BOREAS TGB-1 CH4 Concentration and Flux Data from NSA Tower Sites
Hall, Forrest G. (Editor); Conrad, Sara K. (Editor); Crill, Patrick; Varner, Ruth K.
2000-01-01
The BOREAS TGB-1 team made numerous measurements of trace gas concentrations and fluxes at various NSA sites. This data set contains half-hourly averages of ambient methane (CH4) measurements and calculated fluxes for the NSA-Fen in 1996 and the NSA-BP and NSA-OJP tower sites in 1994. The purpose of this study was to determine the CH4 flux from the study area by measuring ambient CH 4 concentrations. This flux can then be compared to the chamber flux measurements taken at the same sites. The data are provided in tabular ASCII files.
BOREAS TGB-1 Soil CH4 and CO2 Profile Data from NSA Tower Sites
Crill, Patrick; Varner, Ruth K.; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor)
2000-01-01
The BOREAS TGB-1 team made numerous measurements of trace gas concentrations and fluxes at various NSA sites. This data set contains methane (CH4) and carbon dioxide (CO2) concentrations in soil profiles from the NSA-OJP, NSA-OBS, NSA-YJP, and NSA-BP sites during the period of 23-May to 20-Sep-1994. The soil gas sampling profiles of CH 4 and CO 2 were completed to quantify controls on CO2 and CH4 fluxes in the boreal forest. The data are provided in tabular ASCII files.
BOREAS TGB-6 Soil Methane Oxidation and Production from NSA BP and Fen Sites
Deck, Bruce; Wahlen, Martin; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor)
2000-01-01
The BOReal Ecosystem-Atmosphere Study Trace Gas Biogeochemistry (BOREAS TGB-6) team collected soil methane measurements at several sites in the Southern Study Area (SSA) and Northern Study Area (NSA). This data set contains soil methane consumption (bacterial CH4 oxidation) and associated C-13 fractionation effects in samples that were collected at various sites in 1994 and 1996 from enclosures (chambers). Methane C-13 data in soil gas samples from the NSA Young Jack Pine (YJP) and Old Jack Pine (OJP) sites for 1994 and 1996 are also given. Additional data on the isotopic composition of methane (carbon and hydrogen isotopes) produced in the NSA beaver ponds and fen bog in 1993 and 1994 are given as well. The data are stored in tabular ASCII files.
Diurnal Cycle of Clouds and Precipitation at the ARM SGP Site
Zhao, W.; Marchand, R.; Fu, Q.
2016-12-01
Millimeter Wavelength Cloud Radar (MMCR) data from Dec. 1996 to Dec. 2010, collected at the U. S. Department of Energy Atmospheric Radiation Measurement (ARM) program site in the U.S. Southern Great Plains (SGP), are categorized into clouds (-40dBZe≤reflectivityCRM). Observational and simulated radar reflectivity are compared and further sorted into different atmospheric states identified by Evans (2014). Evans used a neutral network to take ERA-Interim state variables (i.e. horizontal winds, relative humidity, temperature at seven predetermined pressure level and surface pressure) on an 8×8 grid with 1.5º×1.5º spatial resolution centered on the SGP site and found twenty-one atmospheric states which represent specific synoptic conditions. We use these states to study the differences in the diurnal cycle between observations and simulations. Differences in the (mean) annual diurnal cycle between the observations and model are decomposed into errors in the daily mean, errors in the diurnal variation in each state, and errors due to difference in the frequency of occurrence of atmospheric states between ERA and the MMF. The magnitude of various error sources is assessed.
Decadal Vision Progress Report Implementation Plans and Status for the Next Generation ARM Facility
Energy Technology Data Exchange (ETDEWEB)
Mather, James
2016-06-01
The reconfiguration of the ARM facility, formally initiated in early 2014, is geared toward implementing the Next Generation of the ARM Facility, which will more tightly link ARM measurements and atmospheric models. The strategy is outlined in the ARM Climate Research Facility Decadal Vision (DOE 2014a). The strategy includes the implementation of a high-resolution model, initially at the Southern Great Plains (SGP) site, and enhancements at the SGP and North Slope of Alaska (NSA) sites to provide additional observations to support modeling and process studies. Enhancements at the SGP site focus on ground-based instruments while enhancements at the NSA make use of Unmanned Aerial Systems (UAS) and Tethered Balloon Systems (TBS). It is also recognized that new data tools and data products will need to be developed to take full advantage of these improvements. This document provides an update on the status of these ARM facility enhancements, beginning with the measurement enhancements at the SGP and NSA, followed by a discussion of the modeling project including associated data-processing activities.
BOREAS TGB-3 CH4 and CO2 Chamber Flux Data over NSA Upland Sites
Savage, Kathleen; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor); Moore, Tim R.
2000-01-01
The BOReal Ecosystem-Atmosphere Study Trace Gas Biogeochemistry (BOREAS TGB-3) team collected methane and carbon dioxide (CH4, CO2) chamber flux measurements at the Northern Study Area (NSA) Fen, Old Black Spruce (OBS), Young Jack Pine (YJP), and auxiliary sites along Gillam Road and the 1989 burn site. Gas samples were extracted from chambers and analyzed at the NSA lab facility approximately every 7 days during May to September 1994 and June to October 1996. The data are provided in tabular ASCII files.
Using Self Organizing Maps to evaluate the NASA GISS AR5 SCM at the ARM SGP Site
Dong, X.; Kennedy, A. D.; Xi, B.
2010-12-01
Cluster analyses have gained popularity in recent years to establish cloud regimes using satellite and radar cloud data. These regimes can then be used to evaluate climate models or to determine what large-scale or subgrid processes are responsible for cloud formation. An alternative approach is to first classify the meteorological regimes (i.e. synoptic pattern and forcing) and then determine what cloud scenes occur. In this study, a competitive neural network known as the Self Organizing Map (SOM) is used to classify synoptic patterns over the Southern Great Plains (SGP) region to evaluate simulated clouds from the AR5 version of the NASA GISS Model E Single Column Model (SCM). In detail, 54-class SOMs have been developed using North American Regional Reanalysis (NARR) variables averaged to 2x2.5 degree latitude longitude grid boxes for a region of 7x7 grid boxes centered on the ARM SGP site. Variables input into the SOM include mean sea-level pressure and the horizontal wind components, relative humidity, and geopotential height at the 900, 500, and 300 hPa levels. These SOMs are produced for the winter (DJF), spring (MAM), summer (JJA), and fall (SON) seasons during 1999-2001. This synoptic typing will be associated with observed cloud fractions and forcing properties from the ARM SGP site and then used to evaluate simulated clouds from the SCM. SOMs provide a visually intuitive way to understand their classifications because classes are related to each other in a two-dimensional space. In Fig. 1 for example, the reader can easily see for a 54 class SOM during the winter season, classes with higher 300 hPa mean relative humidities are clustered near each other. This allows for the user to identify that there appears to be a relationship between mean 300 hPa RH and high cloud fraction as observed by the ARM SGP site. Figure 1. Mean high cloud fraction (top panel) and 300 hPa Relative Humidity (bottom panel) for a 9x6 (54 class) SOM during the winter (DJF) season
BOREAS TGB-1 NSA SF6 Chamber Flux Data
Crill, Patrick; Varner, Ruth K.; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor)
2000-01-01
The BOREAS TGB-1 team made several chamber and tower measurements of trace gases at sites in the BOREAS NSA. This data set contains sulfur hexafluoride (SF6) dark chamber flux measurements at the NSA-OJP and NSA-YJP sites from 16-May through 13-Sep-1994. Gas samples were extracted approximately every 7 days from dark chambers and analyzed at the NSA lab facility. The data are provided in tabular ASCII files.
Directory of Open Access Journals (Sweden)
James Barnard
2013-09-01
Full Text Available Well-known cloud-screening algorithms, which are designed to remove cloud-contaminated aerosol optical depths (AOD from Multifilter Rotating Shadowband Radiometer (MFRSR and Normal Incidence Multifilter Radiometer (NIMFR measurements, have exhibited excellent performance at many middle-to-low latitude sites around world. However, they may occasionally fail under challenging observational conditions, such as when the sun is low (near the horizon and when optically thin clouds with small spatial inhomogeneity occur. Such conditions have been observed quite frequently at the high-latitude Atmospheric Radiation Measurement (ARM North Slope of Alaska (NSA sites. A slightly modified cloud-screening version of the standard algorithm is proposed here with a focus on the ARM-supported MFRSR and NIMFR data. The modified version uses approximately the same techniques as the standard algorithm, but it additionally examines the magnitude of the slant-path line of sight transmittance and eliminates points when the observed magnitude is below a specified threshold. Substantial improvement of the multi-year (1999–2012 aerosol product (AOD and its Angstrom exponent is shown for the NSA sites when the modified version is applied. Moreover, this version reproduces the AOD product at the ARM Southern Great Plains (SGP site, which was originally generated by the standard cloud-screening algorithms. The proposed minor modification is easy to implement and its application to existing and future cloud-screening algorithms can be particularly beneficial for challenging observational conditions.
BOREAS TGB-5 Dissolved Organic Carbon Data from NSA Beaver Ponds
Bourbonniere, Rick; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor)
2000-01-01
The BOReal Ecosystem-Atmosphere Study Trace Gas Biogeochemistry (BOREAS TGB-5) team collected several data sets related to carbon and trace gas fluxes and concentrations in the Northern Study Area (NSA). This data set contains concentrations of dissolved organic and inorganic carbon species from water samples collected at various NSA sites. In particular, this set covers the NSA Tower Beaver Pond Site and the NSA Gillam Road Beaver Pond Site, including data from all visits to open water sampling locations during the BOREAS field campaigns from April to September 1994. The data are provided in tabular ASCII files.
BOREAS TE-20 Soils Data Over the NSA-MSA and Tower Sites in Vector Format
Hall, Forrest G. (Editor); Veldhuis, Hugo; Knapp, David
2000-01-01
The BOREAS TE-20 team collected several data sets for use in developing and testing models of forest ecosystem dynamics. This data set contains vector layers of soil maps that were received from Dr. Hugo Veldhuis, who did the original mapping in the field during 1994. The vector layers were converted to ARCANFO EXPORT files. These data cover 1-kilometer diameters around each of the NSA tower sites, and another layer covers the NSA-MSA. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Center (DAAC).
BOREAS TF-8 NSA-OJP and SSA-OBS Ceilometer Data
Moore, Kathleen E.; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Fitzjarrald, David R.
2000-01-01
The BOREAS TF-8 team used ceilometers to collect data on the fraction of the sky covered with clouds and the cloud height. Included with these data is the surface-based lifting condensation level, derived from temperature and humidity values acquired at the flux tower at the NSA-OJP site. Ceilo-meter data were collected at the NSA-OJP site in 1994 and at the NSA-OJP and SSA-OBS sites in 1996. The data are available in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884).
Schmid, B.; Arnott, P.; Bucholtz, A.; Colarco, P.; Covert, D.; Eilers, J.; Elleman, R.; Ferrare, R.; Flagan, R.; Jonsson, H.
2003-01-01
In order to meet one of its goals - to relate observations of radiative fluxes and radiances to the atmospheric composition - the Department of Energy's Atmospheric Radiation Measurement (ARM) program has pursued measurements and modeling activities that attempt to determine how aerosols impact atmospheric radiative transfer, both directly and indirectly. However, significant discrepancies between aerosol properties measured in situ or remotely remain. One of the objectives of the Aerosol Intensive Operational Period (TOP) conducted by ARM in May 2003 at the ARM Southern Great Plains (SGP) site in north central Oklahoma was to examine and hopefully reduce these differences. The IOP involved airborne measurements from two airplanes over the heavily instrumented SGP site. We give an overview of airborne results obtained aboard the Center for Interdisciplinary Remotely-Piloted Aircraft Studies (CIRPAS) Twin Otter aircraft. The Twin Otter performed 16 research flights over the SGP site. The aircraft carried instrumentation to perform in-situ measurements of aerosol absorption, scattering, extinction and particle size. This included such novel techniques as the photoacoustic and cavity ring-down methods for in-situ absorption (675 nm) and extinction (675 and 1550 nm) and a new multiwavelength, filter-based absorption photometer (467, 530, 660 nm). A newly developed instrument measured cloud condensation nucleus concentration (CCN) concentrations at two supersaturation levels. Aerosol optical depth and extinction (354-2139 nm) were measured with the NASA Ames Airborne Tracking 14-channel sunphotometer. Furthermore, up-and downwelling solar (broadband and spectral) and infrared radiation were measured using seven individual radiometers. Three up-looking radiometers werer mounted on a newly developed stabilized platform, keeping the instruments level up to aircraft pitch and roll angles of approximately 10(exp 0). This resulted in unprecedented continuous vertical profiles
BOREAS TGB-1 NSA CH4 and CO2 Chamber Flux Data
Hall, Forrest G. (Editor); Conrad, Sara K. (Editor); Crill, Patrick; Varner, Ruth K.
2000-01-01
The BOREAS TGB-1 team made methane (CH4) and carbon dioxide (CO2) dark chamber flux measurements at the NSA-OJP, NSA-OBS, NSA-BP, and NSA-YJP sites from 16-May-1994 through 13-Sep-1994. Gas samples were extracted approximately every 7 days from dark chambers and analyzed at the NSA lab facility. The data are provided in tabular ASCII files.
BOREAS TGB-12 Isotropic Carbon Dioxide Data over the NSA
Trumbore, Susan; Hall, Forrest G. (Editor); Sundquist, Eric; Winston, Greg; Conrad, Sara K. (Editor)
2000-01-01
The BOREAS TGB-12 team made measurements of soil carbon inventories, carbon concentration in soil gases, and rates of soil respiration at several sites to estimate the rates of carbon accumulation and turnover in each of the major vegetation types. This data set contains information on the carbon isotopic content of carbon dioxide sampled from soils in the NSA-OBS, NSA-YJP, and NSA-OJP sites. Data were collected from 14-Nov-1993 to 10-Oct-1996. The data are stored in tabular ASCII files.
Kawamoto, Kazuaki; Minnis, Patrick; Smith, William L., Jr.
2001-01-01
One of the most perplexing problems in satellite cloud remote sensing is the overlapping of cloud layers. Although most techniques assume a 1-layer cloud system in a given retrieval of cloud properties, many observations are affected by radiation from more than one cloud layer. As such, cloud overlap can cause errors in the retrieval of many properties including cloud height, optical depth, phase, and particle size. A variety of methods have been developed to identify overlapped clouds in a given satellite imager pixel. Baum el al. (1995) used CO2 slicing and a spatial coherence method to demonstrate a possible analysis method for nighttime detection of multilayered clouds. Jin and Rossow (1997) also used a multispectral CO2 slicing technique for a global analysis of overlapped cloud amount. Lin et al. (1999) used a combination infrared, visible, and microwave data to detect overlapped clouds over water. Recently, Baum and Spinhirne (2000) proposed 1.6 and 11 microns. bispectral threshold method. While all of these methods have made progress in solving this stubborn problem, none have yet proven satisfactory for continuous and consistent monitoring of multilayer cloud systems. It is clear that detection of overlapping clouds from passive instruments such as satellite radiometers is in an immature stage of development and requires additional research. Overlapped cloud systems also affect the retrievals of cloud properties over the ARM domains (e.g., Minnis et al 1998) and hence should identified as accurately as possible. To reach this goal, it is necessary to determine which information can be exploited for detecting multilayered clouds from operational meteorological satellite data used by ARM. This paper examines the potential information available in spectral data available on the Geostationary Operational Environmental Satellite (GOES) imager and the NOAA Advanced Very High Resolution Radiometer (AVHRR) used over the ARM SGP and NSA sites to study the
Heterogeneous surface fluxes and their effects on the SGP CART site
International Nuclear Information System (INIS)
Doran, J.C.; Hu, Q.; Hubbe, J.M.; Liljegren, J.C.; Shaw, W.J.; Zhong, S.; Collatz, G.J.
1995-03-01
The treatment of subgrid-scale variations of surface properties and the resultant spatial variations of sensible and latent heat fluxes has received increasing attention in recent years. Mesoscale numerical simulations of highly idealized conditions, in which strong flux contrasts exist between adjacent surfaces, have shown that under some circumstances the secondary circulations induced by land-use differences can significantly affect the properties of the planetary boundary layer (PBL) and the region of the atmosphere above the PBL. At the Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site, the fluxes from different land-surface types are not expected to differ as dramatically as those found in idealized simulations. Although the corresponding effects on the atmosphere should thus be less dramatic, they are still potentially important. From an ARM perspective, in tests of single column models (SCMs) it would be useful to understand the effects of the lower boundary conditions on model performance. We describe here our initial efforts to characterize the variable surface fluxes over the CART site and to assess their effects on the PBL that are important for the performance of SCMs
BOREAS TGB-12 Soil Carbon Data over the NSA
Trumbore, Susan; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor); Harden, Jennifer; Sundquist, Eric; Winston, Greg
2000-01-01
The BOREAS TGB-12 team made measurements of soil carbon inventories, carbon concentration in soil gases, and rates of soil respiration at several sites to estimate the rates of carbon accumulation and turnover in each of the major vegetation types. TGB-12 data sets include soil properties at tower and selected auxiliary sites in the BOREAS NSA and data on the seasonal variations in the radiocarbon content of CO2 in the soil atmosphere at NSA tower sites. The sampling strategies for soils were designed to take advantage of local fire chronosequences, so that the accumulation of C in areas of moss regrowth could be determined. These data are used to calculate the inventory of C and N in moss and mineral soil layers at NSA sites and to determine the rates of input and turnover (using both accumulation since the last stand-killing fire and radiocarbon data). This data set includes physical parameters needed to determine carbon and nitrogen inventory in soils. The data were collected discontinuously from August 1993 to July 1996. The data are stored in tabular ASCII files.
Tang, S.; Xie, S.; Tang, Q.; Zhang, Y.
2017-12-01
Two types of instruments, the eddy correlation flux measurement system (ECOR) and the energy balance Bowen ratio system (EBBR), are used at the Atmospheric Radiation Measurement (ARM) program Southern Great Plains (SGP) site to measure surface latent and sensible fluxes. ECOR and EBBR typically sample different land surface types, and the domain-mean surface fluxes derived from ECOR and EBBR are not always consistent. The uncertainties of the surface fluxes will have impacts on the derived large-scale forcing data and further affect the simulations of single-column models (SCM), cloud-resolving models (CRM) and large-eddy simulation models (LES), especially for the shallow-cumulus clouds which are mainly driven by surface forcing. This study aims to quantify the uncertainties of the large-scale forcing caused by surface turbulence flux measurements and investigate the impacts on cloud simulations using long-term observations from the ARM SGP site.
SGP Cloud and Land Surface Interaction Campaign (CLASIC): Measurement Platforms
Energy Technology Data Exchange (ETDEWEB)
MA Miller; R Avissar; LK Berg; SA Edgerton; ML Fischer; TJ Jackson; B. Kustas; PJ Lamb; G McFarquhar; Q Min; B Schmid; MS Torn; DD Tuner
2007-06-01
The Cloud and Land Surface Interaction Campaign (CLASIC) will be conducted from June 8 to June 30, 2007, at the U.S. Department of Energy’s Atmospheric Radiation Measurement (ARM) Climate Research Facility (ACRF) Southern Great Plains (SGP) site. Data will be collected using eight aircraft equipped with a variety of specialized sensors, four specially instrumented surface sites, and two prototype surface radar systems. The architecture of CLASIC includes a high-altitude surveillance aircraft and enhanced vertical thermodynamic and wind profile measurements that will characterize the synoptic scale structure of the clouds and the land surface within the ACRF SGP site. Mesoscale and microscale structures will be sampled with a variety of aircraft, surface, and radar observations. An overview of the measurement platforms that will be used during the CLASIC are described in this report. The coordination of measurements, especially as it relates to aircraft flight plans, will be discussed in the CLASIC Implementation Plan.
Energy Technology Data Exchange (ETDEWEB)
Dong, Xiquan [Univ. of North Dakota, Grand Forks, ND (United States). Dept. of Atmospheric Sciences; Univ. of Arizona, Tucson, AZ (United States). Dept. of Hydrology and Atmospheric Sciences
2016-10-26
In this proposed research, we will investigate how different meteorological regimes and aerosol sources affect DCS properties, diurnal and life cycles, and precipitation using multiple observational platforms (surface, satellite, and aircraft) and NARR reanalysis at the ARM SGP site. The Feng et al. (2011, 2012) DCS results will serve as a starting point for this proposed research, and help us to address some fundamental issues of DCSs, such as convective initiation, rain rate, areal extent (including stratiform and convective regions), and longevity. Convective properties will be stratified by meteorological regime (synoptic/mesoscale patterns) identified by reanalysis. Aerosol information obtained from the ARM SGP site will also be stratified by meteorological regimes to understand their effects on convection. Finally, the aircraft in-situ measurements and various radar observations and retrievals during the MC3E campaign will provide a “cloud-truth” dataset and are an invaluable data source for verifying the findings and investigating the proposed hypotheses in Objective 1.
BOREAS TGB-1/TGB-3 NEE Data over the NSA Fen
Bellisario, Lianne; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor); Moore, Tim R.
2000-01-01
The BOReal Ecosystem-Atmosphere Study Trace Gas Biogeochemistry (BOREAS TGB-1) and TGB-3 teams collected several data sets that contributed to understanding the measured trace gas fluxes over sites in the Northern Study Area (NSA). This data set contains Net Ecosystem Exchange of CO2 (NEE) measurements collected with chambers at the NSA fen in 1994 and 1996. Gas samples were extracted approximately every 7 days from chambers and analyzed at the NSA lab facility. The data are provided in tabular ASCII files.
Strategy for long-term 3D cloud-resolving simulations over the ARM SGP site and preliminary results
Lin, W.; Liu, Y.; Song, H.; Endo, S.
2011-12-01
Parametric representations of cloud/precipitation processes continue having to be adopted in climate simulations with increasingly higher spatial resolution or with emerging adaptive mesh framework; and it is only becoming more critical that such parameterizations have to be scale aware. Continuous cloud measurements at DOE's ARM sites have provided a strong observational basis for novel cloud parameterization research at various scales. Despite significant progress in our observational ability, there are important cloud-scale physical and dynamical quantities that are either not currently observable or insufficiently sampled. To complement the long-term ARM measurements, we have explored an optimal strategy to carry out long-term 3-D cloud-resolving simulations over the ARM SGP site using Weather Research and Forecasting (WRF) model with multi-domain nesting. The factors that are considered to have important influences on the simulated cloud fields include domain size, spatial resolution, model top, forcing data set, model physics and the growth of model errors. The hydrometeor advection that may play a significant role in hydrological process within the observational domain but is often lacking, and the limitations due to the constraint of domain-wide uniform forcing in conventional cloud system-resolving model simulations, are at least partly accounted for in our approach. Conventional and probabilistic verification approaches are employed first for selected cases to optimize the model's capability of faithfully reproducing the observed mean and statistical distributions of cloud-scale quantities. This then forms the basis of our setup for long-term cloud-resolving simulations over the ARM SGP site. The model results will facilitate parameterization research, as well as understanding and dissecting parameterization deficiencies in climate models.
