs United States: Update, 1980-1990

    International Nuclear Information System (INIS)

    1992-10-01

    A comparison is presented of the economies of scale achieved by the gasoline retailing sector in Canada and the United States over the period 1980-1990. Gasoline demand increased steadily in the USA and by 1990 was 10% higher than in 1980, while in Canada the fluctuating demand has led to a 12% decline for the same period. Number of automobiles increased 23% in Canada compared to 19% in the USA, while number of retail outlets fell by 5,000 in Canada and 47,000 in the USA. The average distance travelled by automobile increased 11% and 7%, respectively for Canada and the USA, however Canadians drove 7% further than Americans. In 1990, automobiles used ca 200 litres less fuel per year in Canada than the USA. Average sales per outlet increased by 56% in the USA and 10% in Canada. While most of the price difference between American and Canadian gasoline is attributable to taxes, the larger size of American refineries, transportation costs, product slate and product demand affects prices. 6 figs

  9. Expanding the landscape of chromatin modification (CM-related functional domains and genes in human.

    Directory of Open Access Journals (Sweden)

    Shuye Pu

    2010-11-01

    Full Text Available Chromatin modification (CM plays a key role in regulating transcription, DNA replication, repair and recombination. However, our knowledge of these processes in humans remains very limited. Here we use computational approaches to study proteins and functional domains involved in CM in humans. We analyze the abundance and the pair-wise domain-domain co-occurrences of 25 well-documented CM domains in 5 model organisms: yeast, worm, fly, mouse and human. Results show that domains involved in histone methylation, DNA methylation, and histone variants are remarkably expanded in metazoan, reflecting the increased demand for cell type-specific gene regulation. We find that CM domains tend to co-occur with a limited number of partner domains and are hence not promiscuous. This property is exploited to identify 47 potentially novel CM domains, including 24 DNA-binding domains, whose role in CM has received little attention so far. Lastly, we use a consensus Machine Learning approach to predict 379 novel CM genes (coding for 329 proteins in humans based on domain compositions. Several of these predictions are supported by very recent experimental studies and others are slated for experimental verification. Identification of novel CM genes and domains in humans will aid our understanding of fundamental epigenetic processes that are important for stem cell differentiation and cancer biology. Information on all the candidate CM domains and genes reported here is publicly available.

  10. Analysis of Phoenix Anomalies and IV & V Findings Applied to the GRAIL Mission

    Science.gov (United States)

    Larson, Steve

    2012-01-01

    NASA IV&V was established in 1993 to improve safety and cost-effectiveness of mission critical software. Since its inception the tools and strategies employed by IV&V have evolved. This paper examines how lessons learned from the Phoenix project were developed and applied to the GRAIL project. Shortly after selection, the GRAIL project initiated a review of the issues documented by IV&V for Phoenix. The motivation was twofold: the learn as much as possible about the types of issues that arose from the flight software product line slated for use on GRAIL, and to identify opportunities for improving the effectiveness of IV&V on GRAIL. The IV&V Facility provided a database dump containing 893 issues. These were categorized into 16 bins, and then analyzed according to whether the project responded by changing the affected artifacts or using as-is. The results of this analysis were compared to a similar assessment of post-launch anomalies documented by the project. Results of the analysis were discussed with the IV&V team assigned to GRAIL. These discussions led to changes in the way both the project and IV&V approached the IV&V task, and improved the efficiency of the activity.

  11. Safety aspects of the IFR pyroprocess fuel cycle

    International Nuclear Information System (INIS)

    Forrester, R.J.; Lineberry, M.J.; Charak, I.; Tessier, J.H.; Solbrig, C.W.; Gabor, J.D.

    1989-01-01

    This paper addresses the important safety considerations related to the unique Integral Fast Reactor (IFR) fuel cycle technology, the pyroprocess. Argonne has been developing the IFR since 1984. It is a liquid metal cooled reactor, with a unique metal alloy fuel, and it utilizes a radically new fuel cycle. An existing facility, the Hot Fuel Examination Facility-South (HFEF/S) is being modified and equipped to provide a complete demonstration of the fuel cycle. This paper will concentrate on safety aspects of the future HFEF/S operation, slated to begin late next year. HFEF/S is part of Argonne's complex of reactor test facilities located on the Idaho National Engineering Laboratory. HFEF/S was originally put into operation in 1964 as the EBR-II Fuel Cycle Facility (FCF) (Stevenson, 1987). From 1964--69 FCF operated to demonstrate an earlier and incomplete form of today's pyroprocess, recycling some 400 fuel assemblies back to EBR-II. The FCF mission was then changed to one of an irradiated fuels and materials examination facility, hence the name change to HFEF/S. The modifications consist of activities to bring the facility into conformance with today's much more stringent safety standards, and, of course, providing the new process equipment. The pyroprocess and the modifications themselves are described more fully elsewhere (Lineberry, 1987; Chang, 1987). 18 refs., 5 figs., 2 tabs

  12. Flight Paths of Migrating Golden Eagles and the Risk Associated with Wind Energy Development in the Rocky Mountains

    Directory of Open Access Journals (Sweden)