Eddy Correlation Flux Measurement System Handbook
Energy Technology Data Exchange (ETDEWEB)
Cook, D. R. [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-01-01
The eddy correlation (ECOR) flux measurement system provides in situ, half-hour measurements of the surface turbulent fluxes of momentum, sensible heat, latent heat, and carbon dioxide (CO2) (and methane at one Southern Great Plains extended facility (SGP EF) and the North Slope of Alaska Central Facility (NSA CF). The fluxes are obtained with the eddy covariance technique, which involves correlation of the vertical wind component with the horizontal wind component, the air temperature, the water vapor density, and the CO2 concentration. The instruments used are: • a fast-response, three-dimensional (3D) wind sensor (sonic anemometer) to obtain the orthogonal wind components and the speed of sound (SOS) (used to derive the air temperature) • an open-path infrared gas analyzer (IRGA) to obtain the water vapor density and the CO2 concentration, and • an open-path infrared gas analyzer (IRGA) to obtain methane density and methane flux at one SGP EF and at the NSA CF. The ECOR systems are deployed at the locations where other methods for surface flux measurements (e.g., energy balance Bowen ratio [EBBR] systems) are difficult to employ, primarily at the north edge of a field of crops. A Surface Energy Balance System (SEBS) has been installed collocated with each deployed ECOR system in SGP, NSA, Tropical Western Pacific (TWP), ARM Mobile Facility 1 (AMF1), and ARM Mobile Facility 2 (AMF2). The surface energy balance system consists of upwelling and downwelling solar and infrared radiometers within one net radiometer, a wetness sensor, and soil measurements. The SEBS measurements allow the comparison of ECOR sensible and latent heat fluxes with the energy balance determined from the SEBS and provide information on wetting of the sensors for data quality purposes. The SEBS at one SGP and one NSA site also support upwelling and downwelling PAR measurements to qualify those two locations as Ameriflux sites.
Improvements in AVHRR Daytime Cloud Detection Over the ARM NSA Site
Chakrapani, V.; Spangenberg, D. A.; Doelling, D. R.; Minnis, P.; Trepte, Q. Z.; Arduini, R. F.
2001-01-01
Clouds play an important role in the radiation budget over Arctic and Antarctic. Because of limited surface observing capabilities, it is necessary to detect clouds over large areas using satellite imagery. At low and mid-latitudes, satellite-observed visible (VIS; 0.65 micrometers) and infrared (IR; 11 micrometers) radiance data are used to derive cloud fraction, temperature, and optical depth. However, the extreme variability in the VIS surface albedo makes the detection of clouds from satellite a difficult process in polar regions. The IR data often show that the surface is nearly the same temperature or even colder than clouds, further complicating cloud detection. Also, the boundary layer can have large areas of haze, thin fog, or diamond dust that are not seen in standard satellite imagery. Other spectral radiances measured by satellite imagers provide additional information that can be used to more accurately discriminate clouds from snow and ice. Most techniques currently use a fixed reflectance or temperature threshold to decide between clouds and clear snow. Using a subjective approach, Minnis et al. (2001) found that the clear snow radiance signatures vary as a function of viewing and illumination conditions as well as snow condition. To routinely process satellite imagery over polar regions with an automated algorithm, it is necessary to account for this angular variability and the change in the background reflectance as snow melts, vegetation grows over land, and melt ponds form on pack ice. This paper documents the initial satellite-based cloud product over the Atmospheric Radiation Measurement (ARM) North Slope of Alaska (NSA) site at Barrow for use by the modeling community. Cloud amount and height are determined subjectively using an adaptation of the methodology of Minnis et al. (2001) and the radiation fields arc determined following the methods of Doelling et al. (2001) as applied to data taken during the Surface Heat and Energy Budget of the
BOREAS TGB-1/TGB-3 CH4 Chamber Flux Data over the NSA Fen
Bubier, Jill L.; Moore, Tim R.; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor)
2000-01-01
The BOREAS TGB-3 team collected methane (CH4) chamber flux measurements at the NSA fen site during May-September 1994 and June-October 1996. Gas samples were extracted approximately every 7 days from chambers and analyzed at the NSA lab facility. The data are provided in tabular ASCII files.
BOREAS TE-20 Soils Data Over the NSA-MSA and Tower Sites in Raster Format
Hall, Forrest G. (Editor); Veldhuis, Hugo; Knapp, David; Veldhuis, Hugo
2000-01-01
The BOREAS TE-20 team collected several data sets for use in developing and testing models of forest ecosystem dynamics. This data set was gridded from vector layers of soil maps that were received from Dr. Hugo Veldhuis, who did the original mapping in the field during 1994. The vector layers were gridded into raster files that cover the NSA-MSA and tower sites. The data are stored in binary, image format files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Center (DAAC).
Cloud properties derived from two lidars over the ARM SGP site
Energy Technology Data Exchange (ETDEWEB)
Dupont, Jean-Charles; Haeffelin, Martial; Morille, Y.; Comstock, Jennifer M.; Flynn, Connor J.; Long, Charles N.; Sivaraman, Chitra; Newsom, Rob K.
2011-02-16
[1] Active remote sensors such as lidars or radars can be used with other data to quantify the cloud properties at regional scale and at global scale (Dupont et al., 2009). Relative to radar, lidar remote sensing is sensitive to very thin and high clouds but has a significant limitation due to signal attenuation in the ability to precisely quantify the properties of clouds with a 20 cloud optical thickness larger than 3. In this study, 10-years of backscatter lidar signal data are analysed by a unique algorithm called STRucture of ATmosphere (STRAT, Morille et al., 2007). We apply the STRAT algorithm to data from both the collocated Micropulse lidar (MPL) and a Raman lidar (RL) at the Atmospheric Radiation Measurement (ARM) Southern Great Plains (SGP) site between 1998 and 2009. Raw backscatter lidar signal is processed and 25 corrections for detector deadtime, afterpulse, and overlap are applied. (Campbell et al.) The cloud properties for all levels of clouds are derived and distributions of cloud base height (CBH), top height (CTH), physical cloud thickness (CT), and optical thickness (COT) from local statistics are compared. The goal of this study is (1) to establish a climatology of macrophysical and optical properties for all levels of clouds observed over the ARM SGP site 30 and (2) to estimate the discrepancies induced by the two remote sensing systems (pulse energy, sampling, resolution, etc.). Our first results tend to show that the MPLs, which are the primary ARM lidars, have a distinctly limited range where all of these cloud properties are detectable, especially cloud top and cloud thickness, but even actual cloud base especially during summer daytime period. According to the comparisons between RL and MPL, almost 50% of situations show a signal to noise ratio too low (smaller than 3) for the MPL in order to detect clouds higher than 7km during daytime period in summer. Consequently, the MPLderived annual cycle of cirrus cloud base (top) altitude is
International Nuclear Information System (INIS)
Riedi, J.; Goloub, P.; Marchand, Roger T.
2001-01-01
In our present study, cloud boundaries derived from a combination of active remote sensors at the ARM SGP site are compared to POLDER cloud top phase index which is derived from polarimetric measurements using an innovative method. This approach shows the viability of the POLDER phase retrieval algorithm, and also leads to interesting results. In particular, the analysis demonstrates the sensitivity of polarization measurements to ice crystal shape and indicates that occurrence of polycrystalline ice clouds has to be taken into account in order to improve the POLDER phase retrieval algorithm accuracy. Secondly, the results show that a temperature threshold of 240 K could serve for cloud top particle phase classification. Considering the limitations of the analysis, the temperature threshold could be biased high, but not by more than about 5 degrees
Energy Technology Data Exchange (ETDEWEB)
Zak, D. B.; Church, H.; Ivey, M.; Yellowhorse, L.; Zirzow, J.; Widener, K. B.; Rhodes, P.; Turney, C.; Koontz, A.; Stamnes, K.; Storvold, R.; Eide, H. A.; Utley, P.; Eagan, R.; Cook, D.; Hart, D.; Wesely, M.
2000-04-04
Since the 1997 Atmospheric Radiation Measurement (ARM) Science Team Meeting, the North Slope of Alaska and Adjacent Arctic Ocean (NSA/AAO) Cloud and Radiation Testbed (CART) site has come into being. Much has happened even since the 1998 Science Team Meeting at which this paper was presented. To maximize its usefulness, this paper has been updated to include developments through July 1998.
BOREAS TGB-1/TGB-3 Water Table and Peat Temperature Data over the NSA
Bubier, Jill L.; Comer, Neil; Moore, Tim R.; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor)
2000-01-01
The BOREAS TGB-1 and TGB-3 teams collected several data sets that contributed to understanding the measured trace gas fluxes over sites in the NSA. This data set contains continuous and manual measurements of water level and air and soil temperatures at the four subsites within the NSA Tower Fen site complex. The measurements were taken to understand the thermal and hydrological gradients associated with each plant community present in the fen. Measurements were taken from May to September 1994 and May to October 1996. The data are provided in tabular ASCII files.
BOREAS TGB-12 Rn-222 Flux Data over the NSA
Hall, Forrest G. (Editor); Conrad, Sara K.; Trumbore, Susan; Sundquist, Eric; Winston, Greg
2000-01-01
The BOREAS TGB-12 team made measurements of soil carbon inventories, carbon concentration in soil gases, and rates of soil respiration at several sites to estimate the rates of carbon accumulation and turnover in each of the major vegetation types. Sampling strategies for soils were designed to take advantage of local fire chronosequences, so that the accumulation of carbon in new moss growth could be determined. All the data are used to 1) calculate the inventory of carbon and nitrogen in moss and mineral soil layers at NSA sites, 2) determine the rates of input and turnover (using both accumulation since the last stand-killing fire and radiocarbon data), and 3) link changes in soil respiration rate to shifts in the C-14 content of soil CO2 to determine the average "age" respired CO2. These Rn-222 flux data were collected from 15-Nov-1993 to 16-Aug-1994 over the NSA sites. The data in this data set are stored in tabular ASCII files.
46 CFR Sec. 2 - Description of NSA-WORKSMALREP Contract.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Description of NSA-WORKSMALREP Contract. Sec. 2 Section... REPAIRS-NSA-WORKSMALREP Sec. 2 Description of NSA-WORKSMALREP Contract. This is an individual fixed price contract which may be awarded to any firm not holding an NSA-LUMPSUMREP Contract, as a result of formal...
A one-year climatology using data from the Southern Great Plains (SGP) site micropulse lidar
Energy Technology Data Exchange (ETDEWEB)
Mace, G.G.; Ackerman, T.P. [Penn State Univ., University Park, PA (United States); Spinhirne, J.; Scott, S. [NASA Goddard Space Flight Center, Greenbelt, MD (United States)
1996-04-01
The micropulse lidar (MPL) has been operational at the Southern Great Plains (SGP) site of the Atmospheric Radiation Measurement Program for the past 15 months. The compact MPL is unique among research lidar systems in that it is eye-safe and operates continuously, except during precipitation. The MPL is capable of detecting cloud base throughout the entire depth of the troposphere. The MPL data set is an unprecedented time series of cloud heights. It is a vital resource for understanding the frequency of cloud ocurrence and the impact of clouds on the surface radiation budget, as well as for large-scale model validation and satellite retrieval verification. The raw lidar data are processed for cloud base height at a temporal frequency of one minute and a vertical resolution of 270 m. The resultant time series of cloud base is used to generate histograms as a function of month and time of day. Sample results are described.
BOREAS TGB-3 Plant Species Composition Data over the NSA Fen
Bubier, Jill L.; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor)
2000-01-01
The BOReal Ecosystem-Atmosphere Study Trace Gas Biogeochemistry (BOREAS TGB-3) team collected several data sets that contributed to understanding the measured trace gas fluxes over sites in the Northern Study Area (NSA). This data set contains information about the composition of plant species that were within the collars used to measure Net Ecosystem Exchange of CO2 (NEE). The species composition was identified to understand the differences in NEE among the various plant communities in the NSA fen. The data were collected in July of 1994 and 1996. The data are contained in comma-delimited, ASCII files.
BOREAS TGB-12 Rn-222 Activity Data over the NSA
Trumbore, Susan; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor); Sundquist, Eric; Winston, Greg
2000-01-01
The BOREAS TGB-12 team made measurements of soil carbon inventories, carbon concentration in soil gases, and rates of soil respiration at several sites to estimate the rates of carbon accumulation and turnover in each of the major vegetation types. Sampling strategies for soils were designed to take advantage of local fire chronosequences, so that the accumulation of carbon in regrowing mosses could be determined. All the data are used to: (1) calculate the inventory of carbon and nitrogen in moss and mineral soil layers at NSA sites, (2) determine the rates of input and turnover (using both accumulation since the last stand-killing fire and radiocarbon data), and (3) link changes in soil respiration rate to shifts in the C-14 content of soil CO2 to determine the average "age" respired CO2 . These Rn-222 activity data were collected from 15-Nov-1993 to 16-Aug-1994 over the NSA sites. They are useful for determining the rate of gas exchange between soil and the overlying atmosphere. The data in this data set are stored in tabular ASCII files.
BOREAS TF-3 Automated Chamber CO2 Flux Data from the NSA-OBS
Goulden, Michael L.; Crill, Patrick M.; Hall, Forrest G. (Editor); Conrad, Sara (Editor)
2000-01-01
The BOReal Ecosystem Atmosphere Study Tower Flux (BOREAS TF-3) and Trace Gas Biogeochemistry (TGB-1) teams collected automated CO2 chamber flux data in their efforts to fully describe the CO2 flux at the Northern Study Area-Old Black Spruce (NSA-OBS) site. This data set contains fluxes of CO2 at the NSA-OBS site measured using automated chambers. In addition to reporting the CO2 flux, it reports chamber air temperature, moss temperature, and light levels during each measurement. The data set covers the period from 23-Sep-1995 through 26-Oct-1995 and from 28-May-1996 through 21-Oct-1996. The data are stored in tabular ASCII files.
International Nuclear Information System (INIS)
Liu Chunyu; Mu Junqing; Zou Jianwen; Liu Songtao
2007-01-01
Objective: To investigate the relationship between serum IL-6, Sgp80, Sgpl30 levels and bone metabolism in patients with Graves' disease. Methods: Serum levels of IL-6 (with RIA), Sgp80, Sgpl30 (with ELISA) as well as BMD of proximal femur region were determined in 78 patients with Graves' disease (26 not treated yet, 26 partially remitted and 26 in remission) and 30 controls. Results: The serum IL-6 and Sgpl30 levels in all the patients with Graves' disease were significantly higher than those in controls (P 3 , FT 4 , phosphorous, BGP and urinary hydroxy proline levels. BMD of the proximal femur region in patients partially remitted were much lower than that in controls (P<0.05). Conclusion: Serum Sgp80 level might be taken as an important parameter in studying of Graves' disease. Bone loss, both cortical and trabecular, occurred in patients with Graves' disease. Increase of bone formation as well as bone resorption were primary, not secondary to each other. (authors)
NSA Diana Wueger Published in Washington Quarterly
Grant, Catherine L.
2016-01-01
National Security Affairs (NSA) News NSA Faculty Associate for Research Diana Wueger has recently had an article titled “India’s Nuclear-Armed Submarines: Deterrence or Danger?” published in the Washington Quarterly.
Structures of Ebola virus GP and sGP in complex with therapeutic antibodies.
Pallesen, Jesper; Murin, Charles D; de Val, Natalia; Cottrell, Christopher A; Hastie, Kathryn M; Turner, Hannah L; Fusco, Marnie L; Flyak, Andrew I; Zeitlin, Larry; Crowe, James E; Andersen, Kristian G; Saphire, Erica Ollmann; Ward, Andrew B
2016-08-08
The Ebola virus (EBOV) GP gene encodes two glycoproteins. The major product is a soluble, dimeric glycoprotein (sGP) that is secreted abundantly. Despite the abundance of sGP during infection, little is known regarding its structure or functional role. A minor product, resulting from transcriptional editing, is the transmembrane-anchored, trimeric viral surface glycoprotein (GP). GP mediates attachment to and entry into host cells, and is the intended target of antibody therapeutics. Because large portions of sequence are shared between GP and sGP, it has been hypothesized that sGP may potentially subvert the immune response or may contribute to pathogenicity. In this study, we present cryo-electron microscopy structures of GP and sGP in complex with GP-specific and GP/sGP cross-reactive antibodies undergoing human clinical trials. The structure of the sGP dimer presented here, in complex with both an sGP-specific antibody and a GP/sGP cross-reactive antibody, permits us to unambiguously assign the oligomeric arrangement of sGP and compare its structure and epitope presentation to those of GP. We also provide biophysical evaluation of naturally occurring GP/sGP mutations that fall within the footprints identified by our high-resolution structures. Taken together, our data provide a detailed and more complete picture of the accessible Ebolavirus glycoprotein landscape and a structural basis to evaluate patient and vaccine antibody responses towards differently structured products of the GP gene.
BOREAS TF-8 NSA-OJP Tower Flux, Meteorological, and Soil Temperature Data
Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Moore, Kathleen E.; Fitzjarrald, David R.
2000-01-01
The BOREAS TF-8 team collected energy, CO2, and water vapor flux data at the BOREAS NSA-OJP site during the growing season of 1994 and most of the year for 1996. The data are available in tabular ASCII files.
The Sperm-surface glycoprotein, SGP, is necessary for fertilization in the frog, Xenopus laevis.
Nagai, Keita; Ishida, Takuya; Hashimoto, Takafumi; Harada, Yuichirou; Ueno, Shuichi; Ueda, Yasushi; Kubo, Hideo; Iwao, Yasuhiro
2009-06-01
To identify a molecule involved in sperm-egg plasma membrane binding at fertilization, a monoclonal antibody against a sperm-surface glycoprotein (SGP) was obtained by immunizing mice with a sperm membrane fraction of the frog, Xenopus laevis, followed by screening of the culture supernatants based on their inhibitory activity against fertilization. The fertilization of both jellied and denuded eggs was effectively inhibited by pretreatment of sperm with intact anti-SGP antibody as well as its Fab fragment, indicating that the antibody recognizes a molecule on the sperm's surface that is necessary for fertilization. On Western blots, the anti-SGP antibody recognized large molecules, with molecular masses of 65-150 kDa and minor smaller molecules with masses of 20-28 kDa in the sperm membrane vesicles. SGP was distributed over nearly the entire surface of the sperm, probably as an integral membrane protein in close association with microfilaments. More membrane vesicles containing SGP bound to the surface were found in the animal hemisphere compared with the vegetal hemisphere in unfertilized eggs, but the vesicle-binding was not observed in fertilized eggs. These results indicate that SGP mediates sperm-egg membrane binding and is responsible for the establishment of fertilization in Xenopus.
BOREAS TE-9 NSA Leaf Chlorophyll Density
Hall, Forrest G. (Editor); Curd, Shelaine (Editor); Margolis, Hank; Sy, Mikailou
2000-01-01
The BOREAS TE-9 team collected several data sets related to chemical and photosynthetic properties of leaves in boreal forest tree species. These data were collected to help provide an explanation of potential seasonal and spatial changes of leaf pigment properties in boreal forest species at the NSA. At different dates (FFC-Winter, FFC-Thaw, IFC-1, IFC-2, and IMC-3), foliage samples were collected from the upper third of the canopy for five NSA sites (YJP, OJP, OBS, UBS, and OA) near Thompson, Manitoba. Subsamples of 100 needles for black spruce, 20 needles for jack pine, and single leaf for trembling aspen were cut into pieces and immersed in a 20-mL DMF aliquot in a Nalgene test tube. The extracted foliage materials were then oven-dried at 68 C for 48 hours and weighed. Extracted leaf dry weight was converted to a total leaf area basis to express the chlorophyll content in mg/sq cm of total leaf area. The data are provided in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
NSA2, a novel nucleolus protein regulates cell proliferation and cell cycle
International Nuclear Information System (INIS)
Zhang, Heyu; Ma, Xi; Shi, Taiping; Song, Quansheng; Zhao, Hongshan; Ma, Dalong
2010-01-01
NSA2 (Nop seven-associated 2) was previously identified in a high throughput screen of novel human genes associated with cell proliferation, and the NSA2 protein is evolutionarily conserved across different species. In this study, we revealed that NSA2 is broadly expressed in human tissues and cultured cell lines, and located in the nucleolus of the cell. Both of the putative nuclear localization signals (NLSs) of NSA2, also overlapped with nucleolar localization signals (NoLSs), are capable of directing nucleolar accumulation. Moreover, over-expression of the NSA2 protein promoted cell growth in different cell lines and regulated the G1/S transition in the cell cycle. SiRNA silencing of the NSA2 transcript attenuated the cell growth and dramatically blocked the cell cycle in G1/S transition. Our results demonstrated that NSA2 is a nucleolar protein involved in cell proliferation and cell cycle regulation.
BOREAS TF-3 NSA-OBS Tower Flux, Meteorological, and Soil Temperature Data
Wofsy, Steven; Sutton, Doug; Goulden, Mike; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor)
2000-01-01
The BOReal Ecosystem-Atmosphere Study Tower Flux (BOREAS TF-3) team collected tower flux, surface meteorological, and soil temperature data at the BOREAS Northern Study Area-Old Black Spruce (NSA-OBS) site continuously from the March 1994 through October 1996. The data are available in tabular ASCII files.
46 CFR Sec. 5 - Responsibility for duplicating copies of NSA-WORKSMALREP Contract.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Responsibility for duplicating copies of NSA-WORKSMALREP Contract. Sec. 5 Section 5 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION A-NATIONAL... INDIVIDUAL CONTRACT FOR MINOR REPAIRS-NSA-WORKSMALREP Sec. 5 Responsibility for duplicating copies of NSA...
46 CFR Sec. 3 - When the NSA-WORKSMALREP Contract may be used.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false When the NSA-WORKSMALREP Contract may be used. Sec. 3 Section 3 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION A-NATIONAL SHIPPING AUTHORITY... REPAIRS-NSA-WORKSMALREP Sec. 3 When the NSA-WORKSMALREP Contract may be used. This contract may be used...
Energy Technology Data Exchange (ETDEWEB)
Wang, Zhien
2010-06-29
The project is mainly focused on the characterization of cloud macrophysical and microphysical properties, especially for mixed-phased clouds and middle level ice clouds by combining radar, lidar, and radiometer measurements available from the ACRF sites. First, an advanced mixed-phase cloud retrieval algorithm will be developed to cover all mixed-phase clouds observed at the ACRF NSA site. The algorithm will be applied to the ACRF NSA observations to generate a long-term arctic mixed-phase cloud product for model validations and arctic mixed-phase cloud processes studies. To improve the representation of arctic mixed-phase clouds in GCMs, an advanced understanding of mixed-phase cloud processes is needed. By combining retrieved mixed-phase cloud microphysical properties with in situ data and large-scale meteorological data, the project aim to better understand the generations of ice crystals in supercooled water clouds, the maintenance mechanisms of the arctic mixed-phase clouds, and their connections with large-scale dynamics. The project will try to develop a new retrieval algorithm to study more complex mixed-phase clouds observed at the ACRF SGP site. Compared with optically thin ice clouds, optically thick middle level ice clouds are less studied because of limited available tools. The project will develop a new two wavelength radar technique for optically thick ice cloud study at SGP site by combining the MMCR with the W-band radar measurements. With this new algorithm, the SGP site will have a better capability to study all ice clouds. Another area of the proposal is to generate long-term cloud type classification product for the multiple ACRF sites. The cloud type classification product will not only facilitates the generation of the integrated cloud product by applying different retrieval algorithms to different types of clouds operationally, but will also support other research to better understand cloud properties and to validate model simulations. The
NSA Profs. Barma and Piombo Publish Jointly in International Peacekeeping
2016-01-01
National Security Affairs (NSA) News Two NSA faculty, Profs. Naazneen Barma and Jessica Piombo have authored an article with Naomi Levy of Santa Clara University, titled “Disentangling Aid Dynamics in Statebuilding and Peacebuildin: A Causal Framework.”