    Naira N. Johnston

    2013-12-01

    Full Text Available In recent years, the eastern foothills of the Rocky Mountains in northeastern British Columbia have received interest as a site of industrial wind energy development but, simultaneously, have been the subject of concern about wind development coinciding with a known migratory corridor of Golden Eagles (Aquila chrysaetos. We tracked and quantified eagle flights that crossed or followed ridgelines slated for one such wind development. We found that hourly passage rates during fall migration peaked at midday and increased by 17% with each 1 km/h increase in wind speed and by 11% with each 1°C increase in temperature. The propensity to cross the ridge tops where turbines would be situated differed between age classes, with juvenile eagles almost twice as likely to traverse the ridge-top area as adults or subadults. During fall migration, Golden Eagles were more likely to cross ridges at turbine heights (risk zone, < 150 m above ground under headwinds or tailwinds, but this likelihood decreased with increasing temperature. Conversely, during spring migration, eagles were more likely to move within the ridge-top area under eastern crosswinds. Identifying Golden Eagle flight routes and altitudes with respect to major weather systems and local topography in the Rockies may help identify scenarios in which the potential for collisions is greatest at this and other installations.

  13. Industrial market assessment of the products of mild gasification: Final report

    Energy Technology Data Exchange (ETDEWEB)

    Sinor, J.E.

    1988-01-01

    The goal of this study is to determine the best available conditions, in terms of market volumes and prices, for the products from a mild gasification facility. A process feasibility study will then have to determine the cost of building and operating a facility to make those products. The study is presented as a summary of the options available to a coal producer for creating added product value. For this reason, three specific coal mines owned by AMAX Inc. were chosen, and the options were analyzed from the viewpoint of increasing the total revenue derived from those coals. No specific mild gasification, or mild devolatilization technology was assumed during the assessment. The analysis considers only product prices, volumes, and specifications. It does not assign any intangible value or national benefit to substituting coal for oil or to producing a cleaner fuel. Although it would be desirable to conceive of a product slate which would be immune from energy price fluctuations, such a goal is probably unattainable and no particular emphasis was placed on it. 76 figs., 75 tabs.

  14. Using urban forest assessment tools to model bird habitat potential

    Science.gov (United States)

    Lerman, Susannah B.; Nislow, Keith H.; Nowak, David J.; DeStefano, Stephen; King, David I.; Jones-Farrand, D. Todd

    2014-01-01

    The alteration of forest cover and the replacement of native vegetation with buildings, roads, exotic vegetation, and other urban features pose one of the greatest threats to global biodiversity. As more land becomes slated for urban development, identifying effective urban forest wildlife management tools becomes paramount to ensure the urban forest provides habitat to sustain bird and other wildlife populations. The primary goal of this study was to integrate wildlife suitability indices to an existing national urban forest assessment tool, i-Tree. We quantified available habitat characteristics of urban forests for ten northeastern U.S. cities, and summarized bird habitat relationships from the literature in terms of variables that were represented in the i-Tree datasets. With these data, we generated habitat suitability equations for nine bird species representing a range of life history traits and conservation status that predicts the habitat suitability based on i-Tree data. We applied these equations to the urban forest datasets to calculate the overall habitat suitability for each city and the habitat suitability for different types of land-use (e.g., residential, commercial, parkland) for each bird species. The proposed habitat models will help guide wildlife managers, urban planners, and landscape designers who require specific information such as desirable habitat conditions within an urban management project to help improve the suitability of urban forests for birds.

  15. A voice from the high wire: Public involvement in a co-operative siting process

    International Nuclear Information System (INIS)

    Oates, D.J.L.

    1995-01-01

    The author is a public consultation and communications consultant to the Siting Task Force (STF), Low level Radioactive Waste Management. The STF is a Canadian government-appointed yet independent body implementing a voluntary, co-operative siting process for a long term storage or disposal facility for 1 million cubic metres of LLRW. The presentation will document the experiences of and lessons learned by the author during her role developing and implementing a public involvement program for the process. The Co-operative Siting Process is a new approach to siting controversial facilities. It is based on the belief that communities should accept such a facility in their backyard and not be forced against their will on technical or political grounds. A formal 'ground rules-up-front' process was developed and is now being carried out, with completion slated for April, 1995. Putting these rules and theories into practice has resulted in significant changes being made to the work plan for technical activities, and in a sober second look at the intricacies involved in planning and carrying out a thorough and efficient public involvement program that remain practical and cost-effective. There is a delicate balancing act between meaningful public participation that lays the foundation for trust, confidence and consensus, and public involvement that can result in the process being side-tracked and legitimate solutions and technical activities becoming mired in political and personal agendas

  16. Data Management Coordinators Monitor STS-78 Mission at the Huntsville Operations Support Center

    Science.gov (United States)

    1996-01-01

    Launched on June 20, 1996, the STS-78 mission's primary payload was the Life and Microgravity Spacelab (LMS), which was managed by the Marshall Space Flight Center (MSFC). During the 17 day space flight, the crew conducted a diverse slate of experiments divided into a mix of life science and microgravity investigations. In a manner very similar to future International Space Station operations, LMS researchers from the United States and their European counterparts shared resources such as crew time and equipment. Five space agencies (NASA/USA, European Space Agency/Europe (ESA), French Space Agency/France, Canadian Space Agency /Canada, and Italian Space Agency/Italy) along with research scientists from 10 countries worked together on the design, development and construction of the LMS. This photo represents Data Management Coordinators monitoring the progress of the mission at the Huntsville Operations Support Center (HOSC) Spacelab Payload Operations Control Center (SL POCC) at MSFC. Pictured are assistant mission scientist Dr. Dalle Kornfeld, Rick McConnel, and Ann Bathew.

  17. How does an increase in undergraduate teaching load affect GP teacher motivation? A grounded theory study using data from a new medical school.

    Science.gov (United States)

    Harding, Alex; Sweeney, Grace

    2013-07-01

    The opening of a new medical school is a cause for celebration. Starting with a clean slate often gives the opportunity to adopt more modern teaching practices. However, encouraging large numbers of clinicians to start teaching and to adopt these new methods brings its own set of challenges. During the expansion phase of a new medical school, it was often noted that new teachers seemed to have considerable difficulties, and often expressed these as negativity towards student placements. This did not chime with much of the work from established schools, which seemed to evaluate expansion of teaching more positively. We wanted to better understand the issues involved. Semi-structured interviews were conducted involving GPs who had received medical students over the first four years of a newly established medical school. The aims were to assess the impact of the students on the new teachers, and to try to better understand why some teachers were experiencing difficulties. We collected qualitative and quantitative data at the interviews. The qualitative data were analysed using grounded theory which aims to link emerging themes together. The findings suggest that as the quantity of teaching medical students increases, the enjoyment and commitment to teaching may decrease. Concerns over the administration of teaching may begin to predominate. Two factors may help to reduce this: 1 Adequate investment in manpower and premises to reduce time and space constraints on teaching. 2 Practices considering themselves as teaching practices where education is a part of the practice identity.

  18. Remediation of PCB [polychlorinated biphenyl] -contaminated soils from scrapyards

    International Nuclear Information System (INIS)

    MacKnight, S.

    1991-01-01

    Much of the recent attention on contamination of the environment by polychlorinated biphenyls (PCB) has focused on liquid PCB spills from electrical equipment. A new, and possibly more serious, source of PCB contamination is the scrap yard, typically located in or near major urban centers, where the local scrap dealer would purchase used transformers or other PCB-containing electrical equipment, recover copper and other metals, and dump the PCB-containing oils on the ground. With the rising value of urban and suburban lands, these scrap yards may be slated for redevelopment, making the cleanup of contaminated soils necessary. The heterogeneous distribution of scrap yard contaminants requires a very detailed site assessment, and the heterogeneous mixture of typical scrap yard contaminants (not only PCB) cannot be treated in a simple fashion. These problems are illustrated for the case of the assessment and cleanup of a scrap yard site in Nova Scotia. A grid block system was used to sample soil at the site, and samples were analyzed for PCB, metals, and hydrocarbons. The most severely contaminated spots were mapped; groundwater patterns were also examined. The remediation process can be divided into 5 phases: physical separation of uncontaminated material; three stages of separation of materials into those having single, several-but-similar, and multicomponent mixed contaminations; and selection of appropriate process technologies. Since there is currently no approved PCB destruction facility in Atlantic Canada, excavated soils containing PCB are stored securely on the site to await approval for some type of incineration process

  19. Triaxial Wetting Test on Rockfill Materials under Stress Combination Conditions of Spherical Stress p and Deviatoric Stress q

    Directory of Open Access Journals (Sweden)

    Yan-yi Zhang

    2018-01-01

    Full Text Available A GCTS medium-sized triaxial apparatus is used to conduct a single-line method wetting test on three kinds of rockfill materials of different mother rocks such as mixture of sandstone and slate, and dolomite and granite, and the test stress conditions is the combination of spherical stress p and deviatoric stress q. The test results show that (1 for wetting shear strain, the effects of spherical stress p and deviatoric stress q are equivalent, and wetting shear strain and deviatoric stress q show the power function relationship preferably. (2 For wetting volumetric strain, the effect of deviatoric stress q can be neglected because it is extremely insignificant, and spherical stress p is the main influencing factor and shows the power function relationship preferably. (3 The wetting strains decrease significantly with the increase in initial water content and sample density generally, but the excessively high dry density will increase the wetting deformation. Also, the wetting strains will decrease with the increase in the saturated uniaxial compressive strength and average softening coefficient of the mother rock. Based on the test results, a wetting strain model is proposed for rockfill materials. The verification results indicate that the model satisfactorily reflects the development law of wetting deformation.

  20. Strain partitioning in the footwall of the Somiedo Nappe: structural evolution of the Narcea Tectonic Window, NW Spain

    Science.gov (United States)

    Gutiérrez-Alonso, Gabriel

    1996-10-01

    The Somiedo Nappe is a major thrust unit in the Cantabrian Zone, the external foreland fold and thrust belt of the North Iberian Variscan orogen. Exposed at the Narcea Tectonic Window are Precambrian rocks below the basal decollement of the Somiedo Nappe, which exhibit a different deformation style than the overlying Paleozoic rocks above the basal decollement. During Variscan deformation, folding and widespread subhorizontal, bedding-parallel decollements were produced in the hanging wall within the Paleozoic rocks. Vertical folding, with related axial-planar cleavage at a high angle to the decollement planes, developed simultaneously in the upper Proterozoic Narcea Slates of the footwall, below the detachment. The relative magnitude of finite strain, measured in the footwall rocks, diminishes towards the foreland. These observations indicate that (1) significant deformation may occur in the footwall of foreland fold and thrust belts, (2) the shortening mechanism in the footwall may be different from that of the hanging wall, and (3) in this particular case, the partitioning of the deformation implies the existence of a deeper, blind decollement surface contemporaneous with the first stages of the foreland development, that does not crop out in the region. This implies a significant shortening in the footwall, which must be taken into account when restoration and balancing of cross-sections is attempted. A sequential diagram of the evolution of the Narcea Tectonic Window with a minimum shortening of 85 km is proposed, explaining the complete Variscan evolution of the foreland to hinterland transition in the North Iberian Variscan orogen.