[Problems of cardiovascular toxicity of coxibs and non-selective NSA].
Forejtová, S
2006-01-01
Non-steroidal antirheumatics (NSA) belong to the most often prescribed drugs. Certain observation studies indicate that they are used by 20 to 30% of population of developed countries. The most common NSA's adverse effects are gastrointestinal complications. Coxibs have been developed as an alternative to conventional non-selective NSA; with similar efficacy, they should reduce the risk of development of gastrointestinal complications. In the few last years, possible toxicity of coxibs and other non-steroidal antirheumatics has been widely discussed. The VIGOR study, which was performed 6 years ago, showed five times higher incidence of nonfatal myocardial infarction in patients with rofecoxib therapy as compared with naproxen. Afterwards, there was much debate about rofecoxib, and coxibs in general, whose cardiotoxicity was supported and confuted at the same time. Possible cardioprotective effect of naproxen was discussed too. Later on, results of the APPROVE study (Adenoma Polyp Prevention on Vioxx) made Merck & Co., Inc. withdraw rofecoxib from all markets voluntarily. In the end of 2004, three controversial studies on celecoxib were published. Although the first study (Adenoma Prevention with Celecoxib study, APC) showed higher cardiovascular risk of celecoxib, the second study (Prevention of Adenomatosus Polyps, PreSAP) did not verify these results. Surprisingly, the third study (Alzheimer Disease and Prevention Trial, ADAPT) proved 50% increase of the risk of cardiovascular (CV) toxicity of naproxen. In the last year, researchers have tried to decide whether CV toxicity is a class effect of coxib group or a class effect of all NSA. Many observation studies proved higher CV risk both of coxibs (particularly rofecoxib) and non-selective NSA including naproxen. These new findings moved the American FDA (Food and Drug Administration) to publish guidance concerning higher CV risk of all coxibs and NSA. For the time being, the EMEA (European Agency for Evaluation
BOREAS TE-9 NSA Canopy Biochemistry
Hall, Forrest G. (Editor); Curd, Shelaine (Editor); Margolis, Hank; Charest, Martin; Sy, Mikailou
2000-01-01
The BOREAS TE-9 team collected several data sets related to chemical and photosynthetic properties of leaves. This data set contains canopy biochemistry data collected in 1994 in the NSA at the YJP, OJR, OBS, UBS, and OA sites, including biochemistry lignin, nitrogen, cellulose, starch, and fiber concentrations. These data were collected to study the spatial and temporal changes in the canopy biochemistry of boreal forest cover types and how a high-resolution radiative transfer model in the mid-infrared could be applied in an effort to obtain better estimates of canopy biochemical properties using remote sensing. The data are available in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
Evaluating Global Aerosol Models and Aerosol and Water Vapor Properties Near Clouds
Energy Technology Data Exchange (ETDEWEB)
Richard A. Ferrare; David D. Turner
2011-09-01
Project goals: (1) Use the routine surface and airborne measurements at the ARM SGP site, and the routine surface measurements at the NSA site, to continue our evaluations of model aerosol simulations; (2) Determine the degree to which the Raman lidar measurements of water vapor and aerosol scattering and extinction can be used to remotely characterize the aerosol humidification factor; (3) Use the high temporal resolution CARL data to examine how aerosol properties vary near clouds; and (4) Use the high temporal resolution CARL and Atmospheric Emitted Radiance Interferometer (AERI) data to quantify entrainment in optically thin continental cumulus clouds.
46 CFR Sec. 4 - Persons authorized to make awards under the NSA-WORKSMALREP Contract.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Persons authorized to make awards under the NSA-WORKSMALREP Contract. Sec. 4 Section 4 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION A... INDIVIDUAL CONTRACT FOR MINOR REPAIRS-NSA-WORKSMALREP Sec. 4 Persons authorized to make awards under the NSA...
47 CFR 90.1420 - Failure to comply with the NSA or the Commission's rules.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Failure to comply with the NSA or the... § 90.1420 Failure to comply with the NSA or the Commission's rules. (a) Failure to comply with the Commission's rules or the terms of the NSA may warrant cancelling the Public Safety Broadband License. The...
47 CFR 27.1320 - Failure to comply with the NSA or the Commission's rules.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Failure to comply with the NSA or the... § 27.1320 Failure to comply with the NSA or the Commission's rules. (a) Failure to comply with the Commission's rules or the terms of the NSA may warrant cancelling the Upper 700 MHz D Block license and...
Xi, Baike; Dong, Xiquan; Minnis, P.; Khaiyer, M.
2010-01-01
Analysis of a decade of ARM radar-lidar and GOES observations at the SGP site reveal that 0.5 and 4-hr averages of the surface cloud fraction correspond closely to 0.5deg and 2.5deg averages of GOES cloudiness, respectively. The long-term averaged surface and GOES cloud fractions agree to within 0.5%. Cloud frequency increases and cloud amount decreases as the temporal and spatial averaging scales increase. Clouds occurred most often during winter and spring. Single-layered clouds account for 61.5% of the total cloud frequency. There are distinct bimodal vertical distributions of clouds with a lower peak around 1 km and an upper one that varies from 7.5 to 10.8 km between winter and summer, respectively. The frequency of occurrence for nighttime GOES high-cloud tops agree well with the surface observations, but are underestimated during the day.
Overview of Boundary Layer Clouds Using Satellite and Ground-Based Measurements
Xi, B.; Dong, X.; Wu, P.; Qiu, S.
2017-12-01
A comprehensive summary of boundary layer clouds properties based on our few recently studies will be presented. The analyses include the global cloud fractions and cloud macro/micro- physical properties based on satellite measurements using both CERES-MODIS and CloudSat/Caliposo data products,; the annual/seasonal/diurnal variations of stratocumulus clouds over different climate regions (mid-latitude land, mid-latitude ocean, and Arctic region) using DOE ARM ground-based measurements over Southern great plain (SGP), Azores (GRW), and North slope of Alaska (NSA) sites; the impact of environmental conditions to the formation and dissipation process of marine boundary layer clouds over Azores site; characterizing Arctice mixed-phase cloud structure and favorable environmental conditions for the formation/maintainess of mixed-phase clouds over NSA site. Though the presentation has widely spread topics, we will focus on the representation of the ground-based measurements over different climate regions; evaluation of satellite retrieved cloud properties using these ground-based measurements, and understanding the uncertainties of both satellite and ground-based retrievals and measurements.
2011-03-31
... POSTAL SERVICE 39 CFR Part 111 Market Dominant Negotiated Service Agreement (NSA) for First- Class....1, to establish a new Negotiated Service Agreement (NSA) Market Dominant product for First-Class... Gifford at 202-268-8082. SUPPLEMENTARY INFORMATION: This new NSA for First-Class Mail and Standard Mail is...
Spanish validation of the Negative Symptom Assessment-16 (NSA-16) in patients with schizophrenia.
Garcia-Alvarez, Leticia; Garcia-Portilla, María Paz; Saiz, Pilar Alejandra; Fonseca-Pedrero, Eduardo; Bobes-Bascaran, María Teresa; Gomar, Jesús; Muñiz, José; Bobes, Julio
2018-04-05
Negative symptoms are prevalent in schizophrenia and associated with a poorer outcome. Validated newer psychometric instruments could contribute to better assessment and improved treatment of negative symptoms. The Negative Symptom Assessment-16 (NSA-16) has been shown to have strong psychometric properties, but there is a need for validation in non-English languages. This study aimed to examine the psychometric properties of a Spanish version of the NSA-16 (Sp-NSA-16). Observational, cross-sectional validation study in a sample of 123 outpatients with schizophrenia. NSA-16, PANSS, HDRS, CGI-SCH and PSP. The results indicate appropriate psychometric properties, high internal consistency (Cronbach's alpha=0.86), convergent validity (PANSS negative scale, PANSS Marder Negative Factor and CGI-negative symptoms r values between 0.81 and 0.94) and divergent validity (PANSS positive scale and the HDRS r values between 0.10 and 0.34). In addition, the NSA-16 also exhibited discriminant validity (ROC curve=0.97, 95% CI=0.94 to 1.00; 94.3% sensitivity and 83.3% specificity). The Sp-NSA-16 is reliable and valid for measuring negative symptoms in patients with schizophrenia. This provides Spanish clinicians with a new tool for clinical practice and research. However, it is necessary to provide further information about its inter-rater reliability. Copyright © 2018 SEP y SEPB. Publicado por Elsevier España, S.L.U. All rights reserved.
Superconducting Technology Assessment (NSA, Office of Corporate Assessments)
Networking and Information Technology Research and Development, Executive Office of the President — The government, and particularly NSA, has a continuing need for ever-increasing computational power. The Agency is concerned about projected limitations of...
Southern Great Plains Atmospheric Radiation Measurement Site
Federal Laboratory Consortium — The Southern Great Plains Atmospheric Radiation Measurement Site (SGP-ARM) is the oldest and largest of DOE's Arm sites. It was established in 1992. It consists of...
Alphs, Larry; Morlock, Robert; Coon, Cheryl; Cazorla, Pilar; Szegedi, Armin; Panagides, John
2011-06-01
The 16-item Negative Symptom Assessment (NSA-16) scale is a validated tool for evaluating negative symptoms of schizophrenia. The psychometric properties and predictive power of a four-item version (NSA-4) were compared with the NSA-16. Baseline data from 561 patients with predominant negative symptoms of schizophrenia who participated in two identically designed clinical trials were evaluated. Ordered logistic regression analysis of ratings using NSA-4 and NSA-16 were compared with ratings using several other standard tools to determine predictive validity and construct validity. Internal consistency and test--retest reliability were also analyzed. NSA-16 and NSA-4 scores were both predictive of scores on the NSA global rating (odds ratio = 0.83-0.86) and the Clinical Global Impressions--Severity scale (odds ratio = 0.91-0.93). NSA-16 and NSA-4 showed high correlation with each other (Pearson r = 0.85), similar high correlation with other measures of negative symptoms (demonstrating convergent validity), and lesser correlations with measures of other forms of psychopathology (demonstrating divergent validity). NSA-16 and NSA-4 both showed acceptable internal consistency (Cronbach α, 0.85 and 0.64, respectively) and test--retest reliability (intraclass correlation coefficient, 0.87 and 0.82). This study demonstrates that NSA-4 offers accuracy comparable to the NSA-16 in rating negative symptoms in patients with schizophrenia. Copyright © 2011 John Wiley & Sons, Ltd.
Protective effect of NSA on intestinal epithelial cells in a necroptosis model.
Dong, Wei; Zhang, Min; Zhu, Yaxi; Chen, Yuanhan; Zhao, Xingchen; Li, Ruizhao; Zhang, Li; Ye, Zhiming; Liang, Xingling
2017-10-17
This study aimed to investigate the protective effect of the necroptosis inhibitor necrosulfonamide (NSA) on intestinal epithelial cells using a novel in vitro necroptosis model that mimics inflammatory bowel disease (IBD). 2,4,6-trinitrobenzenesulfonic acid (TNBS) was perfused into the rectum of BALB/c mice to established a colitis model. Pathologic injury and cell death were evaluated. A novel in vitro model of necroptosis was established in Caco-2 cells using TNF- α and Z-VAD-fmk, and the cells were treated with or without NSA. Morphologic changes, manner of cell death and the levels of phosphorylation of receptor-interacting protein kinase 3 (p-RIPK3) and mixed-lineage kinase domain-like (p-MLKL) were detected. In the TNBS-induced colitis in mice, TUNEL-positive and caspase-3-negative cells were observed in the intestinal mucosa, and p-RIPK3 was found to be elevated. Under the stimulation of TNF- α and Z-VAD-fmk, the morphologic damage in the Caco-2 cells was aggravated, the proportion of necrosis was increased, and the level of p-RIPK3 and p-MLKL were increased, confirming that the regulated cell death was necroptosis. NSA reversed the morphological abnormalities and reduced necrotic cell death induced by TNF- α and Z-VAD-fmk. NSA can inhibit necroptosis in intestinal epithelial cells in vitro and might confer a potential protective effect against IBD.
Lidar Cloud Detection with Fully Convolutional Networks
Cromwell, E.; Flynn, D.
2017-12-01
The vertical distribution of clouds from active remote sensing instrumentation is a widely used data product from global atmospheric measuring sites. The presence of clouds can be expressed as a binary cloud mask and is a primary input for climate modeling efforts and cloud formation studies. Current cloud detection algorithms producing these masks do not accurately identify the cloud boundaries and tend to oversample or over-represent the cloud. This translates as uncertainty for assessing the radiative impact of clouds and tracking changes in cloud climatologies. The Atmospheric Radiation Measurement (ARM) program has over 20 years of micro-pulse lidar (MPL) and High Spectral Resolution Lidar (HSRL) instrument data and companion automated cloud mask product at the mid-latitude Southern Great Plains (SGP) and the polar North Slope of Alaska (NSA) atmospheric observatory. Using this data, we train a fully convolutional network (FCN) with semi-supervised learning to segment lidar imagery into geometric time-height cloud locations for the SGP site and MPL instrument. We then use transfer learning to train a FCN for (1) the MPL instrument at the NSA site and (2) for the HSRL. In our semi-supervised approach, we pre-train the classification layers of the FCN with weakly labeled lidar data. Then, we facilitate end-to-end unsupervised pre-training and transition to fully supervised learning with ground truth labeled data. Our goal is to improve the cloud mask accuracy and precision for the MPL instrument to 95% and 80%, respectively, compared to the current cloud mask algorithms of 89% and 50%. For the transfer learning based FCN for the HSRL instrument, our goal is to achieve a cloud mask accuracy of 90% and a precision of 80%.
BOREAS TGB-5 CO2, CH4 and CO Chamber Flux Data Over the NSA
Burke, Roger; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor); Zepp, Richard
2000-01-01
The BOReal Ecosystem-Atmosphere Study Trace Gas Biogeochemistry (BOREAS TGB-5) team collected a variety of trace gas concentration and flux measurements at several NSA sites. This data set contains carbon dioxide (CO2), methane (CH4), and carbon monoxide (CO) chamber flux measurements conducted in 1994 at upland forest sites that experienced stand-replacement fires. These measurements were acquired to understand the impact of fires on soil biogeochemistry and related changes in trace gas exchange in boreal forest soils. Relevant ancillary data, including data concerning the soil temperature, solar irradiance, and information from nearby un-burned control sites, are included to provide a basis for modeling the regional impacts of fire and climate changes on trace gas biogeochemistry. The data are provided in tabular ASCII files.
Aerosol measurements at the Southern Great Plains Site: Design and surface installation
Energy Technology Data Exchange (ETDEWEB)
Leifer, R.; Knuth, R.H.; Guggenheim, S.F.; Albert, B. [Department of Energy, New York, NY (United States)
1996-04-01
To impropve the predictive capabilities of the Atmospheric Radiation Measurements (ARM) program radiation models, measurements of awserosol size distributions, condensation particle concentrations, aerosol scattering coefficients at a number of wavelenghts, and the aerosol absorption coefficients are needed at the Southern Great Plains (SGP) site. Alos, continuous measurements of ozone concnetrations are needed for model validation. The environmental Measuremenr Laboratory (EMK) has the responsibility to establish the surface aerosol measurements program at the SGP site. EML has designed a special sampling manifold.
Dalbayrak, Sedat; Yaman, Onur; Yılmaz, Mesut
2013-07-01
Treatment of Hangman's fractures is still controversial. Hangman's fractures Type II and IIA are usually treated with surgical procedures. This study aims at describing the Neurospinal Academy (NSA) technique as an attempt to achieve an approximation of the fracture line to the axis body, which may be used for Type II and IIA patients with severe displacement and angulation. NSA technique both pars or pedicle screws are placed bicortically to ensure that anterior surface of C2 vertebral body will be crossed 1-2 mm. A rod is prepared in suitable length and curve to connect the two screws. For placing the rod, sufficient amount of bone is resected from the C2 spinous process. C2 vertebral body is pulled back by means of the screws that crossed the anterior surface of C2 vertebral body. Hangman II and IIA patient are treated with NSA technique. Angulated and tilted C2 vertebral body was pulled back and approximated to posterior elements. In Hangman's fractures Type II and IIA with severe vertebral body and pedicle displacement, NSA technique is an effective and reliable treatment alternative for the approximation of posterior elements to the C2 vertebral body, which is tilted, angulated, and dislocated.
RFI Mitigation and Testing Employed at GGAO for NASA's Space Geodesy Project (SGP)
Hilliard, L. M.; Rajagopalan, Ganesh; Turner, Charles; Stevenson, Thomas; Bulcha, Berhanu
2017-01-01
Radio Frequency Interference (RFI) Mitigation at Goddard Geophysical and Astronomical Observatory (GGAO) has been addressed in three different ways by NASA's Space Geodesy Project (SGP); masks, blockers, and filters. All of these techniques will be employed at the GGAO, to mitigate the RFI consequences to the Very Long Baseline Interferometer.
Wir sind sowas von geliefert: William Binney, ex-NSA, erklärt Snowden Leaks
Schmetz, Martin
2014-01-01
Die Snowden-Leaks an sich, insbesondere die von ihm an die Öffentlichkeit geleakten Powerpoint-Folien, haben es bereits in sich. Leicht zu verstehen sind sie aber nicht immer, es gibt schlicht zu viele Codenamen. Um so interessanter ist daher diese Mitschrift eines Vortrags von William Binney, einem ehemaligen technischen Direktor bei der NSA, der nach 37 Jahren Dienst ausschied und Whistleblower wurde. In diesem Vortrag erklärt Binney, was es mit der Überwachungsinfrastruktur der NSA auf sic...
BOREAS TE-9 PAR and Leaf Nitrogen Data for NSA Species
Hall, Forrest G. (Editor); Curd, Shelaine (Editor); Dang, Qinglai; Margolis, Hank; Coyea, Marie
2000-01-01
The Boreal Ecosystem-Atmospheric Study (BOREAS) TE-9 (Terrestrial Ecology) team collected several data sets related to chemical and photosynthetic properties of leaves in boreal forest tree species. This data set describes the relationship between photosynthetically active radiation (PAR) levels and foliage nitrogen in samples from six sites in the BOREAS Northern Study Area (NSA) collected during the three 1994 intensive field campaigns (IFCs). This information is useful for modeling the vertical distribution of carbon fixation for these different forest types in the boreal forest. The data were collected to quantify the relationship between PAR and leaf nitrogen of black spruce, jack pine, and aspen. The data are available in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
BOREAS Forest Cover Data Layers of the NSA in Raster Format
Hall, Forrest G. (Editor); Knapp, David; Tuinhoff, Manning
2000-01-01
This data set was processed by BORIS staff from the original vector data of species, crown closure, cutting class, and site classification/subtype into raster files. The original polygon data were received from Linnet Graphics, the distributor of data for MNR. In the case of the species layer, the percentages of species composition were removed. This reduced the amount of information contained in the species layer of the gridded product, but it was necessary in order to make the gridded product easier to use. The original maps were produced from 1:15,840-scale aerial photography collected in 1988 over an area of the BOREAS NSA MSA. The data are stored in binary, image format files and they are available from Oak Ridge National Laboratory. The data files are available on a CD-ROM (see document number 20010000884).
A new technique in the surgical treatment of Hangman′s fractures: Neurospinal Academy (NSA technique
Directory of Open Access Journals (Sweden)
Sedat Dalbayrak
2013-01-01
Full Text Available Context: Treatment of Hangman′s fractures is still controversial. Hangman′s fractures Type II and IIA are usually treated with surgical procedures. Aim: This study aims at describing the Neurospinal Academy (NSA technique as an attempt to achieve an approximation of the fracture line to the axis body, which may be used for Type II and IIA patients with severe displacement and angulation. Settings and Design: NSA technique both pars or pedicle screws are placed bicortically to ensure that anterior surface of C2 vertebral body will be crossed 1-2 mm. A rod is prepared in suitable length and curve to connect the two screws. For placing the rod, sufficient amount of bone is resected from the C2 spinous process. C2 vertebral body is pulled back by means of the screws that crossed the anterior surface of C2 vertebral body. Materials and Methods: Hangman II and IIA patient are treated with NSA technique. Result: Angulated and tilted C2 vertebral body was pulled back and approximated to posterior elements. Conclusions: In Hangman′s fractures Type II and IIA with severe vertebral body and pedicle displacement, NSA technique is an effective and reliable treatment alternative for the approximation of posterior elements to the C2 vertebral body, which is tilted, angulated, and dislocated.
Privacy in het post NSA-tijdperk: tijd voor een fundamentele herziening?
van der Sloot, B.
2014-01-01
De recente NSA-affaire heeft een brede technologische ontwikkeling blootgelegd waarin zeer grote hoeveelheden persoonsgegevens worden verzameld, opgeslagen en verwerkt, zonder dat dit een vooraf en helder bepaald doel heeft. Alhoewel dit evidente privacyproblemen met zich meebrengt, lijken de meeste
Goodell, Roger; Batjer, H Hunt; Ellenbogen, Richard G
2014-10-01
Roger Goodell was invited by the Neurosurgical Society of America (NSA) to give the keynote speech as the NSA Medalist 2013. As President of the NSA, and Co-Chairs of the National Football league's Head Neck and Spine Committee, we provided the introduction for Goodell. He was cited for his tireless advocacy on behalf of professional and student athletes. We noted that the National Football League has been a world leader in funding traumatic brain injury research and a catalyst for safety in youth and professional sports. Mr Goodell's national leadership in thinking and acting boldly on the subject of traumatic brain injury prevention and treatment was the primary motivation for awarding him the NSA medal. What follows is a transcript of his NSA Medal Lecture to the Neurosurgical Society of America.
Cryptographic Research and NSA: Report of the Public Cryptography Study Group.
Davida, George I.
1981-01-01
The Public Cryptography Study Group accepted the claim made by the National Security Agency that some information in some publications concerning cryptology could be inimical to national security, and is allowing the establishment of a voluntary mechanism, on an experimental basis, for NSA to review cryptology manuscripts. (MLW)
Privacy in the Post-NSA Era: Time for a Fundamental Revision?
van der Sloot, B.
2014-01-01
Big Brother Watch and others have filed a complaint against the United Kingdom under the European Convention on Human Rights about a violation of Article 8, the right to privacy. It regards the NSA affair and UK-based surveillance activities operated by secret services. The question is whether it
Leaky Apps and Data Shots: Leakage and Insertion in NSA-surveillance
van der Velden, L.
2015-01-01
The NSA disclosures have put the issue of surveillance at center stage, and with that, a range of technologies by which data are captured. This article aims to break up devices for data collection by discussing devices that leak data versus devices that are inserted into computers or networks in
BOREAS TGB-4 NSA-BVP Tower Flux and Meteorological Data
Roulet, Nigel T.; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Conrad, Sara K. (Editor)
2000-01-01
The BOReal Ecosystem-Atmosphere Study Trace Gas Biogeochemistry (BOREAS TGB-4) team measured the exchange of heat, water, and CO2 between a boreal forest beaver pond and the atmosphere in the Northern Study Area (NSA) for the ice-free period of BOREAS. The data cover the period of 28-May to 18-Sep-1994. The data are available in tabular ASCII files.
Site scientific mission plan for the southern great plains CART site January-June 2000.; TOPICAL
International Nuclear Information System (INIS)
Peppler, R. A.; Sisterson, D. L.; Lamb, P.