  1. C235-V3 cyclotron for a proton therapy center to be installed in the hospital complex of radiation medicine (Dimitrovgrad)

    Science.gov (United States)

    Galkin, R. V.; Gurskii, S. V.; Jongen, Y.; Karamysheva, G. A.; Kazarinov, M. Yu.; Korovkin, S. A.; Kostromin, S. A.; Calderan, J.-M.; Cahay, P.; Mokrenko, S. P.; Morozov, N. A.; Nkongolo, H.; Ol'shevskii, A. G.; Paradis, Y.; Petrov, D. S.; Romanov, V. M.; Samsonov, E. V.; Syresin, E. M.; Shakun, A. N.; Shakun, N. G.; Shirkov, G. D.; Shirkov, S. G.

    2014-06-01

    Proton therapy is an effective method of treating oncologic diseases. In Russia, construction of several centers for proton and ion therapy is slated for the years to come. A proton therapy center in Dimitrovgrad will be the first. The Joint Institute for Nuclear Research (Russia) in collaboration with Ion Beam Application (IBA) (Belgium) has designed an C235-V3 medical proton cyclotron for this center. It outperforms previous versions of commercial IBA cyclotrons, which have already been installed in 11 oncologic hospital centers in different countries. Experimental and calculation data for the beam dynamics in the C235-V3 medical cyclotron are presented. Reasons for beam losses during acceleration are considered, the influence of the magnetic field radial component in the midplane of the accelerator and main resonances is studied, and a beam extraction system is designed. In 2011-2012 in Dubna, the cyclotron was mounted, its magnetic field was properly configured, acceleration conditions were optimized, and beam extraction tests were carried out after which it was supplied to Dimitrovgrad. In the C235-V3 cyclotron, an acceleration efficiency of 72% and an extraction efficiency of 62% have been achieved without diaphragming to form a vertical profile of the beam.

  2. Speaking Up For Science

    Science.gov (United States)

    Spilhaus, Fred

    2005-06-01

    The Smithsonian Institution's National Museum of Natural History in Washington D.C. is planning to show a film, "A Privileged Planet" that promotes creationism in the form of "intelligent design." The film is based on the book by Guillermo Gonzalez and Jay Wesley Richards, both affiliated with the Discovery Institute, which advocates teaching "intelligent design" as science in U.S. public schools. By associating with the Discovery Institute, the Smithsonian Institution will associate science with creationism and damage their credibility. The film is slated for airing on 23 June, unless the Smithsonian comes to its senses.Why is this important? Because the film promotes a long term strategy of the Discovery Institute (//www.discovery.org/csc/) to replace "materialistic science" with "intelligent design." The film fosters the idea that science should include the supernatural. This is unacceptable. AGU's position is clear, creationism is not science and AGU opposes all efforts to promote creationism as science, (The full text of the AGU position statement can be found at: //www.agu.org/sci_soc/policy/positions/evolution.shtml).

  3. Welsh Women's Industrial Fiction 1880-1910.

    Science.gov (United States)

    Bohata, Kirsti; Jones, Alexandra

    2017-10-02

    From the beginning of the genre, women writers have made a major contribution to the development of industrial writing. Although prevented from gaining first-hand experience of the coalface, Welsh women writers were amongst the first to try to fictionalize those heavy industries-coal and metal in the south, and slate in the north-which dominated the lives of the majority of the late nineteenth-century Welsh population. Treatment of industrial matter is generally fragmentary in this early women's writing; industrial imagery and metaphor may be used in novels that are not primarily "about" industry at all. Yet from c. 1880-1910, Welsh women writers made a significant-and hitherto critically neglected-attempt to make sense in literature of contemporary industrial Wales in powerful and innovative ways. This essay maps their contribution and considers anglophone Welsh women writers' adaptations and innovations of form (particularly romance) as they try to find a way of representing industrial landscapes, communities and the daily realities of industrial labour. It identifies the genesis in women's writing of tropes that would become central to later industrial fiction, including depictions of industrial accident, injury, death and disability. And it explores the representation of social relations (class, gender, ethnicity, sexuality) and conflict on this tumultuous, dangerous new stage.

  4. Implications of environmental regulations on refinery product specification, operation and investment

    International Nuclear Information System (INIS)

    Amin, M.M.

    1992-01-01

    During the 1980s, refiners mainly in OECD countries were occupied with improving their refinery configurations for producing high-value light products which would not only satisfy the product demand slate but also meet the increasingly restrictive environmental regulations. In the 1990s refiners will continue to be challenged to improve the world's air quality not only by producing products that minimize emissions of toxic and hazardous hydrocarbons, but also through the refinery operation itself by investment in upgrading the industry and products to cope with the constant flow of new regulations. These investments will not only be limited to consuming centres but will also be extended to cover exporting refineries as well due to competition of acquiring market shares for product exports. The additional cost will be directly related to product quality and site regulations and will vary from one country to the other. This paper deals mainly with the air pollution and the impact of related environmental issues on the refining industry. Environmental regulations for refinery products in the USA and Europe are examined and international regulations for the tanker industry are noted. (author)

  5. An overview of experimental techniques developed during hydrogeological investigations at Reskajeage Quarry, Cornwall

    International Nuclear Information System (INIS)

    Bolt, J.E.; Pascoe, D.M.; Watkins, V.M.B.

    1991-09-01

    In fractured rocks, the transport of dissolved radionuclides which may be released from the near-field of a radioactive waste repository will take place dominantly through the three dimensional network of fractures. Assessments of groundwater flow and radionuclide transport from an underground repository use continuum models, such as NAMMU, to predict radionuclide transport. To complement this approach, water flow and transport in fractured rock is being investigated at a more detailed level, using fracture network modelling. A test site, at Reskajeage Quarry in Cornwall, is currently being used to provide experimental data on flow and transport in fractured rock, to improve confidence in this modelling approach. This report describes the range of experimental techniques that have been used to obtain data on the positions, orientations and hydraulic properties of individual fractures in the slate. Also, brief descriptions of the design of a series of transport tests are given. The results of this work are described in a series of Nirex Safety Series Reports. (Author)

  6. An overview of experimental techniques developed during hydrogeological investigations at Reskajeage Quarry, Cornwall

    International Nuclear Information System (INIS)

    Bolt, J.E.; Pascoe, D.M.; Watkins, V.M.B.

    1991-09-01

    In fractured rocks, the transport of dissolved radionuclides which may be released from the near-field of a radioactive waste repository will take place dominantly through the three-dimensional network of fractures. Assessments of groundwater flow and radionuclide transport from an underground repository use continuum models, such as NAMMU, to predict radionuclide transport. To complement this approach, water flow and transport in fractured rock is being investigated at a more detailed level, using fracture network modelling. A test side, at Reskajeage Quarry in Cornwall, is currently being used to provide experimental data on flow and transport in fractured rock, to improve confidence in this modelling approach. This report describes the range of experimental techniques that have been used to obtain data on the positions, orientations and hydraulic properties of individual fractures in the slate. Also, brief descriptions of the design of a series of transport tests are given. The results of this work are described in a series of Nirex Safety Series Reports. (author)

  7. Deformation mechanisms in the frontal Lesser Himalayan Duplex in Sikkim Himalaya, India

    Science.gov (United States)

    Matin, Abdul; Mazumdar, Sweety

    2009-08-01

    Understanding deformation mechanisms in Himalayan rocks is a challenging proposition due to the complex nature of the deformed rocks and their genesis. Crustal deformation in the Himalayan thrust belt typically occurs in elastico-frictional (EF) or quasi-plastic (QP) regimes at depths controlled mainly by regional strain-rate and geothermal gradient. However, material property, grain-size and their progressive changes during deformation are also important controlling factors. We present evidence of EF deformation from Gondwana rocks developed during the emplacement of one of the frontal horses (Jorthang horse) in the Lesser Himalayan Duplex (LHD) structure associated with Lesser Himalayan rocks in the footwall of the Ramgarh thrust in the Rangit window near Jorthang in the Sikkim Himalaya. The rocks in the horse exhibit systematic changes in microand meso-structures from an undeformed protolith to cataclasite suggesting that it was emplaced under elastico-frictional conditions. Meso- to micro-scale shear fractures are seen developed in Gondwana sandstone and slate while intercalated fine-grained shale-coal-carbonates are deformed by cataclastic flow suggesting that material property and grain-size have played an important role in the deformation of the Jorthang horse. In contrast, the hanging wall schists and quartzites of the Ramgarh thrust exhibit quasi-plastic deformation structures. This suggests that the Jorthang horse was emplaced under shallower crustal conditions than the antiformally folded Ramgarh thrust sheet even though the Ramgarh sheet presently overlies the Jorthang horse.

  8. The advanced neutron source

    International Nuclear Information System (INIS)

    Hayter, J.B.

    1994-01-01

    The Advanced Neutron Source (ANS), slated for construction start in 1994, will be a multipurpose neutron research laboratory serving academic and industrial users in chemistry, biology, condensed matter physics, nuclear and fundamental physics, materials science and engineering, and many other fields. It will be centered on the world's highest flux neutron beam reactor, operating at 330 MW, with careful design integration between the neutron source and the experiment systems. Many instruments will be situated in low backgrounds at distances up to 80 m from the reactor, using neutron guides with tailored neutron optical coatings for beam transport. Apart from the many stations for neutron scattering research, specialized stations will also be provided for isotope separation on-line, experiments with liquid hydrogen targets, neutron optical techniques such as interferometry, activation analysis, depth profiling, and positron production. Careful consideration has been given to providing a good research environment for visiting scientists, including easy access to the experimental areas, while maintaining a highly secure nuclear facility. This paper will describe the reactor and experimental facilities and give some examples of the types of research for which ANS has been designed