2001-01-01
The Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site was designed to help satisfy the data needs of the Atmospheric Radiation Measurement (ARM) Program Science Team. This Site Scientific Mission Plan defines the scientific priorities for site activities during the six months beginning on January 1, 2000, and looks forward in less detail to subsequent six-month periods. The primary purpose of this document is to provide scientific guidance for the development of plans for site operations. It also provides information on current plans to the ARM functional teams (Management Team, Data and Science Integration Team[DSIT], Operations Team, and Instrument Team[IT]) and serves to disseminate the plans more generally within the ARM Program and among the members of the Science Team. This document includes a description of the operational status of the site and the primary site activities envisioned, together with information concerning approved and proposed intensive observation periods (IOPs). The primary users of this document are the site operator, the site program manager, the Site Scientist Team (SST), the Science Team through the ARM Program science director, the ARM Program Experiment Center, and the aforementioned ARM Program functional teams. This plan is a living document that is updated and reissued every six months as the observational facilities are developed, tested, and augmented and as priorities are adjusted in response to developments in scientific planning and understanding. With this issue, many aspects of earlier Site Scientific Mission Plan reports have been moved to ARM sites on the World Wide Web. This report and all previous reports are available on the SGP CART web site
Hwang, Hyun Sook; Kim, Dong Won; Kim, Soung Soo
2006-01-01
The human prothrombin kringle-2 protein inhibits angiogenesis and LLC (Lewis lung carcinoma) growth and metastasis in mice. Additionally, the NSA9 peptide (NSAVQLVEN) derived from human prothrombin kringle-2 has been reported to inhibit the proliferation of BCE (bovine capillary endothelial) cells and CAM (chorioallantoic membrane) angiogenesis. In the present study, we examined the structure–activity relationships of the NSA9 peptide in inhibiting the proliferation of endothelial cells lines...
The SGP – Faulty by Design or Made Faulty by Politicians? An Assessment Based on a Simulation Model
Directory of Open Access Journals (Sweden)
Horáková Šárka
2014-09-01
Full Text Available By joining the European Monetary Union (the “EMU”, member countries lost the ability to use monetary policy as a tool for macroeconomic regulation. The attention was then focused on regulation of fiscal policy and Stability and Growth Pact (the “SGP” was the instrument agreed upon. The states of the EMU have agreed to meet the 3% of GDP requirement for the maximum annual public budget deficit. Based on evolution of public debt in member countries, we can say that the SGP has failed as a tool for fiscal discipline. In this paper, we answer the question of whether the failure was due to the incorrect concept of the SGP or whether the development of the debt was affected more by arbitrary disrespect of the agreed rules. The two reasons mentioned above are interdependent. To separate them, we construct a dynamic model of EU countries’ public debt. By using real data, we simulate the potential values of public debt in a situation where the SGP rules have been respected in recent years. Comparing the results for the potential debt given by simulation of the model with the current real values, we are able to quantify the impact of non-compliance for each country. The initial results indicate that there are both EU states where non-compliance led to a negligible increase in public debt - up to 7% of GDP - and other states where this factor caused the growth of public debt by more than 30% of GDP.
Differential effects of MK-801 on cerebrocortical neuronal injury in C57BL/6J, NSA, and ICR mice.
Brosnan-Watters, G; Ogimi, T; Ford, D; Tatekawa, L; Gilliam, D; Bilsky, E J; Nash, D
2000-08-01
1. Antagonists of the N-methyl-D-aspartate (NMDA) glutamate (Glu) receptor, including [(+)-5-methyl-10,11-dihydro-5H-dibenzo[a,d]cyclohepten-5,10-imine maleate], dizocilpine maleate (MK-801), injure pyramidal neurons in the posterior cingulate/retrosplenial (PC/RS) cortex when administered systemically to adult rats and mice. 2. These results have, to our knowledge, only been reported previously in Harlan Sprague Dawley albino rats and International Cancer Research (ICR) mice, an outbred albino strain. 3. Male Non-Swiss Albino (NSA) mice, an albino outbred strain, and male C57BL/6J (B6) mice, a pigmented inbred strain, were injected systemically with 1 mg/kg of MK-801 in the first experiment. This dose of MK-801 reliably produces cytoplasmic vacuoles in neurons in layers III and IV of the PC/RS cortex in 100% of ICR mice treated 4. There was a significant difference in the number of vacuolated neurons in B6 and NSA mice, as assessed by ANOVA. The NSA were not significantly different than previously examined ICR mice, but the B6 had fewer vacuolated neurons than either of the two outbred strains. 5. In the second experiment, male NSA, ICR, and B6 mice were injected systemically with a high dose, 10 mg/kg, of MK-801. This dose has been demonstrated to result in necrosis in the same population of neurons injured by lower doses of MK-801. 6. An ANOVA indicated that there was a significant difference among the three strains of mice, and a Fisher's protected t revealed that the B6 mice were significantly different from both the NSA and ICR, but that, with our test, those two strains were indistinguishable. 7. Male ICR, NSA, and B6 mice were tested in the holeboard food search task 5 hours after 1 mg/kg of MK-801. There were significant differences between the strains in performance both pre and posttreatment. The effect of the drug was not statistically significant. 8. These results suggest that there may be a genetically mediated difference in the reaction to NMDA
Applications of Sunphotometry to Aerosol Extinction and Surface Anisotropy
Energy Technology Data Exchange (ETDEWEB)
Tsay, S.
2002-09-30
Support cost-sharing of a newly developed sunphotometer in field deployment for aerosol studies. This is a cost-sharing research to deploy a newly developed sun-sky-surface photometer for studying aerosol extinction and surface anisotropy at the ARM SGP, TWP, and NSA-AAO CART sites and in many field campaigns. Atmospheric aerosols affect the radiative energy balance of the Earth, both directly by perturbing the incoming/outgoing radiation fields and indirectly by influencing the properties/processes of clouds and reactive greenhouse gases. The surface bidirectional reflectance distribution function (BRDF) also plays a crucial role in the radiative energy balance, since the BRDF is required to determine (i) the spectral and spectrally-averaged surface albedo, and (ii) the top-of-the-atmosphere (TOA) angular distribution of radiance field. Therefore, the CART sites provide an excellent, albeit unique, opportunity to collect long-term climatic data in characterizing aerosol properties and various types of surface anisotropy.
Veldhuis, Hugo; Hall, Forrest G. (Editor); Knapp, David E. (Editor)
2000-01-01
This data set contains the major soil properties of soil samples collected in 1994 at the tower flux sites in the Northern Study Area (NSA). The soil samples were collected by Hugo Veldhuis and his staff from the University of Manitoba. The mineral soil samples were largely analyzed by Barry Goetz, under the supervision of Dr. Harold Rostad at the University of Saskatchewan. The organic soil samples were largely analyzed by Peter Haluschak, under the supervision of Hugo Veldhuis at the Centre for Land and Biological Resources Research in Winnipeg, Manitoba. During the course of field investigation and mapping, selected surface and subsurface soil samples were collected for laboratory analysis. These samples were used as benchmark references for specific soil attributes in general soil characterization. Detailed soil sampling, description, and laboratory analysis were performed on selected modal soils to provide examples of common soil physical and chemical characteristics in the study area. The soil properties that were determined include soil horizon; dry soil color; pH; bulk density; total, organic, and inorganic carbon; electric conductivity; cation exchange capacity; exchangeable sodium, potassium, calcium, magnesium, and hydrogen; water content at 0.01, 0.033, and 1.5 MPascals; nitrogen; phosphorus: particle size distribution; texture; pH of the mineral soil and of the organic soil; extractable acid; and sulfur. These data are stored in ASCII text files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
Wei, Wenhui; Li, Yunchang; Wang, Lijun; Liu, Shengyi; Yan, Xiaohong; Mei, Desheng; Li, Yinde; Xu, Yusong; Peng, Pengfei; Hu, Qiong
2010-04-01
An allo-cytoplasmic male sterile line, which was developed through somatic hybridization between Brassica napus and Sinapis arvensis (thus designated as Nsa CMS line), possesses high potential for hybrid production of rapeseed. In order to select for restorer lines, fertile plants derived from the same somatic hybridization combination were self-pollinated and testcrossed with the parental Nsa CMS line for six generations. A novel disomic alien addition line, B. napus-S. arvensis, has been successfully developed. GISH analysis showed that it contains one pair of chromosomes from S. arvensis and 19 pairs from B. napus, and retains stable and regular mitotic and meiotic processes. The addition line displays very strong restoration ability to Nsa CMS line, high resistance to Sclerotinia sclerotiorum and a low incidence of pod shattering. Because the addition line shares these very important agricultural characters, it is a valuable restorer to Nsa CMS line, and is named NR1 here (Nsa restorer no. 1).
Daniel, David G; Alphs, Larry; Cazorla, Pilar; Bartko, John J; Panagides, John
2011-07-01
The 16-item Negative Symptom Assessment scale (NSA-16) has been validated in English-speaking raters. We analyzed the level of agreement achieved among raters of different nationalities using the NSA-16 and the Positive and Negative Syndrome Scale (PANSS) negative subscale and Marder negative factor. Raters participating in two international trials were trained in the use of each instrument through lectures and feedback on their ratings of at least one videotaped interview of a schizophrenic patient. Overall and regional (North America, Western Europe, Eastern Europe, South/Central America, and Australia and South Africa combined) kappa values were calculated and mean total scores were compared (1-way analysis of variance) by region for each instrument. In addition, within-scales variance was calculated by item to help identify negative symptoms that were particularly challenging to obtain agreement on across cultures. In the combined group of international raters, the kappa values for ratings of the NSA-16, PANSS negative subscale, and Marder negative factors were 0.89, 0.84, and 0.82, respectively. Kappa values calculated by geographic region ranged from 0.87 to 0.94 for the NSA-16 compared with 0.82 to 0.86 for the PANSS negative subscale and 0.79 to 0.87 for the PANSS Marder negative factor. Despite cultural and linguistic differences among raters, standardizing measurement of negative symptoms in international clinical trials is possible using available rating scales: NSA-16, PANSS negative subscale, and Marder negative subscale. Agreement among raters was at least as high using the NSA-16 as using the PANSS instruments.
Single-Column Modeling, GCM Parameterizations and Atmospheric Radiation Measurement Data
International Nuclear Information System (INIS)
Somerville, R.C.J.; Iacobellis, S.F.
2005-01-01
Our overall goal is identical to that of the Atmospheric Radiation Measurement (ARM) Program: the development of new and improved parameterizations of cloud-radiation effects and related processes, using ARM data at all three ARM sites, and the implementation and testing of these parameterizations in global and regional models. To test recently developed prognostic parameterizations based on detailed cloud microphysics, we have first compared single-column model (SCM) output with ARM observations at the Southern Great Plains (SGP), North Slope of Alaska (NSA) and Topical Western Pacific (TWP) sites. We focus on the predicted cloud amounts and on a suite of radiative quantities strongly dependent on clouds, such as downwelling surface shortwave radiation. Our results demonstrate the superiority of parameterizations based on comprehensive treatments of cloud microphysics and cloud-radiative interactions. At the SGP and NSA sites, the SCM results simulate the ARM measurements well and are demonstrably more realistic than typical parameterizations found in conventional operational forecasting models. At the TWP site, the model performance depends strongly on details of the scheme, and the results of our diagnostic tests suggest ways to develop improved parameterizations better suited to simulating cloud-radiation interactions in the tropics generally. These advances have made it possible to take the next step and build on this progress, by incorporating our parameterization schemes in state-of-the-art 3D atmospheric models, and diagnosing and evaluating the results using independent data. Because the improved cloud-radiation results have been obtained largely via implementing detailed and physically comprehensive cloud microphysics, we anticipate that improved predictions of hydrologic cycle components, and hence of precipitation, may also be achievable. We are currently testing the performance of our ARM-based parameterizations in state-of-the--art global and regional
BOREAS TE-9 NSA Photosynthetic Response Data
Hall, Forrest G.; Curd, Shelaine (Editor); Dang, Qinglai; Margolis, Hank; Coyea, Marie
2000-01-01
The Boreal Ecosystem-Atmospheric Study (BOREAS) TE-9 (Terrestrial Ecology) team collected several data sets related to chemical and photosynthetic properties of leaves. This data set describes: (1) the response of leaf and shoot-level photosynthesis to ambient and intercellular CO2 concentration, temperature, and incident photosynthetically active radiation (PAR) for black spruce, jack pine, and aspen during the three intensive field campaigns (IFCs) in 1994 in the Northern Study Area (NSA); (2) the response of stomatal conductance to vapor pressure difference throughout the growing season of 1994; and (3) a range of shoot water potentials (controlled in the laboratory) for black spruce and jack pine. The data are stored in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
Eddy Correlation Flux Measurement System (ECOR) Handbook
Energy Technology Data Exchange (ETDEWEB)
Cook, DR
2011-01-31
The eddy correlation (ECOR) flux measurement system provides in situ, half-hour measurements of the surface turbulent fluxes of momentum, sensible heat, latent heat, and carbon dioxide (CO2) (and methane at one Southern Great Plains extended facility (SGP EF) and the North Slope of Alaska Central Facility (NSA CF). The fluxes are obtained with the eddy covariance technique, which involves correlation of the vertical wind component with the horizontal wind component, the air temperature, the water vapor density, and the CO2 concentration.
Logan, Timothy; Dong, Xiquan; Xi, Baike
2018-02-01
Aerosol particles are of particular importance because of their impacts on cloud development and precipitation processes over land and ocean. Aerosol properties as well as meteorological observations from the Department of Energy Atmospheric Radiation Measurement (ARM) platform situated in the Southern Great Plains (SGP) are utilized in this study to illustrate the dependence of continental cloud condensation nuclei (CCN) number concentration ( N CCN) on aerosol type and transport pathways. ARM-SGP observations from the 2011 Midlatitude Continental Convective Clouds Experiment field campaign are presented in this study and compared with our previous work during the 2009-10 Clouds, Aerosol, and Precipitation in the Marine Boundary Layer field campaign over the current ARM Eastern North Atlantic site. Northerly winds over the SGP reflect clean, continental conditions with aerosol scattering coefficient ( σ sp) values less than 20 Mm-1 and N CCN values less than 100 cm-3. However, southerly winds over the SGP are responsible for the observed moderate to high correlation ( R) among aerosol loading ( σ sp moisture via the Gulf of Mexico, indicating a strong dependence on air mass type. NASA MERRA-2 reanalysis aerosol and chemical data are moderately to highly correlated with surface ARM-SGP data, suggesting that this facility can represent surface aerosol conditions in the SGP, especially during strong aerosol loading events that transport via the Gulf of Mexico. Future long-term investigations will help to understand the seasonal influences of air masses on aerosol, CCN, and cloud properties over land in comparison to over ocean.
BOREAS RSS-15 SIR-C and Landsat TM Biomass and Landcover Maps of the NSA
Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Ranson, K. Jon
2000-01-01
As part of BOREAS, the RSS-15 team conducted an investigation using SIR-C, X-SAR, and Landsat TM data for estimating total above-ground dry biomass for the SSA and NSA modeling grids and component biomass for the SSA. Relationships of backscatter to total biomass and total biomass to foliage, branch, and bole biomass were used to estimate biomass density across the landscape. The procedure involved image classification with SAR and Landsat TM data and development of simple mapping techniques using combinations of SAR channels. For the SSA, the SIR-C data used were acquired on 06-Oct-1994, and the Landsat TM data used were acquired on 02-Sep-1995. The maps of the NSA were developed from SIR-C data acquired on 13-Apr-1994. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
Dubey, Swati; Sharma, Raj Kumar; Agarwal, Pragati; Singh, Jyoti; Sinha, Neeraj; Singh, R P
2017-03-01
Bacterial nanocellulose (BNC), being ultrapure and unique in its properties, is a booming and ageless precursor of several breakthrough technologies of materials sciences; however, its low yield and high cost has created a challenge for its usage at industrial level. Herein, we report a novel, high yielding bacterial cell factory Komagataeibacter europaeus SGP37, isolated from rotten grapes, for the production of high quality and value added BNC. The strain was kinetically analyzed to evaluate BNC production under different physiological conditions and had demonstrated the production of 9.98±0.24gL -1 BNC at the expense of 12.08±1.94gL -1 sugar following 2 weeks of cultivation, thus having the conversion yield of 0.82g BNC/g sugar which seems to be the maximum reported yield so far. The analysis of produced pellicle using FTIR, 13 C CP MAS NMR, FE-SEM, XRD and TGA had shown similar structural, morphological and chemical characteristics with that of bacterial nanocellulose. Thus, K. europaeus SGP37 appears to be a potential strain and may offer a promising platform for industrial scale production of nanocelluloses. Copyright © 2016 Elsevier B.V. All rights reserved.
Robotic tape library system level testing at NSA: Present and planned
Shields, Michael F.
1994-01-01
In the present of declining Defense budgets, increased pressure has been placed on the DOD to utilize Commercial Off the Shelf (COTS) solutions to incrementally solve a wide variety of our computer processing requirements. With the rapid growth in processing power, significant expansion of high performance networking, and the increased complexity of applications data sets, the requirement for high performance, large capacity, reliable and secure, and most of all affordable robotic tape storage libraries has greatly increased. Additionally, the migration to a heterogeneous, distributed computing environment has further complicated the problem. With today's open system compute servers approaching yesterday's supercomputer capabilities, the need for affordable, reliable secure Mass Storage Systems (MSS) has taken on an ever increasing importance to our processing center's ability to satisfy operational mission requirements. To that end, NSA has established an in-house capability to acquire, test, and evaluate COTS products. Its goal is to qualify a set of COTS MSS libraries, thereby achieving a modicum of standardization for robotic tape libraries which can satisfy our low, medium, and high performance file and volume serving requirements. In addition, NSA has established relations with other Government Agencies to complete this in-house effort and to maximize our research, testing, and evaluation work. While the preponderance of the effort is focused at the high end of the storage ladder, considerable effort will be extended this year and next at the server class or mid range storage systems.
BOREAS TGB-12 Soil Carbon and Flux Data of NSA-MSA in Raster Format
Hall, Forrest G. (Editor); Knapp, David E. (Editor); Rapalee, Gloria; Davidson, Eric; Harden, Jennifer W.; Trumbore, Susan E.; Veldhuis, Hugo
2000-01-01
The BOREAS TGB-12 team made measurements of soil carbon inventories, carbon concentration in soil gases, and rates of soil respiration at several sites. This data set provides: (1) estimates of soil carbon stocks by horizon based on soil survey data and analyses of data from individual soil profiles; (2) estimates of soil carbon fluxes based on stocks, fire history, drain-age, and soil carbon inputs and decomposition constants based on field work using radiocarbon analyses; (3) fire history data estimating age ranges of time since last fire; and (4) a raster image and an associated soils table file from which area-weighted maps of soil carbon and fluxes and fire history may be generated. This data set was created from raster files, soil polygon data files, and detailed lab analysis of soils data that were received from Dr. Hugo Veldhuis, who did the original mapping in the field during 1994. Also used were soils data from Susan Trumbore and Jennifer Harden (BOREAS TGB-12). The binary raster file covers a 733-km 2 area within the NSA-MSA.
Vector Topographic Map Data over the BOREAS NSA and SSA in SIF Format
Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)
2000-01-01
This data set contains vector contours and other features of individual topographic map sheets from the National Topographic Series (NTS). The map sheet files were received in Standard Interchange Format (SIF) and cover the BOReal Ecosystem-Atmosphere Study (BOREAS) Northern Study Area (NSA) and Southern Study Area (SSA) at scales of 1:50,000 and 1:250,000. The individual files are stored in compressed Unix tar archives.
Institute of Scientific and Technical Information of China (English)
Timothy LOGAN; Xiquan DONG; Baike XI
2018-01-01
Aerosol particles are of particular importance because of their impacts on cloud development and precipitation processes over land and ocean.Aerosol properties as well as meteorological observations from the Department of Energy Atmospheric Radiation Measurement (ARM) platform situated in the Southern Great Plains (SGP) are utilized in this study to illustrate the dependence of continental cloud condensation nuclei (CCN) number concentration (NCCN) on aerosol type and transport pathways.ARM-SGP observations from the 2011 Midlatitude Continental Convective Clouds Experiment field campaign are presented in this study and compared with our previous work during the 2009-10 Clouds,Aerosol,and Precipitation in the Marine Boundary Layer field campaign over the current ARM Eastern North Atlantic site.Northerly winds over the SGP reflect clean,continental conditions with aerosol scattering coefficient (σsp) values less than 20 Mm-1 and NCCN values less than 100 cm-3.However,southerly winds over the SGP are responsible for the observed moderate to high correlation (R)among aerosol loading (σsp > 60 Mm-1) and NCCN,carbonaceous chemical species (biomass burning smoke),and precipitable water vapor.This suggests a common transport mechanism for smoke aerosols and moisture via the Gulf of Mexico,indicating a strong dependence on air mass type.NASA MERRA-2 reanalysis aerosol and chemical data are moderately to highly correlated with surface ARM-SGP data,suggesting that this facility can represent surface aerosol conditions in the SGP,especially during strong aerosol loading events that transport via the Gulf of Mexico.Future long-term investigations will help to understand the seasonal influences of air masses on aerosol,CCN,and cloud properties over land in comparison to over ocean.
BOREAS RSS-7 Landsat TM LAI IMages of the SSA and NSA
Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Chen, Jing; Cihlar, Josef
2000-01-01
The BOReal Ecosystem-Atmosphere Study Remote Sensing Science (BOREAS RSS-7) team used Landsat Thematic Mapper (TM) images processed at CCRS to produce images of Leaf Area Index (LAI) for the BOREAS study areas. Two images acquired on 06-Jun and 09-Aug-1991 were used for the SSA, and one image acquired on 09-Jun-1994 was used for the NSA. The LAI images are based on ground measurements and Landsat TM Reduced Simple Ratio (RSR) images. The data are stored in binary image-format files.
BOREAS HYP-8 DEM Data Over The NSA-MSA and SSA-MSA in The AEAC Projection
Knapp, David E.; Hall, Forrest G. (Editor); Wang, Xue-Wen; Band, L. E.; Smith, David E. (Technical Monitor)
2000-01-01
These data were derived from the original Digital Elevation Models (DEMs) produced by the Boreal Ecosystem-Atmosphere Study (BOREAS) Hydrology (HYD)-8 team. The original DEMs were in the Universal Transverse Mercator (UTM) projection, while this product is projected in the Albers Equal-Area Conic (AEAC) projection. The pixel size of the data is 100 meters, which is appropriate for the 1:50,000-scale contours from which the DEMs were made. The original data were compiled from information available in the 1970s and 1980s. This data set covers the two Modeling Sub-Areas (MSAs) that are contained within the Southern Study Area (SSA) and the Northern Study Area (NSA). The data are stored in binary, image format files. The DEM data over the NSA-MSA and SSA-MSA in the AEAC projection are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).
BOREAS TE-9 NSA Photosynthetic Capacity and Foliage Nitrogen Data
Hall, Forrest G. (Editor); Curd, Shelaine (Editor); Dang, Qinglai; Margolis, Hank; Coyea, Marie
2000-01-01
The Boreal Ecosystem-Atmospheric Study (BOREAS) TE-9 (Terrestrial Ecology) team collected several data sets related to chemical and photosynthetic properties of leaves in boreal forest tree species. This data set describes the spatial and temporal relationship between foliage nitrogen concentration and photosynthetic capacity in the canopies of black spruce, jack pine, and aspen located within the Northern Study Area (NSA). The data were collected from June to September 1994 and are useful for modeling the vertical distribution of carbon fixation for different forest types in the boreal forest. The data are available in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
Site scientific mission plan for the Southern Great Plains CART site: July--December 1997
Energy Technology Data Exchange (ETDEWEB)
Peppler, R.A.; Lamb, P.J. [Univ. of Oklahoma, Norman, OK (United States). Cooperative Inst. for Mesoscale Meteorological Studies; Sisterson, D.L. [Argonne National Lab., IL (United States). Environmental Research Div.