  9. Cooperation and tensions in multiethnic corporate societies using Teotihuacan, Central Mexico, as a case study.

    Science.gov (United States)

    Manzanilla, Linda R

    2015-07-28

    In this paper, I address the case of a corporate society in Central Mexico. After volcanic eruptions triggered population displacements in the southern Basin of Mexico during the first and fourth centuries A.D., Teotihuacan became a multiethnic settlement. Groups from different backgrounds settled primarily on the periphery of the metropolis; nevertheless, around the core, intermediate elites actively fostered the movement of sumptuary goods and the arrival of workers from diverse homelands for a range of specialized tasks. Some of these skilled craftsmen acquired status and perhaps economic power as a result of the dynamic competition among neighborhoods to display the most lavish sumptuary goods, as well as to manufacture specific symbols of identity that distinguished one neighborhood from another, such as elaborate garments and headdresses. Cotton attire worn by the Teotihuacan elite may have been one of the goods that granted economic importance to neighborhood centers such as Teopancazco, a compound that displayed strong ties to the Gulf Coast where cotton cloth was made. The ruling elite controlled raw materials that came from afar whereas the intermediate elite may have been more active in providing other sumptuary goods: pigments, cosmetics, slate, greenstone, travertine, and foreign pottery. The contrast between the corporate organization at the base and top of Teotihuacan society and the exclusionary organization of the neighborhoods headed by the highly competitive intermediate elite introduced tensions that set the stage for Teotihuacan's collapse.

  10. HIV vaccine development: would more (public) money bring quicker results?

    Science.gov (United States)

    Winsbury, R

    1999-01-01

    Globally, $200-250 million/year are devoted to HIV vaccine research. Most of those funds pay for basic research rather than product development. Moreover, most of the funds are aimed at the HIV strain commonly found in the US and Europe, and not at the strains common to Africa and other developing countries. While US President Bill Clinton set in 1997 a 10-year target for the development of an HIV vaccine, that target date is looking increasingly unlikely. International vaccine and pharmaceutical companies typically drive vaccine research and development. However, concern over the ultimate profitability of developing and marketing an HIV vaccine, and the fear of major litigation should an eventual vaccine go awry have caused such firms to shy away from investing large amounts of money into HIV vaccine development. These companies somehow have to be attracted back into the field. A World Bank special task force is slated to present its report by mid-1999 on possible funding mechanisms to promote HIV vaccine development. It remains to be resolved whether public funds could and should be used, perhaps through a pooled international vaccine development fund. 2 new International AIDS Vaccine Initiative projects are described.

  11. Nutrient concentrations in coarse and fine woody debris of Populus tremuloides Michx.-dominated forests, northern Minnesota, USA

    Science.gov (United States)

    Klockow, Paul A.; D'Amato, Anthony W.; Bradford, John B.; Fraver, Shawn

    2014-01-01

    Contemporary forest harvesting practices, specifically harvesting woody biomass as a source of bioenergy feedstock, may remove more woody debris from a site than conventional harvesting. Woody debris, particularly smaller diameter woody debris, plays a key role in maintaining ecosystem nutrient stores following disturbance. Understanding nutrient concentrations within woody debris is necessary for assessing the long-term nutrient balance consequences of altered woody debris retention, particularly in forests slated for use as bioenergy feedstocks. Nutrient concentrations in downed woody debris of various sizes, decay classes, and species were characterized within one such forest type, Populus tremuloides Michx.-dominated forests of northern Minnesota, USA. Nutrient concentrations differed significantly between size and decay classes and generally increased as decay progressed. Fine woody debris (≤ 7.5 cm diameter) had higher nutrient concentrations than coarse woody debris (> 7.5 cm diameter) for all nutrients examined except Na and Mn, and nutrient concentrations varied among species. Concentrations of N, Mn, Al, Fe, and Zn in coarse woody debris increased between one and three orders of magnitude, while K decreased by an order of magnitude with progressing decay. The variations in nutrient concentrations observed here underscore the complexity of woody debris nutrient stores in forested ecosystems and suggest that retaining fine woody debris at harvest may provide a potentially important source of nutrients following intensive removals of bioenergy feedstocks.

  12. Détermination du niveau de contamination de l'ochratoxine A (OTA dans les fèves de cacao à l'exportation

    Directory of Open Access Journals (Sweden)

    Silué, N.

    2009-01-01

    Full Text Available Determination of Ochratoxin A (OTA Levels in Exported Cocoa. This exported cocoa ochratoxin A contamination assessment target is to answer the legal dispositions and regulations. Three hundred (300 large samples of dried cocoa beans was taken according the Commission Regulation (EC No 401/2006 and OTA was quantified by HPLC analytical methods with extraction and clean-up on immunoaffinity columns. The global result shows that 33 samples out of 300 cocoa samples have levels of OTA above 2 μg/kg that constitutes 11.04% of total cocoa production in Ivory Coast. At the port of Abidjan rejected cocao beans were evaluated to 15.65%, if the maximum authorized levels are fixed to 2 μg/kg. The result for San Pedro port showed lower levels of OTA (only 6.67%. If we consider the Ivorian regulation that the under grade cocoa bean (S/G cannot been exported (the under grade cocoa bean (S/G is the dry cocoa bean of which the mould rate is above 4%, the slated cocoa bean rate is above 8% and the defective rate is also above 6%. At the both ports rejected cocoa beans constitutes 9.50% (11% at Abidjan and 8% at San Pedro. This cocoa beans contamination by OTA can be controlled or reduced by the efficient implementation and vulgarization of the good cocoa production, if we identify the critical points of contamination in the cocoa chain production by ochratoxigen fungi.

  13. Beyond takeovers: politics comes to corporate control.

    Science.gov (United States)

    Pound, J

    1992-01-01

    In the 1990s, politics will replace takeovers as the defining tool for corporate governance challenges, and a marketplace of ideas will replace the frenzied activity that once dominated the financial marketplace in the 1980s. In the transaction-driven market of the past, corporate raiders used junk bonds and other financial tools to take control of their targets. In the new marketplace of ideas, debate will replace debt as active shareholders press specific operating policies for their target corporations in a new politicized market for corporate control. John Pound, associate professor of public policy at the John F. Kennedy School of Government at Harvard, reports that investors are already using shadow management committees, independent director slates, and outside experts to influence management policy. Pound cites Carl Icahn's battle for control of USX as an example of the emerging trend. What began as a hostile takeover ended with a negotiated solution in which many constituencies ultimately played a role in the restructuring of the company. This political approach to governance gives management a chance to embrace a bargain that is in its long-term interest. By promoting politically based tactics, managers can generate political capital with their major investors. Managers in companies as diverse as Avon and Lockheed now meet regularly with investors, seeking their input on both financial and strategic decisions. In the new politicized market for corporate control, striking a bargain with long-term investors is ultimately in the best interest of the corporation.

  14. Recent advance and applications in radiation curing of coatings

    International Nuclear Information System (INIS)

    Kishi, Naoyuki

    1976-01-01

    The recent advance and application as well as the profitability of method of coating by curing with electron beam are reviewed. The acrylic prepolymers having two or more acryloyl radicals on side chains or at the end can be cured with electron beam, and have excellent characteristics. The technique to use acrylic esters and methacrylic esters as dilutant monomers has been developed. Mitsubishi Rayon Co., Ltd. is finishing asbestos slate boards and calcium silicate boards for prefabricated houses, utilizing an electron beam curing coating line. The line serves as a semicommercial production line having the capacity of continuously coating and curing boards of 1,200 mm by 2,400 mm. It is equipped with an electron beam accelerator of 500 kV x 65 mA (max. 100 mA), a conveyor running at speed of 5 to 100 m/min, and a curtain flow coater, a roller coater and the like. It can be cured rapidly at room temperature. The finished coatings have high cross-linking density and withstand particularly blocking, freezing and solvents. Its application to the coating of automotive parts by Suzuki Automobile Co. is briefly mentioned. (Iwakiri, K.)

  15. AIDS radio triggers.

    Science.gov (United States)

    Elias, A M

    1991-07-01

    In April 1991, the Ethnic Communities' Council of NSW was granted funding under the Community AIDS Prevention and Education Program through the Department of Community Services and Health, to produce a series of 6x50 second AIDS radio triggers with a 10-second tag line for further information. The triggers are designed to disseminate culturally-sensitive information about HIV/AIDS in English, Italian, Greek, Spanish, Khmer, Turkish, Macedonian, Serbo-Croatian, Arabic, Cantonese, and Vietnamese, with the goal of increasing awareness and decreasing the degree of misinformation about HIV/AIDS among people of non-English-speaking backgrounds through radio and sound. The 6 triggers cover the denial that AIDS exists in the community, beliefs that words and feelings do not protect one from catching HIV, encouraging friends to be compassionate, compassion within the family, AIDS information for a young audience, and the provision of accurate and honest information on HIV/AIDS. The triggers are slated to be completed by the end of July 1991 and will be broadcast on all possible community, ethnic, and commercial radio networks across Australia. They will be available upon request in composite form with an information kit for use by health care professionals and community workers.

  16. Heirs to the throne

    International Nuclear Information System (INIS)

    Nudo, L.

    1993-01-01

    Methyl chloroform and CFC-113 ascended in the cleaning hierarchy as versatile, aggressive, yet safe parts cleaners. Now the U.S. Environmental Protection Agency and its global equivalents want these choice solvents to step down. Saddled with an ozone depletion potential higher than anybody cares to talk about, regulators put methyl chloroform (MCF or 1,1,1-trichloroethane) and CFC-113 (trichlorotrifluoroethane) on a list of chlorofluorocarbons (CFCs) slated for phase-out by Jan. 1, 1996. The phase-out bans production and imports of the blacklisted parts cleaners. But as production declines, the cost of cleaning components with an ozone-depleter gets prohibitive. The steep federal excise tax, shorten shelf-life of CFCs and new labeling rule are reason enough to stop using MCF and CFC-113 and start looking at alternative cleaning processes. The labeling rule mandates warning labels on any component ''manufactured with or containing'' an ozone-depleter as of May 15, 1993. There are no acceptable ''drop-in'' alternatives. Even trichloroethylene (TCE), perchloroethylene (PERC) and methylene chloride (MC) require some equipment modifications. There are plenty of other cleaning alternatives vying for the parts-cleaning throne