1997-07-01
The Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site is designed to help satisfy the data needs of the Atmospheric Radiation Measurement (ARM) Program Science Team. This document defines the scientific priorities for site activities during the six months beginning on July 1, 1997, and looks forward in lesser detail to subsequent six-month periods. The primary purpose of this Site Scientific Mission Plan is to provide guidance for the development of plans for site operations. It also provides information on current plans to the ARM functional teams and serves to disseminate the plans more generally within the ARM Program and among the members of the Science Team. This document includes a description of the operational status of the site and the primary site activities envisioned, together with information concerning approved and proposed intensive observation periods (IOPs). This plan is a living document that is updated and reissued every six months as the observational facilities are developed, tested, and augmented and as priorities are adjusted in response to developments in scientific planning and understanding.
Energy Technology Data Exchange (ETDEWEB)
Bian, X.; Zhong, S.; Whiteman, C.D.; Stage, S.A. [Pacific Northwest National Lab., Richland, WA (United States)
1996-04-01
The Atmospheric Radiation Measurement (ARM) Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) is located in a region that is strongly affected by a prominent meteorological phenomenon--the Great Plains Low-Level Jet (LLJ). Observations have shown that the LLJ plays a vital role in spring and summertime cloud formation and precipitation over the Great Plains. An improved understanding of the LLJ characteristics and its impact on the environment is necessary for addressing the fundamental issue of development and testing of radiational transfer and cloud parameterization schemes for the general circulation models (GCMs) using data from the SGP CART site. A climatological analysis of the summertime LLJ over the SGP has been carried out using hourly observations from the National Oceanic and Atmospheric Administration (NOAA) Wind Profiler Demonstration Network and from the ARM June 1993 Intensive Observation Period (IOP). The hourly data provide an enhanced temporal and spatial resolution relative to earlier studies which used 6- and 12-hourly rawinsonde observations at fewer stations.
BOREAS TE-6 1994 Soil and Air Temperatures in the NSA
Hall, Forrest G. (Editor); Curd, Shelaine (Editor); Norman, John; Wilson, Tim
2000-01-01
The BOREAS TE-6 team collected several data sets to examine the influence of vegetation, climate, and their interactions on the major carbon fluxes for boreal forest species. This data set contains measurements of the air temperature at a single height and soil temperature at several depths in the NSA from 25-May to 08-Oct- 1994. Chromel-Constantan thermocouple wires run by a miniprogrammable data logger (Model 21X, Campbell Scientific, Inc., Logan, UT) provided direct measurements of temperature. The data are stored in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distrobuted Activity Archive Center (DAAC).
BOREAS AFM-08 ECMWF Hourly Surface and Upper Air Data for the SSA and NSA
Viterbo, Pedro; Betts, Alan; Hall, Forrest G. (Editor); Newcomer, Jeffrey A.; Smith, David E. (Technical Monitor)
2000-01-01
The Boreal Ecosystem-Atmosphere Study (BOREAS) Airborne Fluxes and Meteorology (AFM)-8 team focused on modeling efforts to improve the understanding of the diurnal evolution of the convective boundary layer over the boreal forest. This data set contains hourly data from the European Center for for Medium-Range Weather Forecasts (ECMWF) operational model from below the surface to the top of the atmosphere, including the model fluxes at the surface. Spatially, the data cover a pair of the points that enclose the rawinsonde sites at Candle Lake, Saskatchewan, in the Southern Study Area (SSA) and Thompson, Manitoba, in the Northern Study Area (NSA). Temporally, the data include the two time periods of 13 May 1994 to 30 Sept 1994 and 01 Mar 1996 to 31 Mar 1997. The data are stored in tabular ASCII files. The number of records in the upper air data files may exceed 20,000, causing a problem for some software packages. The ECMWF hourly surface and upper air data are available from the Earth Observing System Data and Information System (EOSDIS) Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC). The data files are available on a CD-ROM (see document number 20010000884).
Dong, Xiquan; Minnis, Patrick; Xi, Baike
2005-01-01
A record of single-layer and overcast low cloud (stratus) properties has been generated using approximately 4000 hours of data collected from January 1997 to December 2002 at the Atmospheric Radiation Measurement (ARM) Southern Great Plains Central Facility (SCF). The cloud properties include liquid-phase and liquid-dominant, mixed-phase, low cloud macrophysical, microphysical, and radiative properties including cloud-base and -top heights and temperatures, and cloud physical thickness derived from a ground-based radar and lidar pair, and rawinsonde sounding; cloud liquid water path (LWP) and content (LWC), and cloud-droplet effective radius (r(sub e)) and number concentration (N) derived from the macrophysical properties and radiometer data; and cloud optical depth (tau), effective solar transmission (gamma), and cloud/top-of-atmosphere albedos (R(sub cldy)/R(sub TOA)) derived from Eppley precision spectral pyranometer measurements. The cloud properties were analyzed in terms of their seasonal, monthly, and hourly variations. In general, more stratus clouds occur during winter and spring than in summer. Cloud-layer altitudes and physical thicknesses were higher and greater in summer than in winter with averaged physical thicknesses of 0.85 km and 0.73 km for day and night, respectively. The seasonal variations of LWP, LWC, N. tau, R(sub cldy), and R(sub TOA) basically follow the same pattern with maxima and minima during winter and summer, respectively. There is no significant variation in mean r(sub e), however, despite a summertime peak in aerosol loading, Although a considerable degree of variability exists, the 6-yr average values of LWP, LWC, r(sub e), N, tau, gamma, R(sub cldy) and R(sub TOA) are 150 gm(exp -2) (138), 0.245 gm(exp -3) (0.268), 8.7 micrometers (8.5), 213 cm(exp -3) (238), 26.8 (24.8), 0.331, 0.672, 0.563 for daytime (nighttime). A new conceptual model of midlatitude continental low clouds at the ARM SGP site has been developed from this study
Site scientific mission plan for the southern Great Plains CART site, January--June 1998
Energy Technology Data Exchange (ETDEWEB)
Peppler, R.A.; Lamb, P.J. [Univ. of Oklahoma, Norman, OK (United States). Cooperative Inst. for Mesoscale Meteorological Studies; Sisterson, D.L. [Argonne National Lab., IL (United States). Environmental Research Div.
1998-01-01
The Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site is designed to help satisfy the data needs of the Atmospheric Radiation Measurement (ARM) Program Science Team. The primary purpose of this site scientific mission plan is to provide guidance for the development of plans for site operations. It also provides information on current plans to the ARM functional teams (Management Team, Data and Science Integration Team, Operations Team, and Instrument Team) and serves to disseminate the plans more generally within the ARM Program and among the members of the Science Team. This document includes a description of the operational status of the site and the primary site activities envisioned, together with information concerning approved and proposed intensive observation periods (IOPs). The primary users of this document are the Site operator, the Site Scientist Team (SST), the Science Team through the ARM Program science director, the ARM Program Experiment Center, and the aforementioned ARM Program functional teams. This plan is a living document that is updated and reissued every six months as the observational facilities are developed, tested, and augmented and as priorities are adjusted in response to developments in scientific planning and understanding.
Directory of Open Access Journals (Sweden)
Majid Malekzadeh Shafaroudi
2016-09-01
Full Text Available Background: Diversity in Proximal Femur Geometric Parameters (PFGPs will be led to frequency changes in hip fractures. The purpose of the present study is to investigate of the relation between Bone Mineral Density (BMD in proximal femur with Neck Shaft Angle (NSA in both of osteoporotic and normal groups among old postmenopausal women in eastern part of Mazandaran province as a appropriate indicator to predict hip fractures occurance. Materials and Methods: Among 5103 postmenopausal women reffered to bone densitometry center, for 221 postmenopausal women who had inclusion criteria to this study, simultaneously by using densitometry system and completing a standard questionnaire, history of disease and demographic information including body mass index (BMI were recorded for each patient. Obtained information from densitometers was analyzed by the statistical software SPSS version 16 and Pearson correlation coefficient test was used. Results: Geometric parameters of 221 post-menopausal women aged 50 to 60 were analyzed. The mean of neck shaft angle (NSA were recorded for osteoporotic group 121.55 and for control group 121.44. Pearson correlation coefficient t-test results showed a negative significant correlation between mineral density in the femoral neck in osteoporotic group and NSA (P<0.05. Considering the effect of weight and BMI in strength and bone density in the femoral neck, the mean of BMI and weight in osteoporotic group was lower compared to control group. Conclusion: according to the findings of this study, NSA is effective in predicting of the proximal femur BMD in osteoporotic group.
BOREAS Elevation Contours over the NSA and SSA in ARC/INFO Generate Format
Knapp, David; Nickeson, Jaime; Hall, Forrest G. (Editor)
2000-01-01
This data set was prepared by BORIS Staff by reformatting the original data into the ARC/INFO Generate format. The original data were received in SIF at a scale of 1:50,000. BORIS staff could not find a format document or commercial software for reading SIF; the BOREAS HYD-08 team pro-vided some C source code that could read some of the SIF files. The data cover the BOREAS NSA and SSA. The original data were compiled from information available in the 1970s and 1980s. The data are available in ARC/INFO Generate format files.
Directory of Open Access Journals (Sweden)
Zmarak Khan
2006-12-01
Full Text Available On 16 December 2005, the New York Times reported that the President had authorized the National Security Agency (NSA to spy on Americans, inside the United States, without first obtaining a warrant from the secret FISA court. Although the President has described the NSA activities to be legal and critical to our national security, the programme has started a national controversy, raising questions over its legality and necessity. Consequently, there have been pending legal challenges, congressional investigations, and public outcry over the use of such expansive presidential authority. The legal community, including the American Bar Association, considers the programme illegal. The only district court that has addressed the issue has held it to be an unconstitutional programme that violates FISA. This comment highlights several reasons for why warrantless wiretapping is illegal and unnecessary. The comment also notes public policy reasons against presidential power that is not subject to any checks from Congress or review from the judiciary. Finally, it argues that the President needs to immediately cease the programme; asks Congress to take its oversight responsibility more seriously; and reasons that the judicial review protects against abuse.
BOREAS TE-18 Landsat TM Maximum Likelihood Classification Image of the NSA
Hall, Forrest G. (Editor); Knapp, David
2000-01-01
The BOREAS TE-18 team focused its efforts on using remotely sensed data to characterize the successional and disturbance dynamics of the boreal forest for use in carbon modeling. The objective of this classification is to provide the BOREAS investigators with a data product that characterizes the land cover of the NSA. A Landsat-5 TM image from 20-Aug-1988 was used to derive this classification. A standard supervised maximum likelihood classification approach was used to produce this classification. The data are provided in a binary image format file. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Activity Archive Center (DAAC).
Site scientific mission plan for the Southern Great Plains CART Site, January--June 1999
Energy Technology Data Exchange (ETDEWEB)
Peppler, R.A.; Sisterson, D.L.; Lamb, P.
1999-03-10
The Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site was designed to help satisfy the data needs of the Atmospheric Radiation Measurement (ARM) Program Science Team. This Site Scientific Mission Plan defines the scientific priorities for site activities during the six months beginning on January 1, 1999, and looks forward in lesser detail to subsequent six-month periods. The primary purpose of this document is to provide scientific guidance for the development of plans for site operations. It also provides information on current plans to the ARM functional teams (Management Team, Data and Science Integration Team [DSIT], Operations Team, and Instrument Team [IT]) and serves to disseminate the plans more generally within the ARM Program and among the members of the Science Team. This document includes a description of the operational status of the site and the primary site activities envisioned, together with information concerning approved and proposed intensive observation periods (IOPs). The primary users of this document are the site operator, the site program manager, the Site Scientist Team (SST), the Science Team through the ARM Program science director, the ARM Program Experiment Center, and the aforementioned ARM Program functional teams. This plan is a living document that is updated and reissued every six months as the observational facilities are developed, tested, and augmented and as priorities are adjusted in response to developments in scientific planning and understanding.
Site scientific mission plan for the Southern Great Plains CART site: July--December 1998
Energy Technology Data Exchange (ETDEWEB)
Peppler, R.A.; Lamb, P. [Univ. of Oklahoma, Norman, OK (United States). Cooperative Inst. for Mesoscale Meteorological Studies; Sisterson, D.L. [Argonne National Lab., IL (United States). Environmental Research Div.
1998-07-01
The Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site was designed to help satisfy the data needs of the Atmospheric Radiation Measurement (ARM) Program Science Team. This Site Scientific Mission Plan defines the scientific priorities for site activities during the six months beginning on July 1, 1998, and looks forward in lesser detail to subsequent six-month periods. The primary purpose of this document is to provide scientific guidance for the development of plans for site operations. It also provides information on current plans to the ARM functional teams (Management Team, Data and Science Integration Team [DSIT], Operations Team, and Instrument Team [IT]) and serves to disseminate the plans more generally within the ARM Program and among the members of the Science Team. This document includes a description of the operational status of the site and the primary site activities envisioned, together with information concerning approved and proposed intensive observation periods (IOPs). The primary users of this document are the site operator, the site program manager, the Site Scientist Team (SST), the Science Team through the ARM Program science director, the ARM program Experiment Center, and the aforementioned ARM Program functional teams. This plan is a living document that is updated and reissued every six months as the observational facilities are developed, tested, and augmented and as priorities are adjusted in response to developments in scientific planning and understanding.
Site scientific mission plan for the southern Great Plain CART site July-December 1997.
Energy Technology Data Exchange (ETDEWEB)
Lamb, P.J.; Peppler, R.A.; Sisterson, D.L.
1997-08-28
The Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site is designed to help satisfy the data needs of the Atmospheric Radiation Measurement (ARM) Program Science Team. This document defines the scientific priorities for site activities during the six months beginning on July 1, 1997, and looks forward in lesser detail to subsequent six-month periods. The primary purpose of this Site Scientific Mission Plan is to provide guidance for the development of plans for site operations. It also provides information on current plans to the ARM functional teams (Management Team, Data and Science Integration Team [DSIT], Operations Team, Instrument Team [IT], and Campaign Team) and serves to disseminate the plans more generally within the ARM Program and among the members of the Science Team. This document includes a description of the operational status of the site and the primary site activities envisioned, together with information concerning approved and proposed intensive observation periods (IOPs). The primary users of this document are the site operator, the Site Scientist Team (SST), the Science Team through the ARM Program science director, the ARM Program Experiment Center, and the aforementioned ARM Program functional teams. This plan is a living document that is updated and reissued every six months as the observational facilities are developed, tested, and augmented and as priorities are adjusted in response to developments in scientific planning and understanding.
Velligan, Dawn I; Alphs, Larry; Lancaster, Scott; Morlock, Robert; Mintz, Jim
2009-09-30
We examined whether changes in negative symptoms, as measured by scores on the 16-item Negative Symptom Assessment scale (NSA-16), were associated with changes in functional outcome. A group of 125 stable outpatients with schizophrenia were assessed at baseline and at 6 months using the NSA-16, the Brief Psychiatric Rating Scale, and multiple measures of functional outcome. Baseline adjusted regression coefficients indicated moderate correlations between negative symptoms and functional outcomes when baseline values of both variables were controlled. Results were nearly identical when we controlled for positive symptoms. Cross-lag panel correlations and Structural Equation Modeling were used to examine whether changes in negative symptoms drove changes in functional outcomes over time. Results indicated that negative symptoms drove the changes in the Social and Occupational Functioning Scale (SOFAS) rather than the reverse. Measures of Quality of Life and measures of negative symptoms may be assessing overlapping constructs or changes in both may be driven by a third variable. Negative symptoms were unrelated over time to scores on a performance-based measure of functional capacity. This study indicates that the relationship between negative symptom change and the change in functional outcomes is complex, and points to potential issues in selection of assessments.
BOREAS TE-18 Landsat TM Physical Classification Image of the NSA
Hall, Forrest G. (Editor); Knapp, David
2000-01-01
The BOREAS TE-18 team focused its efforts on using remotely sensed data to characterize the successional and disturbance dynamics of the boreal forest for use in carbon modeling. The objective of this classification is to provide the BOREAS investigators with a data product that characterizes the land cover of the NSA. A Landsat-5 TM image from 21-Jun-1995 was used to derive the classification. A technique was implemented that uses reflectances of various land cover types along with a geometric optical canopy model to produce spectral trajectories. These trajectories are used in a way that is similar to training data to classify the image into the different land cover classes. The data are provided in a binary, image file format. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
Site scientific mission plan for the Southern Great Plains CART site: January 1997--June 1997
Energy Technology Data Exchange (ETDEWEB)
Peppler, R.A.; Lamb, P.J. [Univ. of Oklahoma, Norman, OK (United States). Cooperative Institute for Mesoscale Meteorological Studies; Sisterson, D.L. [Argonne National Lab., IL (United States)
1997-01-01
The Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site is designed to help satisfy the data needs of the Atmospheric Radiation Measurement (ARM) Program Science Team. This document defines the scientific priorities for site activities during the six months beginning on January 1, 1997, and looks forward in lesser detail to subsequent six-month periods. The primary purpose of this Site Scientific Mission Plan is to provide guidance for the development of plans for site operations. It also provides information on current plans to the ARM functional teams (Management Team, Data and Science Integration Team [DSIT], Operations Team, Instrument Team [IT], and Campaign Team) and serves to disseminate the plans more generally within the ARM Program and among the members of the Science Team. This document includes a description of the operational status of the site and the primary site activities envisioned, together with information concerning approved and proposed intensive observation periods (IOPs). The primary users of this document are the site operator, the Site Scientist Team (SST), the Science Team through the ARM Program science director, the ARM Program Experiment Center, and the aforementioned ARM Program functional teams. This plan is a living document that is updated and reissued every six months as the observational facilities are developed, tested, and augmented and as priorities are adjusted in response to developments in scientific planning and understanding.
International Nuclear Information System (INIS)
Kitayama, K.; Ishiguro, K.; Takeuchi, M.; Tsuchi, H.; Kato, T.; Sakabe, Y.; Wakasugi, K.
2008-01-01
NUMO strategy for safety case development is constrained by a staged siting approach, which has been initiated by a call for volunteer municipalities to host the HLW repository. For each site, the safety case is an important factor to be considered at the selection steps which narrow down towards the preferred repository location. This is particularly challenging, however, as every site requires a tailored repository concept, with associated performance assessment and an individual site evaluation programme all of which evolve with gradually increasing understanding of the host environment. In order to maintain flexibility without losing focus, NUMO has developed a formalized tailoring procedure, termed the NUMO Structured Approach (NSA). The NSA guides the interaction of the key site characterisation, repository design and performance assessment groups and is facilitated by tools to help the decision making associated with the tailoring process (e.g. a requirements management system) and with comparison of siting and design options (e.g. multi-attribute analysis). Pragmatically, the post-closure safety case will initially emphasize near-field processes and a robust engineering barrier system, considering the limited geological information at early stages. This will be complemented by a more realistic assessment of total system performance, as needed to compare options. In addition, efforts to rigorously assess operational phase safety and the practicality of assuring quality of the constructed engineered barriers are components of the total safety case which are receiving particular attention now, as they may better discriminate between sites while information is still limited. (authors)
Construction site Voice Operated Information System (VOIS) test
Lawrence, Debbie J.; Hettchen, William
1991-01-01
The Voice Activated Information System (VAIS), developed by USACERL, allows inspectors to verbally log on-site inspection reports on a hand held tape recorder. The tape is later processed by the VAIS, which enters the information into the system's database and produces a written report. The Voice Operated Information System (VOIS), developed by USACERL and Automated Sciences Group, through a ESACERL cooperative research and development agreement (CRDA), is an improved voice recognition system based on the concepts and function of the VAIS. To determine the applicability of the VOIS to Corps of Engineers construction projects, Technology Transfer Test Bad (T3B) funds were provided to the Corps of Engineers National Security Agency (NSA) Area Office (Fort Meade) to procure and implement the VOIS, and to train personnel in its use. This report summarizes the NSA application of the VOIS to quality assurance inspection of radio frequency shielding and to progress payment logs, and concludes that the VOIS is an easily implemented system that can offer improvements when applied to repetitive inspection procedures. Use of VOIS can save time during inspection, improve documentation storage, and provide flexible retrieval of stored information.
Site Scientific Mission Plan for the Southern Great Plains CART site: January--June 1994
Energy Technology Data Exchange (ETDEWEB)
Schneider, J.M.; Lamb, P.J. [Univ. of Oklahoma, Norman, OK (United States). Cooperative Inst. for Mesoscale Meteorological Studies; Sisterson, D.L. [Argonne National Lab., IL (United States). Environmental Research Div.
1993-12-01
The Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site is designed to help satisfy the data needs of the Atmospheric Radiation Measurement (ARM) Program Science Team. This document defines the scientific priorities for site activities during the six months beginning on January 1, 1994, and also looks forward in lesser detail to subsequent six-month periods. The primary purpose of this Site Scientific Mission Plan is to provide guidance for the development of plans for site operations. It also provides information on current plans to the ARM Functional Teams (Management Team, Experiment Support Team, Operations Team, Data Management Team, Instrument Team, and Campaign Team), and it serves to disseminate the plans more generally within the ARM Program and among the Science Team. This document includes a description of the site`s operational status and the primary envisaged site activities, together with information concerning approved and proposed Intensive Observation Periods. Amendments will be prepared and distributed whenever the content changes by more than 30% within a six-month period. The primary users of this document are the site operator, the site scientist, the Science Team through the ARM Program Science Director, the ARM Program Experiment Center, and the aforementioned ARM Program Functional Teams. This plan is a living document that will be updated and reissued every six months as the observational facilities are developed, tested, and augmented and as priorities are adjusted in response to developments in scientific planning and understanding.
A case for bone canaliculi as the anatomical site of strain generated potentials
Cowin, S. C.; Weinbaum, S.; Zeng, Y.
1995-01-01
We address the question of determining the anatomical site that is the source of the experimentally observed strain generated potentials (SGPs) in bone tissue. There are two candidates for the anatomical site that is the SGP source, the collagen-hydroxyapatite porosity and the larger size lacunar-canalicular porosity. In the past it has been argued, on the basis of experimental data and a reasonable model, that the site of the SGPs in bone is the collagen-hydroxyapatite porosity. The theoretically predicted pore radius necessary for the SGPs to reside in this porosity is 16 nm, which is somewhat larger than the pore radii estimated from gas adsorption data where the preponderance of the pores were estimated to be in the range 5-12.5 nm. However, this pore size is significantly larger than the 2 nm size of the small tracer, microperoxidase, which appears to be excluded from the mineralized matrix. In this work a similar model, but one in which the effects of fluid dynamic drag of the cell surface matrix in the bone canaliculi are included, is used to show that it is possible for the generation of SGPs to be associated with the larger size lacunar-canalicular porosity when the hydraulic drag and electrokinetic contribution of the bone fluid passage through the cell coat (glycocalyx) is considered. The consistency of the SGP data with this model is demonstrated. A general boundary condition is introduced to allow for current leakage at the bone surface. The results suggest that the current leakage is small for the in vitro studies in which the strain generated potentials have been measured.