  17. Inmissores tempestatum in Hispania in Late antiquity

    Directory of Open Access Journals (Sweden)

    Juan Antonio Jiménez Sánchez

    2018-01-01

    Full Text Available In this work we study the belief in the existence of tempestarii or inmissores tempestatum in Hispania in Late Antiquity. Despite the scarcity of sources on this subject, those that do exist suggest that, in the Iberian Peninsula, people believed individuals to be capable of causing storms with their own will. The sources in question include two Chindaswinth laws, which express the authorities’ concerns over “storm-makers” capable of ruining the crops of others. In addition, two epigraphic testimonies, reproducing magic formulae engraved on slate (with an imprecise date between the 8th and 10th centuries suggest the presence in Hispania of the defensores mentioned by Agobard of Lyon in the Frankish Kingdom, magicians who claimed to know how to move storms away from the fields. These scarce sources can be complemented by information from Frankish Gaul sources, and particularly the aforementioned Agobard. Finally, we consider how the Church sought to combat these beliefs, appropriating and adapting them to its own thought, and replacing the evil spirits that caused storms with Satan and his demons, and the divinities that protected the fields with Christian saints and angels.

  18. TL/OSL properties of natural schist for archaeological dating and retrospective dosimetry

    International Nuclear Information System (INIS)

    Afouxenidis, D.; Stefanaki, E.C.; Polymeris, G.S.; Sakalis, A.; Tsirliganis, N.C.; Kitis, G.

    2007-01-01

    Schist, a metamorphic rock composed largely of quartz and muscovite, has been used as a building stone through the centuries in many parts of the world. In ancient Greece, it was used in buildings and monuments (Knossos, Karthaia, etc). Basic TL and OSL properties of schist are studied in the present work to evaluate its potential use in archaeological dating and retrospective dosimetry. In particular, the optical stability, as well as the linearity of the TL and OSL signal were investigated for samples of natural schist obtained from a roofing slate. The results indicate that both signals are rapidly bleached when the sample is exposed to sunlight. An exposure of 1 min reduces the TL signal by 93%, the IRSL signal by 99% and the post-IR BSL signal by 90%. The dose response was found to be linear for a radiation dose at least up to 75 Gy for the TL and the IR OSL signal and at least up to 25 Gy for the post-IR BSL signal

  19. Can Seaweed Farming Play a Role in Climate Change Mitigation and Adaptation?

    KAUST Repository

    Duarte, Carlos M.

    2017-04-12

    Seaweed aquaculture, the fastest-growing component of global food production, offers a slate of opportunities to mitigate, and adapt to climate change. Seaweed farms release carbon that maybe buried in sediments or exported to the deep sea, therefore acting as a CO2 sink. The crop can also be used, in total or in part, for biofuel production, with a potential CO2 mitigation capacity, in terms of avoided emissions from fossil fuels, of about 1,500 tons CO2 km−2 year−1. Seaweed aquaculture can also help reduce the emissions from agriculture, by improving soil quality substituting synthetic fertilizer and when included in cattle fed, lowering methane emissions from cattle. Seaweed aquaculture contributes to climate change adaptation by damping wave energy and protecting shorelines, and by elevating pH and supplying oxygen to the waters, thereby locally reducing the effects of ocean acidification and de-oxygenation. The scope to expand seaweed aquaculture is, however, limited by the availability of suitable areas and competition for suitable areas with other uses, engineering systems capable of coping with rough conditions offshore, and increasing market demand for seaweed products, among other factors. Despite these limitations, seaweed farming practices can be optimized to maximize climate benefits, which may, if economically compensated, improve the income of seaweed farmers.

  20. Vanadium-rich ruby and sapphire within Mogok Gemfield, Myanmar: implications for gem color and genesis

    Science.gov (United States)

    Zaw, Khin; Sutherland, Lin; Yui, Tzen-Fu; Meffre, Sebastien; Thu, Kyaw

    2015-01-01

    Rubies and sapphires are of both scientific and commercial interest. These gemstones are corundum colored by transition elements within the alumina crystal lattice: Cr3+ yields red in ruby and Fe2+, Fe3+, and Ti4+ ionic interactions color sapphires. A minor ion, V3+ induces slate to purple colors and color change in some sapphires, but its role in coloring rubies remains enigmatic. Trace element and oxygen isotope composition provide genetic signatures for natural corundum and assist geographic typing. Here, we show that V can dominate chromophore contents in Mogok ruby suites. This raises implications for their color quality, enhancement treatments, geographic origin, exploration and exploitation and their comparison with rubies elsewhere. Precise LA-ICP-MS analysis of ruby and sapphire from Mogok placer and in situ deposits reveal that V can exceed 5,000 ppm, giving V/Cr, V/Fe and V/Ti ratios up to 26, 78, and 97 respectively. Such values significantly exceed those found elsewhere suggesting a localized geological control on V-rich ruby distribution. Our results demonstrate that detailed geochemical studies of ruby suites reveal that V is a potential ruby tracer, encourage comparisons of V/Cr-variation between ruby suites and widen the scope for geographic typing and genesis of ruby. This will allow more precise comparison of Asian and other ruby fields and assist confirmation of Mogok sources for rubies in historical and contemporary gems and jewelry.