Empirical estimates of CCN from aerosol optical properties at four remote sites
Directory of Open Access Journals (Sweden)
A. Jefferson
2010-07-01
Full Text Available This study presents an empirical method to estimate the CCN concentration as a function of percent supersaturation. The aerosol optical properties, backscatter fraction and single scatter albedo, function as proxies for the aerosol size and composition in a power law relationship to CCN. This method is tested at four sites with aged aerosol: SGP (Oklahoma, USA, FKB (Black Forest, Germany, HFE (Hefei, China and GRW (Graciosa, Azores. Each site represents a different aerosol type and thus demonstrates the method robustness and limitations. Good agreement was found between the calculated and measured CCN with slopes between 0.81 and 1.03 and correlation coefficients (r2 values between 0.59 and 0.67. The fit quality declined at low CCN concentrations.
'Yeast mail': a novel Saccharomyces application (NSA) to encrypt messages.
Rosemeyer, Helmut; Paululat, Achim; Heinisch, Jürgen J
2014-09-01
The universal genetic code is used by all life forms to encode biological information. It can also be used to encrypt semantic messages and convey them within organisms without anyone but the sender and recipient knowing, i.e., as a means of steganography. Several theoretical, but comparatively few experimental, approaches have been dedicated to this subject, so far. Here, we describe an experimental system to stably integrate encrypted messages within the yeast genome using a polymerase chain reaction (PCR)-based, one-step homologous recombination system. Thus, DNA sequences encoding alphabetical and/or numerical information will be inherited by yeast propagation and can be sent in the form of dried yeast. Moreover, due to the availability of triple shuttle vectors, Saccharomyces cerevisiae can also be used as an intermediate construction device for transfer of information to either Drosophila or mammalian cells as steganographic containers. Besides its classical use in alcoholic fermentation and its modern use for heterologous gene expression, we here show that baker's yeast can thus be employed in a novel Saccharomyces application (NSA) as a simple steganographic container to hide and convey messages. Copyright © 2014 Verlag Helvetica Chimica Acta AG, Zürich.
Applying Agrep to r-NSA to solve multiple sequences approximate matching.
Ni, Bing; Wong, Man-Hon; Lam, Chi-Fai David; Leung, Kwong-Sak
2014-01-01
This paper addresses the approximate matching problem in a database consisting of multiple DNA sequences, where the proposed approach applies Agrep to a new truncated suffix array, r-NSA. The construction time of the structure is linear to the database size, and the computations of indexing a substring in the structure are constant. The number of characters processed in applying Agrep is analysed theoretically, and the theoretical upper-bound can approximate closely the empirical number of characters, which is obtained through enumerating the characters in the actual structure built. Experiments are carried out using (synthetic) random DNA sequences, as well as (real) genome sequences including Hepatitis-B Virus and X-chromosome. Experimental results show that, compared to the straight-forward approach that applies Agrep to multiple sequences individually, the proposed approach solves the matching problem in much shorter time. The speed-up of our approach depends on the sequence patterns, and for highly similar homologous genome sequences, which are the common cases in real-life genomes, it can be up to several orders of magnitude.
Data systems for science integration within the Atmospheric Radiation Measurement Program
Energy Technology Data Exchange (ETDEWEB)
Gracio, D.K.; Hatfield, L.D.; Yates, K.R.; Voyles, J.W. [Pacific Northwest Lab., Richland, WA (United States); Tichler, J.L. [Brookhaven National Lab., Upton, NY (United States); Cederwall, R.T.; Laufersweiler, M.J.; Leach, M.J. [Lawrence Livermore National Lab., CA (United States); Singley, P. [Oak Ridge National Lab., TN (United States)
1995-12-31
The Atmospheric Radiation Measurement (ARM) Program was developed by the US Department of Energy to support the goals and mission of the US Global Change Research Program. The purpose of the ARM program is to improve the predictive capabilities of General Circulation Models (GCMs) in their treatment of clouds and radiative transfer effects. Three experimental testbeds were designed for the deployment of instruments to collect atmospheric data used to drive the GCMs. Each site, known as a Cloud and Radiation Testbed (CART), consists of a highly available, redundant data system for the collection of data from a variety of instrumentation. The first CART site was deployed in April 1992 in the Southern Great Plains (SGP), Lamont, Oklahoma, with the other two sites to follow in early 1996 in the Tropical Western Pacific (TWP) and in 1997 on the North Slope of Alaska (NSA). Approximately 1.5 GB of data are transferred per day via the Internet from the CART sites, and external data sources to the ARM Experiment Center (EC) at Pacific Northwest Laboratory in Richland, Washington. The Experimental Center is central to the ARM data path and provides for the collection, processing, analysis and delivery of ARM data. Data from the CART sites from a variety of instrumentation, observational systems and from external data sources are transferred to the Experiment Center. The EC processes these data streams on a continuous basis to provide derived data products to the ARM Science Team in near real-time while maintaining a three-month running archive of data.
Xi, B.; Minnis, P.
2006-01-01
Data collected at the Department of Energy Atmospheric Radiation Measurement (ARM) Southern Great Plains (SGP) Central Facility (SCF) are analyzed to determine the monthly and hourly variations of cloud fraction and radiative forcing between January 1997 and December 2002. Cloud fractions are estimated for total cloud cover and for single-layered low (0-3 km), middle (3-6 km), and high clouds (more than 6 km) using ARM SCG ground-based paired lidar-radar measurements. Shortwave (SW) and longwave (LW) fluxes are derived from up- and down-looking standard precision spectral pyranometers and precision infrared radiometer measurements with uncertainties of approximately 10 Wm(exp -2). The annual averages of total, and single-layered low, middle and high cloud fractions are 0.49, 0.11, 0.03, and 0.17, respectively. Both total and low cloud amounts peak during January and February and reach a minimum during July and August, high clouds occur more frequently than other types of clouds with a peak in summer. The average annual downwelling surface SW fluxes for total and low clouds (151 and 138 Wm(exp-2), respectively) are less than those under middle and high clouds (188 and 201 Wm(exp -2), respectively), but the downwelling LW fluxes (349 and 356 Wm(exp -2)) underneath total and low clouds are greater than those from middle and high clouds (337 and 333 Wm(exp -2)). Low clouds produce the largest LW warming (55 Wm(exp -2) and SW cooling (-91 Wm(exp -2)) effects with maximum and minimum absolute values in spring and summer, respectively. High clouds have the smallest LW warming (17 Wm(exp -2)) and SW cooling (-37 Wm(exp -2)) effects at the surface. All-sky SW CRF decreases and LW CRF increases with increasing cloud fraction with mean slopes of -0.984 and 0.616 Wm(exp -2)%(exp -1), respectively. Over the entire diurnal cycle, clouds deplete the amount of surface insolation more than they add to the downwelling LW flux. The calculated CRFs do not appear to be significantly
Lavigne, T.; Liu, C.
2017-12-01
Previous studies focusing on the comparison of the measured electric field to the physical properties of global electrified clouds have been conducted almost exclusively in the Southern Hemisphere. The One-Year Electric Field Study-North Slope of Alaska (OYES-NSA) aims to establish a long-running collection of this valuable electric field data in the Northern Hemisphere. Presented here is the six-month preliminary data and results of the OYES-NSA Atmospheric Radiation Mission (ARM) field campaign. The local electric field measured in Barrow, Alaska using two CS110 reciprocating shutter field meters, has been compared to simultaneous measurements from the ARM Ka-Band zenith radar, to better understand the influence and contribution of different types of clouds on the local electric field. The fair-weather electric field measured in Barrow has also been analyzed and compared to the climatology of electric field at Vostok Station, Antarctica. The combination of the electric field dataset in the Northern Hemisphere, alongside the local Ka cloud radar, global Precipitation Feature (PF) database, and quasi-global lightning activity (55oN-55oS), allows for advances in the physical understanding of the local electric field, as well as the Global Electric Circuit (GEC).
Dong, Xiquan; Xi, Baike; Minnis, Patrick
2006-01-01
Data collected at the Department of Energy Atmospheric Radiation Measurement (ARM) Southern Great Plains (SGP) central facility are analyzed for determining the variability of cloud fraction and radiative forcing at several temporal scales between January 1997 and December 2002. Cloud fractions are estimated for total cloud cover and for single-layer low (0-3 km), middle (3-6 km), and high clouds (greater than 6 km) using ARM SGP ground-based paired lidar-radar measurements. Shortwave (SW), longwave (LW), and net cloud radiative forcings (CRF) are derived from up- and down-looking standard precision spectral pyranometers and precision infrared radiometer measurements. The annual averages of total, and single-layer, nonoverlapped low, middle and high cloud fractions are 0.49, 0.11, 0.03, and 0.17, respectively. Total and low cloud amounts were greatest from December through March and least during July and August. The monthly variation of high cloud amount is relatively small with a broad maximum from May to August. During winter, total cloud cover varies diurnally with a small amplitude, mid-morning maximum and early evening minimum, and during summer it changes by more than 0.14 over the daily cycle with a pronounced early evening minimum. The diurnal variations of mean single-layer cloud cover change with season and cloud height. Annual averages of all-sky, total, and single-layer high, middle, and low LW CRFs are 21.4, 40.2, 16.7, 27.2, and 55.0 Wm(sup -2), respectively; and their SW CRFs are -41.5, -77.2, -37.0, -47.0, and -90.5 Wm(sup -2). Their net CRFs range from -20 to -37 Wm(sup -2). For all-sky, total, and low clouds, the maximum negative net CRFs of -40.1, -70, and -69.5 Wm(sup -2), occur during April; while the respective minimum values of -3.9, -5.7, and -4.6 Wm(sup -2), are found during December. July is the month having maximum negative net CRF of -46.2 Wm(sup -2) for middle clouds, and May has the maximum value of -45.9 Wm(sup -2) for high clouds. An
Energy Technology Data Exchange (ETDEWEB)
Anderson, Gail P. [National Oceanic and Atmospheric Administration (NOAA), Washington, DC (United States); Cipar, John [Air Force Research Lab. (AFRL), Wright-Patterson AFB, OH (United States); Armstrong, Peter S. [Air Force Research Lab. (AFRL), Wright-Patterson AFB, OH (United States); van den Bosch, J. [Air Force Research Lab. (AFRL), Wright-Patterson AFB, OH (United States)
2016-05-01
Two spectrally calibrated tarpaulins (tarps) were co-located at a fixed Global Positioning System (GPS) position on the gravel antenna field at the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility’s Southern Great Plains (SGP) site. Their placement was timed to coincide with the overflight of a new hyperspectral imaging satellite. The intention was to provide an analysis of the data obtained, including the measured and retrieved spectral albedos for the calibration tarps. Subsequently, a full suite of retrieved values of H2O column, and the aerosol overburden, were to be compared to those determined by alternate SGP ground truth assets. To the extent possible, the down-looking cloud images would be assessed against the all-sky images. Because cloud contamination above a certain level precludes the inversion processing of the satellite data, coupled with infrequent targeting opportunities, clear-sky conditions were imposed. The SGP site was chosen not only as a target of opportunity for satellite validation, but as perhaps the best coincident field measurement site, as established by DOE’s ARM Facility. The satellite team had every expectation of using the information obtained from the SGP to improve the inversion products for all subsequent satellite images, including the cloud and radiative models and parameterizations and, thereby, the performance assessment for subsequent and historic image collections. Coordinating with the SGP onsite team, four visits, all in 2009, to the Central Facility occurred: • June 6-8 (successful exploratory visit to plan tarp placements, etc.) • July 18-24 (canceled because of forecast for heavy clouds) • Sep 9-12 (ground tarps placed, onset of clouds) • Nov 7-9 (visit ultimately canceled because of weather predictions). As noted, in each instance, any significant overcast prediction precluded image collection from the satellite. Given the long task-scheduling procedures
BOREAS HYD-8 DEM Data Over the NSA-MSA and SSA-MSA in the UTM Projection
Wang, Xue-Wen; Hall, Forrest G. (Editor); Knapp, David E. (Editor); Band, L. E.; Smith, David E. (Technical Monitor)
2000-01-01
The BOREAS HYD-8 team focused on describing the scaling behavior of water and carbon flux processes at local and regional scales. These DEMs were produced from digitized contours at a cell resolution of 100 meters. Vector contours of the area were used as input to a software package that interpolates between contours to create a DEM representing the terrain surface. The vector contours had a contour interval of 25 feet. The data cover the BOREAS MSAs of the SSA and NSA and are given in a UTM map projection. Most of the elevation data from which the DEM was produced were collected in the 1970s or 1980s. The data are stored in binary, image format files. The data files are available on a CD-ROM (see document number 20010000884) or from the Oak Ridge National Laboratory (ORNL) Distributed Active Archive Center (DAAC).
Providing Diurnal Sky Cover Data at ARM Sites
Energy Technology Data Exchange (ETDEWEB)
Klebe, Dimitri I. [Solmirus Corporation, Colorado Springs, CO (United States)
2015-03-06
The Solmirus Corporation was awarded two-year funding to perform a comprehensive data analysis of observations made during Solmirus’ 2009 field campaign (conducted from May 21 to July 27, 2009 at the ARM SGP site) using their All Sky Infrared Visible Analyzer (ASIVA) instrument. The objective was to develop a suite of cloud property data products for the ASIVA instrument that could be implemented in real time and tailored for cloud modelers. This final report describes Solmirus’ research and findings enabled by this grant. The primary objective of this award was to develop a diurnal sky cover (SC) data product utilizing the ASIVA’s infrared (IR) radiometrically-calibrated data and is described in detail. Other data products discussed in this report include the sky cover derived from ASIVA’s visible channel and precipitable water vapor, cloud temperature (both brightness and color), and cloud height inferred from ASIVA’s IR channels.
Energy Technology Data Exchange (ETDEWEB)
Zhong, S.; Fast, J.D.; Bian, X.; Stage, S. [Pacific Northwest National Lab., Richland, WA (United States)] [and others
1996-04-01
The Great Plains low-level jet (LLJ) has important effects on the life cycle of clouds and on radiative and surface heat and moisture fluxes at the Atmospheric Radiation Measurement (ARM) Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site. This diurnal phenomenon governs the transport and convergence of low-level moisture into the region and often leads to the development of clouds and precipitation. A full understanding of the life cycle of clouds at the SGP CART site and their proper representation in single column and global climate models cannot be obtained without an improved understanding of this important phenomenon.
Energy Technology Data Exchange (ETDEWEB)
Revercomb, Henry; Tobin, David; Knuteson, Robert; Borg, Lori; Moy, Leslie
2009-06-17
This grant began with the development of the Atmospheric Emitted Radiance Interferometer (AERI) for ARM. The AERI has provided highly accurate and reliable observations of downwelling spectral radiance (Knuteson et al. 2004a, 2004b) for application to radiative transfer, remote sensing of boundary layer temperature and water vapor, and cloud characterization. One of the major contributions of the ARM program has been its success in improving radiation calculation capabilities for models and remote sensing that evolved from the multi-year, clear-sky spectral radiance comparisons between AERI radiances and line-by-line calculations (Turner et al. 2004). This effort also spurred us to play a central role in improving the accuracy of water vapor measurements, again helping ARM lead the way in the community (Turner et al. 2003a, Revercomb et al. 2003). In order to add high-altitude downlooking AERI-like observations over the ARM sites, we began the development of an airborne AERI instrument that has become known as the Scanning High-resolution Interferometer Sounder (Scanning-HIS). This instrument has become an integral part of the ARM Unmanned Aerospace Vehicle (ARM-UAV) program. It provides both a cross-track mapping view of the earth and an uplooking view from the 12-15 km altitude of the Scaled Composites Proteus aircraft when flown over the ARM sites for IOPs. It has successfully participated in the first two legs of the “grand tour” of the ARM sites (SGP and NSA), resulting in a very good comparison with AIRS observations in 2002 and in an especially interesting data set from the arctic during the Mixed-Phase Cloud Experiment (M-PACE) in 2004.
ARM Airborne Carbon Measurements (ARM-ACME) and ARM-ACME 2.5 Final Campaign Reports
Energy Technology Data Exchange (ETDEWEB)
Biraud, S. C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Tom, M. S. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Sweeney, C. [NOAA Earth Systems Research Lab., Boulder, CO (United States)
2016-01-01
We report on a 5-year multi-institution and multi-agency airborne study of atmospheric composition and carbon cycling at the Atmospheric Radiation Measurement (ARM) Climate Research Facility’s Southern Great Plains (SGP) site, with scientific objectives that are central to the carbon-cycle and radiative-forcing goals of the U.S. Global Change Research Program and the North American Carbon Program (NACP). The goal of these measurements is to improve understanding of 1) the carbon exchange of the Atmospheric Radiation Measurement (ARM) SGP region; 2) how CO2 and associated water and energy fluxes influence radiative-forcing, convective processes, and CO2 concentrations over the ARM SGP region, and 3) how greenhouse gases are transported on continental scales.
Energy Technology Data Exchange (ETDEWEB)
Cary, Robert
2016-04-01
The purpose of this study was to measure the organic carbon (OC) and elemental carbon (EC) fractions of PM2.5 particulate matter at the U.S. Department of Energy (DOE)’s Atmospheric Radiation Measurement (ARM) Climate Research Facility Southern Great Plains (SGP) sampling site for a 6-month period during the summer of 2013. The site is in a rural location remote from any populated areas, so it would be expected to reflect carbon concentration over long-distance transport patterns. During the same period in 2012, a number of prairie fires in Oklahoma and Texas had produced large plumes of smoke particles, but OC and EC particles had not been quantified. In addition, during the summer months, other wild fires, such as forest fires in the Rocky Mountain states and other areas, can produce carbon aerosols that are transported over long distances. Both of these source types would be expected to contain mixtures of both OC and EC.
Directory of Open Access Journals (Sweden)
Francisco Regis Vieira Alves
2016-09-01
Full Text Available Neste artigo trazemos uma discussão, que não desconsidera elementos de ordem histórica, atinentes ao modelo matemático que nomeamos por Sequência de Pell – SP. Mostraremos os resultados de artigos especializados, predominantemente das décadas de 80 e 90, que indicam resultados que validam a generalização do referido modelo, e que passa a ser nomeado, então, como Sequência Generalizada de Pell – SGP. Intimamente relacionado com outra duas outras sequências emblemáticas, como a sequência de Fibonacci e de Lucas, apontaremos propriedades e relações desconsideradas por autores de livros de História da Matemática - HM e demarcaremos determinados elementos que podem atuar decidamente para um entendimento da evolução epistemológica de um modelo devido a John Pell, o qual preserva seu vigor e se mostra indene ao passar dos séculos.
Design and implementation of a computer based site operations log for the ARM Program
International Nuclear Information System (INIS)
Tichler, J.L.; Bernstein, H.J.; Bobrowski, S.F.; Melton, R.B.; Campbell, A.P.; Edwards, D.M.; Kanciruk, P.; Singley, P.T.
1992-01-01
The Atmospheric Radiation Measurement (ARM) Program is a Department of Energy (DOE) research effort to reduce the uncertainties found in general circulation and other models due to the effects of clouds and solar radiation. ARM will provide an experimental testbed for the study of important atmospheric effects, particularly cloud and radiative processes, and testing of parameterizations of the processes for use in atmospheric models. The design of the testbed known as the Clouds and Radiation Testbed (CART), calls for five, long-term field data collection sites. The first site, located in the Southern Great Plains (SGP) in Lamont, OK began operation in the spring of 1992. The CART Data Environment (CDE) is the element of the testbed which acquires the basic observations from the instruments and processes them to meet the ARM requirements. A formal design was used to develop a description of the logical requirements for the CDE. This paper discusses the design and prototype implementation of a part of the CDE known as the site operations log, which records metadata defining the environment within which the data produced by the instruments is collected
Dubey, Swati; Singh, Jyoti; Singh, R P
2018-01-01
Herein, sweet lime pulp waste (SLPW) was utilized as a low- or no-cost feedstock for the production of bacterial nanocellulose (BNC) alone and in amalgamation with other nutritional supplements by the isolate K. europaeus SGP37 under static batch and static intermittent fed-batch cultivation. The highest yield (26.2±1.50gL -1 ) was obtained in the hot water extract of SLPW supplemented with the components of HS medium, which got further boosted to 38±0.85gL -1 as the cultivation strategy was shifted from static batch to static intermittent fed-batch. BNC obtained from various SLPW medium was similar or even superior to that obtained with standard HS medium in terms of its physicochemical properties. The production yields of BNC thus obtained are significantly higher and fit well in terms of industrial scale production. Copyright © 2017 Elsevier Ltd. All rights reserved.
Morcrette, C. J.; Van Weverberg, K.; Ma, H.-Y.; Ahlgrimm, M.; Bazile, E.; Berg, L. K.; Cheng, A.; Cheruy, F.; Cole, J.; Forbes, R.; Gustafson, W. I.; Huang, M.; Lee, W.-S.; Liu, Y.; Mellul, L.; Merryfield, W. J.; Qian, Y.; Roehrig, R.; Wang, Y.-C.; Xie, S.; Xu, K.-M.; Zhang, C.; Klein, S.; Petch, J.
2018-03-01
We introduce the Clouds Above the United States and Errors at the Surface (CAUSES) project with its aim of better understanding the physical processes leading to warm screen temperature biases over the American Midwest in many numerical models. In this first of four companion papers, 11 different models, from nine institutes, perform a series of 5 day hindcasts, each initialized from reanalyses. After describing the common experimental protocol and detailing each model configuration, a gridded temperature data set is derived from observations and used to show that all the models have a warm bias over parts of the Midwest. Additionally, a strong diurnal cycle in the screen temperature bias is found in most models. In some models the bias is largest around midday, while in others it is largest during the night. At the Department of Energy Atmospheric Radiation Measurement Southern Great Plains (SGP) site, the model biases are shown to extend several kilometers into the atmosphere. Finally, to provide context for the companion papers, in which observations from the SGP site are used to evaluate the different processes contributing to errors there, it is shown that there are numerous locations across the Midwest where the diurnal cycle of the error is highly correlated with the diurnal cycle of the error at SGP. This suggests that conclusions drawn from detailed evaluation of models using instruments located at SGP will be representative of errors that are prevalent over a larger spatial scale.
AmeriFlux Measurement Component (AMC) Handbook
Energy Technology Data Exchange (ETDEWEB)
Reichl, K. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Biraud, S. C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2016-01-01
An AMC system was installed at the Atmospheric Radiation Measurement (ARM) Climate Research Facility’s North Slope Alaska (NSA) Barrow site, also known as NSA C1 at the ARM Data Archive, in August 2012. A second AMC system was installed at the third ARM Mobile Facility deployment at Oliktok Point, also known as NSA M1. This in situ system consists of 12 combination soil temperature and volumetric water content (VWC) reflectometers and one set of upwelling and downwelling PAR sensors, all deployed within the fetch of the Eddy Correlation Flux Measurement System. Soil temperature and VWC sensors placed at two depths (10 and 30 cm below the vegetation layer) at six locations (or microsites) allow soil property inhomogeneity to be monitored across a landscape. The soil VWC and temperature sensors used at NSA C1 are the Campbell Scientific CS650L and the sensors at NSA M1 use the Campbell Scientific CS655. The two sensors are nearly identical in function, and vendor specifications are based on the CS650 unless otherwise stated.
Thermodynamic phase profiles of optically thin midlatitude cloud and their relation to temperature
Energy Technology Data Exchange (ETDEWEB)
Naud, C. M.; Del Genio, Anthony D.; Haeffelin, M.; Morille, Y.; Noel, V.; Dupont, Jean-Charles; Turner, David D.; Lo, Chaomei; Comstock, Jennifer M.
2010-06-03
Winter cloud phase and temperature profiles derived from ground-based lidar depolarization and radiosonde measurements are analyzed for two midlatitude locations: the United States Atmospheric Radiation Measurement Program Southern Great Plains (SGP) site and the Site Instrumental de Recherche par Télédétection Atmosphérique (SIRTA) in France. Because lidars are attenuated in optically thick clouds, the dataset only includes optically thin clouds (optical thickness < 3). At SGP, 57% of the clouds observed with the lidar in the temperature range 233-273 K are either completely liquid or completely glaciated, while at SIRTA only 42% of the observed clouds are single phase, based on a depolarization ratio threshold of 11% for differentiating liquid from ice. Most optically thin mixed phase clouds show an ice layer at cloud top, and clouds with liquid at cloud top are less frequent. The relationship between ice phase occurrence and temperature only slightly changes between cloud base and top. At both sites liquid is more prevalent at colder temperatures than has been found previously in aircraft flights through frontal clouds of greater optical thicknesses. Liquid in clouds persists to colder temperatures at SGP than SIRTA. This information on the average temperatures of mixed phase clouds at both locations complements earlier passive satellite remote sensing measurements that sample cloud phase near cloud top and for a wider range of cloud optical thicknesses.
He, Jun; Zeller, Matthias; Hunter, Allen D; Xu, Zhengtao
2012-01-25
We describe a white emitting coordination network solid that can be conveniently applied as a thin film onto a commercial UV-LED lamp for practical white lighting applications. The solid state material was discovered in an exercise of exploring molecular building blocks equipped with secondary groups for fine-tuning the structures and properties of coordination nets. Specifically, CH(3)SCH(2)CH(2)S- and (S)-CH(3)(OH)CHCH(2)S- (2-hydroxylpropyl) were each attached as secondary groups to the 2,5- positions of 1,4-benzenedicarboxylic acid (bdc), and the resultant molecules (L1 and L2, respectively) were crystallized with Pb(II) into the topologically similar 3D nets of PbL1 and PbL2, both consisting of interlinked Pb-carboxyl chains. While the CH(3)S- groups in PbL1 are not bonded to the Pb(II) centers, the hydroxy groups in PbL2 participate in coordinating to Pb(II) and thus modify the bonding features around the Pb(II), but only to a slight and subtle degree (e.g., Pb-O distances 2.941-3.116 Å). Interestingly, the subtle change in structure significantly impacts the properties, i.e., while the photoluminescence of PbL1 is yellowish green, PbL2 features bright white emission. Also, the homochiral side group in PbL2 imparts significant second harmonic generation, in spite of its seemingly weak association with the main framework (the NLO-phore). In a broad perspective, this work showcases the idea of secondary group participation (SGP) in the construction of coordination networks, an idea that parallels that of hemilabile ligands in organometallics and points to an effective strategy in developing advanced functions in solid state framework materials. © 2011 American Chemical Society
Carlson, Gary P
2010-01-01
Styrene is a widely used chemical, but it is known to produce lung and liver damage in mice. This may be related to oxidative stress associated with the decrease in the levels of reduced glutathione (GSH) in the target tissues. The purpose of this study was to investigate the effect of styrene and its primary metabolites R-styrene oxide (R-SO) and S-styrene oxide (S-SO) on GSH levels in the lung lumen, as determined by amounts of GSH in bronchioalveolar lavage fluid (BALF) and in plasma. When non-Swiss albino (NSA) mice were administered styrene (600 mg/kg, ip), there was a significant fall in GSH levels in both BALF and plasma within 3 h. These returned to control levels by 12 h. The active metabolite R-SO (300 mg/kg, ip) also produced significant decreases in GSH in both BALF and plasma, but S-SO was without marked effect. Since GSH is a principal antioxidant in the lung epithelial lining fluid, this fall due to styrene may exert a significant influence on the ability of the lung to buffer oxidative damage.
Directory of Open Access Journals (Sweden)
Y. Qian
2012-02-01
Full Text Available Cloud Fraction (CF is the dominant modulator of radiative fluxes. In this study, we evaluate CF simulated in the IPCC AR4 GCMs against ARM long-term ground-based measurements, with a focus on the vertical structure, total amount of cloud and its effect on cloud shortwave transmissivity. Comparisons are performed for three climate regimes as represented by the Department of Energy Atmospheric Radiation Measurement (ARM sites: Southern Great Plains (SGP, Manus, Papua New Guinea and North Slope of Alaska (NSA. Our intercomparisons of three independent measurements of CF or sky-cover reveal that the relative differences are usually less than 10% (5% for multi-year monthly (annual mean values, while daily differences are quite significant. The total sky imager (TSI produces smaller total cloud fraction (TCF compared to a radar/lidar dataset for highly cloudy days (CF > 0.8, but produces a larger TCF value than the radar/lidar for less cloudy conditions (CF < 0.3. The compensating errors in lower and higher CF days result in small biases of TCF between the vertically pointing radar/lidar dataset and the hemispheric TSI measurements as multi-year data is averaged. The unique radar/lidar CF measurements enable us to evaluate seasonal variation of cloud vertical structures in the GCMs.
Both inter-model deviation and model bias against observation are investigated in this study. Another unique aspect of this study is that we use simultaneous measurements of CF and surface radiative fluxes to diagnose potential discrepancies among the GCMs in representing other cloud optical properties than TCF. The results show that the model-observation and inter-model deviations have similar magnitudes for the TCF and the normalized cloud effect, and these deviations are larger than those in surface downward solar radiation and cloud transmissivity. This implies that other dimensions of cloud in addition to cloud amount, such as cloud optical thickness and
A clear-sky hyperspectral closure study for MERRA-2 and ERA-interim reanalyses
Chen, X.; Huang, X.; Loeb, N. G.; Dong, X.; Xi, B.; Dolinar, E. K.; Bosilovich, M. G.; Kato, S.; Smith, W. L., Jr.; Stackhouse, P. W., Jr.
2017-12-01
We carried out a clear-sky radiance closure study to compare four sets of synthetic AIRS spectra to 51 AIRS L1 spectra over the ARM Southern Great Plains (SGP) site. The AIRS observations were made when the ARM SGP cloud radar identified cloud free situation for 50-km region within the SGP site. Four sets of synthetic AIRS spectra are calculated using collocated atmospheric profiles from ARM SGP sounding, AIRS L2 retrievals, MERRA-2 and ECMWF ERA-Interim reanalyses. Only channels that are sensitive to temperature, CO2 and water vapor and not to other trace gases are selected for study. The selected channels are further divided into different groups according to their sensitivities to the emission from different vertical levels and to H2O and CO2, respectively. Observed and synthetic radiances of each group are then examined. For synthetic spectra using the AIRS L2 retrievals or the ARM SGP sounding profiles, the brightness temperature (BT) differences between synthetic and observed ones are within ±0.5 K or even smaller, for all groups and for all four seasons. For MERRA-2 and ECMWF-interim reanalyses, the BT differences from observations for each CO2 group are generally within ±0.5 K, indicating good agreements with respect to temperature profiles in the reanalyses. The BT differences for H2O groups are all negative, ranging from -0.5K to -1.5K. The largest BT difference is -1.5K for H2O channels peaking at 400-200 hPa. Such BT difference is persistent when the synthetic radiances based on reanalyses are compared with observed ones for the entire zone of 30°N-40°N. These comparisons imply that the reanalyses can represent the temperature profile well but there is persistent wet bias in the reanalyses, especially for the upper troposphere. The water vapor at 400-200 hPa in reanalyses needs to be adjusted by about -0.01 g/kg in order to reach agreement with the observed radiances.
Jacob, J.; Chilson, P. B.; Houston, A. L.; Smith, S.
2017-12-01
CLOUD-MAP (Collaboration Leading Operational UAS Development for Meteorology and Atmospheric Physics) is a 4 year, 4 university collaboration sponsored by the National Science Foundation to develop capabilities that will allow meteorologists and atmospheric scientists to use unmanned aircraft as a common, useful everyday measurement tool. Currently, we know that systems can be used for meteorological measurements, but they are far from being practical or robust for everyday field diagnostics by the average meteorologist or scientist. In particular, UAS are well suited for the lower atmosphere, namely the lower boundary layer that has a large impact on the atmosphere and where much of the weather phenomena begin. The 2016 and 2017 campaigns resulted in over 500 unmanned aircraft flights of over a dozen separate platforms collecting meteorological data at 3 different sites including Oklahoma Mesonet stations and the DOE Atmospheric Radiation Measurement Southern Great Plains (SGP) site. The SGP atmospheric observatory was the first field measurement site established by the ARM Climate Research Facility and is the world's largest and most extensive climate research facility. Data from the SGP was used to validate observations from the various UAS. UAS operations consisted of both fixed and rotary platforms up to 3,000 AGL with thermodynamic, wind, and chemistry (viz., CO2 and CH4) sensors. ABL conditions were observed over a variety of conditions, particularly during the morning transition to evaluate the boundary layer dilution due to vertical mixing and changes in the wind patterns from diurnal variability.
Climatology analysis of cirrus cloud in ARM site: South Great Plain
Olayinka, K.
2017-12-01
Cirrus cloud play an important role in the atmospheric energy balance and hence in the earth's climate system. The properties of optically thin clouds can be determined from measurements of transmission of the direct solar beam. The accuracy of cloud optical properties determined in this way is compromised by contamination of the direct transmission by light that is scattered into the sensors field of view. With the forward scattering correction method developed by Min et al., (2004), the accuracy of thin cloud retrievals from MFRSR has been improved. Our result shows over 30% of cirrus cloud present in the atmosphere are within optical depth between (1-2). In this study, we do statistics studies on cirrus clouds properties based on multi-years cirrus cloud measurements from MFRSR at ARM site from the South Great Plain (SGP) site due to its relatively easy accessibility, wide variability of climate cloud types and surface flux properties, large seasonal variation in temperature and specific humidity. Through the statistic studies, temporal and spatial variations of cirrus clouds are investigated. Since the presence of cirrus cloud increases the effect of greenhouse gases, we will retrieve the aerosol optical depth in all the cirrus cloud regions using a radiative transfer model for atmospheric correction. Calculate thin clouds optical depth (COD), and aerosol optical depth (AOD) using a radiative transfer model algorithm, e.g.: MODTRAN (MODerate resolution atmospheric TRANsmission)
Woods, K. M.; Fattaey, H.; Johnson, T. C.; Chapes, S. K.; Spooner, B. S. (Principal Investigator)
1994-01-01
The tumor necrosis factor-alpha (TNF)-resistant, SV40-transformed, murine fibroblast cell lines, F5b and F5m, became sensitive to TNF-mediated cytolysis after treatment with a biologically active 18 kDa peptide fragment (SGP) derived from a 66-kDa parental cell surface sialoglycoprotein. Neither TNF nor the SGP alone exhibited cytotoxicity to the two SV40-transformed cell lines. However, Balb/c 3T3 cells, incubated with SGP alone or with SGP and TNF, were not killed. Therefore, SGP can selectively sensitize cells for TNF alpha-mediated cytotoxicity. This selective sensitization may be due to the previously documented ability of the SGP to selectively mediate cell cycle arrest.
Scanning Radar Investigations to Characterize Cloud and Precipitation Processes for ASR
Energy Technology Data Exchange (ETDEWEB)
Venkatachalam, Chandrasekar [Colorado State Univ., Fort Collins, CO (United States). Dept. of Electrical and Computer Engineering. Cooperative Inst. for Research in the Atmosphere (CIRA)
2016-12-17
The project conducted investigations in the following areas related to scanning radar retrievals: a) Development for Cloud drizzle separation studies for the ENA site based on Doppler Spectra b) Advanced radar retrieval for the SGP site c) Characterizing falling snow using multifrequency dual-polarization measurements d) BAECC field experiment. More details about these investigations can be found within each subtopic within the report.
BOREAS TE-5 Soil Respiration Data
Hall, Forrest G. (Editor); Curd, Shelaine (Editor); Ehleriinger, Jim; Brooks, J. Renee; Flanagan, Larry
2000-01-01
The BOREAS TE-5 team collected measurements in the NSA and SSA on gas exchange, gas composition, and tree growth. Soil respiration data were collected from 26-May-94 to 07-Sep-94 in the BOREAS NSA and SSA to compare the soil respiration rates in different forest sites using a LI-COR 6200 soil respiration chamber (model 6299). The data are stored in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884), or from the Oak Ridge National Laboratory (ORNL) Distrobuted Activity Archive Center (DAAC).
AmeriFlux Measurement Component (AMC) Instrument Handbook
Energy Technology Data Exchange (ETDEWEB)
Reichl, Ken [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Biraud, Sebastien C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2016-04-01
An AMC system was installed at the U.S. Department of Energy (DOE)’s Atmospheric Radiation Measurement (ARM) Climate Research Facility North Slope of Alaska (NSA) Barrow site, also known as NSA C1 at the ARM Data Archive, in August 2012. A second AMC system was installed at the third ARM Mobile Facility deployment at Oliktok Point, also known as NSA M1. This in situ system consists of 12 combination soil temperature and volumetric water content (VWC) reflectometers and one set of upwelling and downwelling photosynthetically active radiation (PAR) sensors, all deployed within the fetch of the Eddy Correlation Flux Measurement System. Soil temperature and VWC sensors placed at two depths (10 and 30 cm below the vegetation layer) at six locations (or microsites) allow soil property inhomogeneity to be monitored across a landscape.
Department of National Security Affairs News Archive for period of June 7, 2016 to September 9, 2016
2016-01-01
This document captures NSA's "archived" news content for this period: 2016-06-07 to 2016-09-06. National Security Affairs (NSA) News Includes these articles: NSA Faculty Contribute to Diplomacy Efforts; Visiting Scholar Discusses Russia and Putin with NSA Students; Dr. Covell Meyskens Featured in NY Times; NSA Professor Huntley Shares Knowledge with DLI FAOs; NSA Prof Afshon Ostovar Published in Foreign Affairs; NSA Prof Jasper Speaks on ISIS as Adaptive Hybrid Threat; NSA Department Welc...
Immunologic relationships of human serum albumin, macroaggregated albumin, and albumin microspheres
International Nuclear Information System (INIS)
Stang, P.C.; Roelands, J.F.; Cohen, P.
1975-01-01
Antigenic relationships of NSA (normal serum albumin), MAA (macroaggregated albumin), and HAM (human albumin microspheres) were determined in vivo in guinea pigs and in vitro in gel diffusion plates. Results showed that HAM could sensitize but seldom elicit anaphylaxis when used to challenge guinea pigs. In contrast, NSA and MAA were strong sensitizing antigens and inducers of anaphylaxis. The relative inability of HAM to induce anaphylaxis suggests that during production of the microspheres from soluble albumin, antigenic determinants of albumin may be altered or masked. Consequently, these determinants may be less available to react with antibody at the tissue sites
Modeling of the Ebola Virus Delta Peptide Reveals a Potential Lytic Sequence Motif
Directory of Open Access Journals (Sweden)
William R. Gallaher
2015-01-01
Full Text Available Filoviruses, such as Ebola and Marburg viruses, cause severe outbreaks of human infection, including the extensive epidemic of Ebola virus disease (EVD in West Africa in 2014. In the course of examining mutations in the glycoprotein gene associated with 2014 Ebola virus (EBOV sequences, a differential level of conservation was noted between the soluble form of glycoprotein (sGP and the full length glycoprotein (GP, which are both encoded by the GP gene via RNA editing. In the region of the proteins encoded after the RNA editing site sGP was more conserved than the overlapping region of GP when compared to a distant outlier species, Tai Forest ebolavirus. Half of the amino acids comprising the “delta peptide”, a 40 amino acid carboxy-terminal fragment of sGP, were identical between otherwise widely divergent species. A lysine-rich amphipathic peptide motif was noted at the carboxyl terminus of delta peptide with high structural relatedness to the cytolytic peptide of the non-structural protein 4 (NSP4 of rotavirus. EBOV delta peptide is a candidate viroporin, a cationic pore-forming peptide, and may contribute to EBOV pathogenesis.
Dynamic Socialized Gaussian Process Models for Human Behavior Prediction in a Health Social Network
Shen, Yelong; Phan, NhatHai; Xiao, Xiao; Jin, Ruoming; Sun, Junfeng; Piniewski, Brigitte; Kil, David; Dou, Dejing
2016-01-01
Modeling and predicting human behaviors, such as the level and intensity of physical activity, is a key to preventing the cascade of obesity and helping spread healthy behaviors in a social network. In our conference paper, we have developed a social influence model, named Socialized Gaussian Process (SGP), for socialized human behavior modeling. Instead of explicitly modeling social influence as individuals' behaviors influenced by their friends' previous behaviors, SGP models the dynamic social correlation as the result of social influence. The SGP model naturally incorporates personal behavior factor and social correlation factor (i.e., the homophily principle: Friends tend to perform similar behaviors) into a unified model. And it models the social influence factor (i.e., an individual's behavior can be affected by his/her friends) implicitly in dynamic social correlation schemes. The detailed experimental evaluation has shown the SGP model achieves better prediction accuracy compared with most of baseline methods. However, a Socialized Random Forest model may perform better at the beginning compared with the SGP model. One of the main reasons is the dynamic social correlation function is purely based on the users' sequential behaviors without considering other physical activity-related features. To address this issue, we further propose a novel “multi-feature SGP model” (mfSGP) which improves the SGP model by using multiple physical activity-related features in the dynamic social correlation learning. Extensive experimental results illustrate that the mfSGP model clearly outperforms all other models in terms of prediction accuracy and running time. PMID:27746515
BOREAS TF-10 NSA-Fen Tower Flux and Meteorological Data
McCaughey, J. Harry; Hall, Forrest G. (Editor); Huemmrich, Karl (Editor); Jelinski, Dennis E.
2000-01-01
The BOREAS TF-10 team collected tower flux and meteorological data at two sites, a fen and a young jack pine forest, near Thompson, Manitoba, Canada, as part of BOREAS. A preliminary data set was assembled in August 1993 while field testing the instrument packages, and at both sites data were collected from 15-Aug to 31-Aug. The main experimental period was in 1994, when continuous data were collected from 08-Apr to 23-Sep at the fen site. A very limited experiment was run in the spring/ summer of 1995, when the fen site tower was operated from 08-Apr to 14-Jun in support of a hydrology experiment in an adjoining feeder basin. Upon examination of the 1994 data set, it became clear that the behavior of the heat, water, and carbon dioxide fluxes throughout the whole growing season was an important scientific question, and that the 1994 data record was not sufficiently long to capture the character of the seasonal behavior of the fluxes. Thus, the fen site was operated in 1996 in order to collect data from spring melt to autumn freeze-up. Data were collected from 29-Apr to 05-Nov at the fen site. All variables are presented as 30-minute averages. The data are stored in tabular ASCII files.
Widjaja, E; Mahmoodabadi, S Z; Rea, D; Moineddin, R; Vidarsson, L; Nilsson, D
2009-01-01
Tensor estimation can be improved by increasing the number of gradient directions (NGD) or increasing the number of signal averages (NSA), but at a cost of increased scan time. To evaluate the effects of NGD and NSA on fractional anisotropy (FA) and fiber density index (FDI) in vivo. Ten healthy adults were scanned on a 1.5T system using nine different diffusion tensor sequences. Combinations of 7 NGD, 15 NGD, and 25 NGD with 1 NSA, 2 NSA, and 3 NSA were used, with scan times varying from 2 to 18 min. Regions of interest (ROIs) were placed in the internal capsules, middle cerebellar peduncles, and splenium of the corpus callosum, and FA and FDI were calculated. Analysis of variance was used to assess whether there was a difference in FA and FDI of different combinations of NGD and NSA. There was no significant difference in FA of different combinations of NGD and NSA of the ROIs (P>0.005). There was a significant difference in FDI between 7 NGD/1 NSA and 25 NGD/3 NSA in all three ROIs (PNSA, 25 NGD/1 NSA, and 25 NGD/2 NSA and 25 NGD/3 NSA in all ROIs (P>0.005). We have not found any significant difference in FA with varying NGD and NSA in vivo in areas with relatively high anisotropy. However, lower NGD resulted in reduced FDI in vivo. With larger NGD, NSA has less influence on FDI. The optimal sequence among the nine sequences tested with the shortest scan time was 25 NGD/1 NSA.
2010-07-01
... SERVICE OF PROCESS; RELEASE OF OFFICIAL INFORMATION IN LITIGATION; AND TESTIMONY BY NSA PERSONNEL AS... testimony of NSA personnel as witnesses. (c) NSA personnel. (or NSA person) Includes present and former civilian employees of NSA (including non-appropriated fund activity employees), and present and former...
32 CFR 93.2 - Purpose and applicability.
2010-07-01
... ACCEPTANCE OF SERVICE OF PROCESS; RELEASE OF OFFICIAL INFORMATION IN LITIGATION; AND TESTIMONY BY NSA... NSA). The procedures herein are also promulgated pursuant to the NSA's independent authority, under... procedures for service of process at NSA and for the release of official information in litigation by NSA...
Observed and simulated temperature dependence of the liquid water path of low clouds
Energy Technology Data Exchange (ETDEWEB)
Del Genio, A.D.; Wolf, A.B. [NASA Goddard Institute for Space Studies, New York, NY (United States)
1996-04-01
Data being acquired at the Atmospheric Radiation Measurement (ARM) Southern great Plains (SGP) Cloud and Radiation Testbed (CART) site can be used to examine the factors determining the temperature dependence of cloud optical thickness. We focus on cloud liquid water and physical thickness variations which can be derived from existing ARM measurements.
Dicty_cDB: Contig-U04229-1 [Dicty_cDB
Lifescience Database Archive (English)
Full Text Available 9 ) HAE00002983 Home-made, regular (lib1_ha) Histiona... 44 0.001 2 ( CK888692 ) SGP160684 Atlantic salmon Liver cDNA library...2 ( DE224908 ) Trifolium pratense DNA, clone:RCG16896. 42 4e-04 2 ( CK888010 ) SGP149211 Atlantic salmon Liver cDNA library...A for TCP1 protein. 46 6e-04 2 ( CK887535 ) SGP164401 Atlantic salmon Kidney cDNA library Sal... 44 6e-04 2 ...mo salar cDNA, mRNA sequence. 44 0.001 2 ( CK889382 ) SGP161400 Atlantic salmon Liver cDNA library Salm... 4... salmon Liver cDNA library Salm... 44 0.001 2 ( CK888710 ) SGP160704 Atlantic salmon Liver cDNA library
76 FR 3098 - Privacy Act of 1974; Systems of Records
2011-01-19
... requests and/or records have been referred to the National Security Agency/Central Security Service (NSA..., Department of Defense Privacy Program; NSA/CSS Policy 1-5; NSA/CSS Freedom of Information Act Program; NSA/CSS Policy 1-34; Implementation of the Privacy Act of 1974; NSA/CSS Policy 1-15, Mandatory...
Energy Technology Data Exchange (ETDEWEB)
Splitt, M.E. [Univ. of Oklahoma, Norman, OK (United States); Wesely, M.L. [Argonne National Lab., IL (United States)
1996-04-01
A systmatic evaluation of the performance of broadband radiometers at the Radiation Testbed (CART) site is needed to estimate the uncertainties of the irradiance observations. Here, net radiation observed with the net radiometer in the enrgy balance Bowen ratio station at the Central facility is compared with the net radiation computed as the sum of component irradiances recorded by nearby pyranameters and pyrgeometers. In addition, data obtained from the central facility pyranometers, pyrgeometers, and pyrheliometers are examined for April 1994, when intensive operations periods were being carried out. The data used in this study are from central facility radiometers in a solar and infrared observation station, and EBBR station, the so-called `BSRN` set of upward pointing radiometers, and a set of radiometers pointed down at the 25-m level of a 60-m tower.
Neuronal surface antigen antibodies in limbic encephalitis
Graus, F; Saiz, A; Lai, M; Bruna, J; López, F; Sabater, L; Blanco, Y; Rey, M J.; Ribalta, T; Dalmau, J
2008-01-01
Objective: To report the frequency and type of antibodies against neuronal surface antigens (NSA-ab) in limbic encephalitis (LE). Methods: Analysis of clinical features, neuropathologic findings, and detection of NSA-ab using immunochemistry on rat tissue and neuronal cultures in a series of 45 patients with paraneoplastic (23) or idiopathic (22) LE. Results: NSA-ab were identified in 29 patients (64%; 12 paraneoplastic, 17 idiopathic). Thirteen patients had voltage-gated potassium channels (VGKC)-ab, 11 novel NSA (nNSA)-ab, and 5 NMDA receptor (NMDAR)-ab. nNSA-ab did not identify a common antigen and were more frequent in paraneoplastic than idiopathic LE (39% vs 9%; p = 0.03). When compared with VGKC-ab or NMDAR-ab, the nNSA associated more frequently with intraneuronal antibodies (11% vs 73%; p = 0.001). Of 12 patients (9 nNSA-ab, 2 VGKC-ab, 1 NMDAR-ab) with paraneoplastic LE and NSA-ab, concomitant intraneuronal antibodies occurred in 9 (75%). None of these 12 patients improved with immunotherapy. The autopsy of three of them showed neuronal loss, microgliosis, and cytotoxic T cell infiltrates in the hippocampus and amygdala. These findings were compatible with a T-cell mediated neuronal damage. In contrast, 13 of 17 (76%) patients with idiopathic LE and NSA-ab (8 VGKC-ab, 4 NMDAR-ab, 1 nNSA-ab) and 1 of 5 (20%) without antibodies had clinical improvement (p = 0.04). Conclusions: In paraneoplastic limbic encephalitis (LE), novel antibodies against neuronal surface antigens (nNSA-ab) occur frequently, coexist with antibodies against intracellular antigens, and these cases are refractory to immunotherapy. In idiopathic LE, the likelihood of improvement is significantly higher in patients with NSA-ab than in those without antibodies. GLOSSARY GAD = glutamic acid decarboxylase; LE = limbic encephalitis; NMDAR = N-methyl-D-aspartate receptor; NSA = neuronal surface antigens; nNSA = novel NSA; SCLC = small-cell lung cancer; VGKC = voltage-gated potassium channels
Femoral neck-shaft angle and climate-induced body proportions.
Child, Stephanie L; Cowgill, Libby W
2017-12-01
Declination in femoral neck-shaft angle (NSA) is commonly linked to an increased level of physical activity during life. More recently, however, research suggests that lower NSA might also be explained, in part, as the mechanical consequence of differences in ecogeographic body proportions. This study tests the proposed link between NSA and climatic-induced body proportions, using relative body mass (RBM), throughout the course of development. NSA and RBM were collected for 445 immature remains from five geographic locations. NSA and RBM were standardized for age-effects. ANOVA was used to examine when population differences emerged in both NSA and RBM. Regression analyses were used to examine the pattern of relationship between NSA and RBM. Populations differ significantly in NSA and RBM before skeletal maturity, and these differences occur early in life. While both NSA and RBM change over the course of development, no significant relationship was found between NSA and RBM for any sample, or any age category (p = .244). Individuals who have relatively greater relative body mass do not necessarily have lower NSA. Population differences in NSA were found to be variable, while differences in RBM remained consistent across the developmental span. Taken together, these results suggest that regardless of body proportions, the degree of declination of NSA is presumed to be similar among individuals with similar gait and ambulatory behaviors. Conversely, populations differ in RBM from birth, and these differences are consistent throughout development. These two measures likely are responsive to diffing stimuli, and any potential relationship is likely complex and multifactorial. © 2017 Wiley Periodicals, Inc.
Reduction of non-specific adsorption of drugs to plastic containers used in bioassays or analyses.
Fukazawa, Tominaga; Yamazaki, Yuri; Miyamoto, Yohei
2010-01-01
Non-specific adsorption (NSA) of drugs to plastic or glass containers used in clinical use is well known, but methods for reducing NSA have been rarely reported. We assessed the NSA to various containers and then investigated methods to reduce NSA. Probe drugs (methotrexate, warfarin, chloroquine, propranolol, verapamil, digoxin and paclitaxel) dissolved in water were incubated in conventional or low-adsorption containers for 4h at 4 degrees C and the NSA was determined by HPLC. They were also dissolved in aqueous methanol or acetonitrile and the NSA to a conventional polypropylene microplate was determined. Finally, tissue culture microplates were coated with silane coupling agents and the effects of the coatings were evaluated. Hydrophobic drugs (paclitaxel, verapamil and digoxin) were highly adsorbed to conventional plastic microplates, but in addition to hydrophobic drugs, positively charged drugs were well adsorbed to the tissue culture microplate. Low-adsorption microplates could reduce NSA below 15%, but positively charged or neutral hydrophobic drugs showed relatively higher adsorption. Acetonitrile showed stronger NSA inhibition than that of methanol, but the peak shapes of methotrexate and chloroquine were broadened and split. Among the silane coupling agents, GPTMS suppressed the NSA below 10%. Also, AATMS resembled the NSA pattern of GPTMS, but it increased the adsorption of methotrexate to 29%. On conventional plastic microplates, NSA is mainly driven by hydrophobic interactions, but on tissue culture microplates and low-adsorption microplates, in addition to hydrophobic interactions, ionic interactions play a role in the NSA. Therefore, to reduce the NSA to plastic containers, both hydrophobic and ionic interactions should be reduced using amphiphilic organic solvents or neutral and hydrophilic coatings. 2010 Elsevier Inc. All rights reserved.
Southern Great Plains Safety Orientation
Energy Technology Data Exchange (ETDEWEB)
Schatz, John
2014-05-01
Welcome to the Atmospheric Radiation Measurement (ARM) Climate Research Facility (ARM) Southern Great Plains (SGP) site. This U.S. Department of Energy (DOE) site is managed by Argonne National Laboratory (ANL). It is very important that all visitors comply with all DOE and ANL safety requirements, as well as those of the Occupational Safety and Health Administration (OSHA), the National Fire Protection Association, and the U.S. Environmental Protection Agency, and with other requirements as applicable.
Update History of This Database - KAIKOcDNA | LSDB Archive [Life Science Database Archive metadata
Lifescience Database Archive (English)
Full Text Available switchLanguage; BLAST Search Image Search Home About Archive Update History Data ...List Contact us KAIKOcDNA Update History of This Database Date Update contents 2014/10/20 The URL of the dat... database ( http://sgp.dna.affrc.go.jp/EST/ ) is opened. About This Database Database Description Download License Update Hi...story of This Database Site Policy | Contact Us Update History of This Database - KAIKOcDNA | LSDB Archive ... ...abase maintenance site is changed. 2014/10/08 KAIKOcDNA English archive site is opened. 2004/04/12 KAIKOcDNA
Serum Golgi protein 73 is a prognostic rather than diagnostic marker in hepatocellular carcinoma.
Dong, Min; Chen, Zhan-Hong; Li, Xing; Li, Xiao-Yun; Wen, Jing-Yun; Lin, Qu; Ma, Xiao-Kun; Wei, Li; Chen, Jie; Ruan, Dan-Yun; Lin, Ze-Xiao; Wang, Tian-Tian; Wu, Dong-Hao; Wu, Xiang-Yuan
2017-11-01
Serum Golgi protein 73 (sGP73) is a candidate diagnostic biomarker for hepatocellular carcinoma (HCC). However, current evidence of its diagnostic value is conflicting, primarily due to the small sample sizes of previous studies, and its prognostic role in HCC also remains unclear. In the present study, sGP73 levels in 462 patients with HCC, 186 patients with liver cirrhosis, and 83 healthy controls were evaluated using ELISA, and it was identified that the median sGP73 levels were significantly higher in the HCC (18.7 ng/ml) and liver cirrhosis (18.5 ng/ml) patients than in the healthy controls (0 ng/ml; both P<0.001); however, the levels did not significantly differ between the HCC and liver cirrhosis groups (P=0.632). sGP73 had an inferior sensitivity and specificity for HCC diagnosis (27.79 and 77.96%, respectively) compared with α-fetoprotein (57.36 and 90.96%, respectively; P<0.001). In the HCC group, a high level of sGP73 was associated with aggressive clinicopathological features and independently predicted poor overall survival (OS) time (P<0.001). Additionally, in patients with resectable HCC, a high level of sGP73 was associated with significantly decreased disease-free survival (P<0.001) and OS (P=0.039) times compared with a low level of sGP73. This study demonstrated that sGP73 is unsuitable as a diagnostic marker for the early detection of HCC; however, it is an independent negative prognostic marker, providing a novel risk stratification factor and a potential therapeutic molecular target for HCC.
Land-Atmosphere Feedback Experiment (LAFE) Science Plan
Energy Technology Data Exchange (ETDEWEB)
Wulfmeyer, Volker [University of Hohenheim; Turner, David [NOAA National Severe Storms Laboratory
2016-07-01
The Land-Atmosphere Feedback Experiment (LAFE; pronounced “la-fey”) deploys several state-of-the-art scanning lidar and remote sensing systems to the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility’s Southern Great Plains (SGP) site. These instruments will augment the ARM instrument suite in order to collect a data set for studying feedback processes between the land surface and the atmosphere. The novel synergy of remote-sensing systems will be applied for simultaneous measurements of land-surface fluxes and horizontal and vertical transport processes in the atmospheric convective boundary layer (CBL). The impact of spatial inhomogeneities of the soil-vegetation continuum on land-surface-atmosphere (LSA) feedback will be studied using the scanning capability of the instrumentation. The time period of the observations is August 2017, because large differences in surface fluxes between different fields and bare soil can be observed, e.g., pastures versus fields where the wheat has already been harvested. The remote sensing system synergy will consist of three components: 1) The SGP water vapor and temperature Raman lidar (SRL), the SGP Doppler lidar (SDL), and the National Center for Atmospheric Research (NCAR) water vapor differential absorption lidar (DIAL) (NDIAL) mainly in vertical staring modes to measure mean profiles and gradients of moisture, temperature, and horizontal wind. They will also measure profiles of higher-order turbulent moments in the water vapor and wind fields and profiles of the latent heat flux. 2) A novel scanning lidar system synergy consisting of the National Oceanic and Atmospheric Administration (NOAA) High-Resolution Doppler lidar (HRDL), the University of Hohenheim (UHOH) water-vapor differential absorption lidar (UDIAL), and the UHOH temperature Raman lidar (URL). These systems will perform coordinated range-height indicator (RHI) scans from just above the canopy level to the
Based on graphene tunable dual-band terahertz metamaterial absorber with wide-angle
Huang, Mulin; Cheng, Yongzhi; Cheng, Zhengze; Chen, Haoran; Mao, Xuesong; Gong, Rongzhou
2018-05-01
We present a wide-angle tunable dual-band terahertz (THz) metamaterial absorber (MMA) based on square graphene patch (SGP). This MMA is a simple periodic array, consisting of a dielectric substrate sandwiched with the SGP and a continuous metallic film. The designed MMA can achieve dual-band absorption by exciting fundamental and second higher-order resonance modes on SGP. The numerical simulations indicate that the absorption spectrum of the designed MMA is tuned from 0.85 THz to 1.01 THz, and from 2.84 THz to 3.37 THz when the chemical potential of the SGP is increasing from 0.4eV to 0.8eV. Moreover, it operates well in a wide-angle of the incident waves. The presented THz MMA based on the SGP could find some potential applications in optoelectronic related devices, such as sensor, emitter and wavelength selective radiators.
75 FR 56079 - Privacy Act of 1974; System of Records
2010-09-15
.... Bryman, Alternate OSD Federal Register Liaison Officer, Department of Defense. GNSA 24 System name: NSA..., Classified National Security Information; and NSA/CSS Policy 1-30, Review of NSA/CSS Information for Public... entry and replace with ``The NSA/CSS rules for contesting contents and appealing initial determinations...
A Quick Negative Selection Algorithm for One-Class Classification in Big Data Era
Directory of Open Access Journals (Sweden)
Fangdong Zhu
2017-01-01
Full Text Available Negative selection algorithm (NSA is an important kind of the one-class classification model, but it is limited in the big data era due to its low efficiency. In this paper, we propose a new NSA based on Voronoi diagrams: VorNSA. The scheme of the detector generation process is changed from the traditional “Random-Discard” model to the “Computing-Designated” model by VorNSA. Furthermore, we present an immune detection process of VorNSA under Map/Reduce framework (VorNSA/MR to further reduce the time consumption on massive data in the testing stage. Theoretical analyses show that the time complexity of VorNSA decreases from the exponential level to the logarithmic level. Experiments are performed to compare the proposed technique with other NSAs and one-class classifiers. The results show that the time cost of the VorNSA is averagely decreased by 87.5% compared with traditional NSAs in UCI skin dataset.
Lee, Sarah Y.; Buhimschi, Irina A.; Dulay, Antonette T.; Ali, Unzila A.; Zhao, Guomao; Abdel-Razeq, Sonya S.; Bahtiyar, Mert O.; Thung, Stephen F.; Funai, Edmund F.; Buhimschi, Catalin S.
2013-01-01
Classic IL-6 signaling is conditioned by the transmembrane receptor (IL-6R) and homodimerization of gp130. During trans-signaling, IL-6 binds to soluble IL-6R (sIL-6R) enabling activation of cells expressing solely gp130. Soluble gp130 (sgp130) selectively inhibits IL-6 trans-signaling. To characterize amniotic fluid IL-6 trans-signaling molecules (IL-6, sIL-6R, sgp130) in normal gestations and pregnancies complicated by intra-amniotic inflammation (IAI) we studied 301 women during second trimester (n=39), third trimester (n=40) and preterm labor with intact (n=131, 85 IAI negative & 46 IAI positive) or preterm premature rupture of membranes (PPROM: n=91, 61 IAI negative & 30 IAI positive). ELISA, Western blotting and RT-PCR were used to investigate amniotic fluid, placenta and amniochorion for protein and mRNA expression of sIL-6R, sgp130, IL-6R and gp130. Tissues were immunostained for IL-6R, gp130, CD15+ (polymorphonuclear) and CD3+ (T-cell) inflammatory cells. The ability of sIL-6R and sgp130 to modulate basal and LPS-stimulated release of amniochorion matrix-metalloprotease-9 (MMP-9) was tested ex-vivo. We showed that in physiologic gestations amniotic fluid sgp130 decreases toward term. Amniotic fluid IL-6 and sIL-6R were elevated in IAI whereas sgp130 was decreased in PPROM. Our results suggested that fetal membranes are the probable source of amniotic fluid sIL-6R and sgp130. Immunohistochemistry and RT-PCR revealed increased IL-6R and decreased gp130 expression in amniochorion of women with IAI. Ex-vivo, sIL-6R and LPS augmented amniochorion MMP-9 release whereas sgp130 opposed this effect. We conclude that IL-6 trans-signaling molecules are physiologic constituents of the amniotic fluid regulated by gestational age and inflammation. PPROM likely involves functional loss of sgp130. PMID:21282511
Lee, Sarah Y; Buhimschi, Irina A; Dulay, Antonette T; Ali, Unzila A; Zhao, Guomao; Abdel-Razeq, Sonya S; Bahtiyar, Mert O; Thung, Stephen F; Funai, Edmund F; Buhimschi, Catalin S
2011-03-01
Classic IL-6 signaling is conditioned by the transmembrane receptor (IL-6R) and homodimerization of gp130. During trans-signaling, IL-6 binds to soluble IL-6R (sIL-6R), enabling activation of cells expressing solely gp130. Soluble gp130 (sgp130) selectively inhibits IL-6 trans-signaling. To characterize amniotic fluid (AF) IL-6 trans-signaling molecules (IL-6, sIL-6R, sgp130) in normal gestations and pregnancies complicated by intra-amniotic inflammation (IAI), we studied 301 women during second trimester (n = 39), third trimester (n = 40), and preterm labor with intact (n = 131, 85 negative IAI and 46 positive IAI) or preterm premature rupture of membranes (PPROM; n = 91, 61 negative IAI and 30 positive IAI). ELISA, Western blotting, and real-time RT-PCR were used to investigate AF, placenta, and amniochorion for protein and mRNA expression of sIL-6R, sgp130, IL-6R, and gp130. Tissues were immunostained for IL-6R, gp130, CD15(+) (polymorphonuclear), and CD3(+) (T cell) inflammatory cells. The ability of sIL-6R and sgp130 to modulate basal and LPS-stimulated release of amniochorion matrix metalloprotease-9 was tested ex vivo. We showed that in physiologic gestations, AF sgp130 decreases toward term. AF IL-6 and sIL-6R were increased in IAI, whereas sgp130 was decreased in PPROM. Our results suggested that fetal membranes are the probable source of AF sIL-6R and sgp130. Immunohistochemistry and RT-PCR revealed increased IL-6R and decreased gp130 expression in amniochorion of women with IAI. Ex vivo, sIL-6R and LPS augmented amniochorion matrix metalloprotease-9 release, whereas sgp130 opposed this effect. We conclude that IL-6 trans-signaling molecules are physiologic constituents of the AF regulated by gestational age and inflammation. PPROM likely involves functional loss of sgp130.
75 FR 36371 - Draft Environmental Impact Statement Addressing Campus Development at Fort Meade, MD
2010-06-25
...'s (NSA) continually evolving requirements and for Intelligence Community use. The purpose of the..., or e-mail [email protected]nsa.gov . SUPPLEMENTARY INFORMATION: Background: The NSA is a tenant DOD agency on Fort Meade. NSA is a high-technology organization that is on the frontier of communications and data...
46 CFR Sec. 2 - Voyage numbers.
2010-10-01
... voyage No. 1 having the prefixed designation NSA and followed by the General Agents' abbreviated designation and voyage number, as NSA-1/ABC-1. (b) The continuity of NSA voyage numbers shall not change with... General Agent shall affix his abbreviated designation and initial voyage numbers, as NSA-13/XYZ-1. ...
Energy Technology Data Exchange (ETDEWEB)
Melfi, S.H.; Starr, D.O`C.; Whiteman, D. [NASA Goddard Space Flight Center, Greenbelt, MD (United States)] [and others
1996-04-01
The first Atmospheric Radiation Measurement (ARM) remote Cloud Study (RCS) Intensive Operations Period (IOP) was held during April 1994 at the Southern Great Plains (SGP) site. This experiment was conducted to evaluate and calibrate state-of-the-art, ground based remote sensing instruments and to use the data acquired by these instruments to validate retrieval algorithms developed under the ARM program.
Energy Technology Data Exchange (ETDEWEB)
Mace, G.G.; Ackerman, T.P.; George, A.T. [Penn State Univ., University Park, PA (United States)
1996-04-01
The data from the Atmospheric Radiation Measurement (ARM) Program`s Southern Great plains Site (SCP) is a valuable resource. We have developed an operational data processing and analysis methodology that allows us to examine continuously the influence of clouds on the radiation field and to test new and existing cloud and radiation parameterizations.
Evaluation of a Mesoscale Convective System in Variable-Resolution CESM
Payne, A. E.; Jablonowski, C.
2017-12-01
Warm season precipitation over the Southern Great Plains (SGP) follows a well observed diurnal pattern of variability, peaking at night-time, due to the eastward propagation of mesoscale convection systems that develop over the eastern slopes of the Rockies in the late afternoon. While most climate models are unable to adequately capture the organization of convection and characteristic pattern of precipitation over this region, models with high enough resolution to explicitly resolve convection show improvement. However, high resolution simulations are computationally expensive and, in the case of regional climate models, are subject to boundary conditions. Newly developed variable resolution global climate models strike a balance between the benefits of high-resolution regional climate models and the large-scale dynamics of global climate models and low computational cost. Recently developed parameterizations that are insensitive to the model grid scale provide a way to improve model performance. Here, we present an evaluation of the newly available Cloud Layers Unified by Binormals (CLUBB) parameterization scheme in a suite of variable-resolution CESM simulations with resolutions ranging from 110 km to 7 km within a regionally refined region centered over the SGP Atmospheric Radiation Measurement (ARM) site. Simulations utilize the hindcast approach developed by the Department of Energy's Cloud-Associated Parameterizations Testbed (CAPT) for the assessment of climate models. We limit our evaluation to a single mesoscale convective system that passed over the region on May 24, 2008. The effects of grid-resolution on the timing and intensity of precipitation, as well as, on the transition from shallow to deep convection are assessed against ground-based observations from the SGP ARM site, satellite observations and ERA-Interim reanalysis.
Directory of Open Access Journals (Sweden)
Christoph Kolja Boese
2016-01-01
Full Text Available Background. The femoral neck-shaft angle (NSA is of high importance for the diagnostics and treatment of various conditions of the hip. However, rotational effects limit its precision and applicability using plain radiographs. This study introduces a novel method to measure the femoral NSA: the modified NSA (mNSA, possibly being less susceptible against rotational effects compared to the conventional NSA. Patients and Methods. The method of measurement is described and its applicability was tested in 400 pelvis computed tomography scans (800 hips. Age- and gender-dependent reference values are given and intra- and interrater reliability are analyzed. Results. The mean age of all 400 patients (800 hips was 54.32 years (18–100, SD 22.05 years. The mean mNSA was 147.0° and the 95% confidence interval was 146.7°–147.4°. Differences of the mNSA between sexes, age groups, and sides were nonsignificant. The absolute difference between NSA and mNSA was 16.3° (range 3–31°; SD 4.4°; the correlation was high (0.738; p<0.001. Overall, the intra- and interrater reliability were excellent for the mNSA. Interpretation. We introduced a novel concept for the analysis of the neck-shaft angle. The high reliability of the measurement has been proven and its robustness to hip rotation was demonstrated.
BOREAS TF-10 NSA-YJP Tower Flux, Meteorological, and Porometry Data
McCaughey, J. Harry; Liblik, Laura; Hall, Forrest G. (Editor); Huemmrich, K. (Editor)
2000-01-01
The BOREAS TF-10 team collected tower flux and meteorological data at two sites, a fen and a young jack pine forest, near Thompson, Manitoba, Canada, as part of BOREAS. A preliminary data set was assembled in August 1993 while field testing the instrument packages, and at both sites data were collected from 15-Aug to 31-Aug. The main experimental period was in 1994, when continuous data were collected from the young jack pine site from 23-May to 20-Sep. Upon examination of the 1994 data set, it became clear that the behavior of the heat, water, and carbon dioxide fluxes throughout the whole growing season was an important scientific question, and that the 1994 data record was not sufficiently long to capture the character of the seasonal behavior of the fluxes. Thus, the young jack pine site was operated from 08-May to 07-Nov in 1996 in order to collect data from spring melt to autumn freeze-up. All variables are presented as 30-minute averages. Supporting data were also collected to describe the surface#s state and to provide the information, in association with the flux data, to build SVAT models. For the young jack pine site, these supporting data included stomatal conductance measurements. The data are stored in tabular ASCII files.
47 CFR 27.1315 - Establishment, execution, and application of the network sharing agreement.
2010-10-01
... the NSA: (a) Approval of NSA as pre-condition for granting the Upper 700 MHz D Block License. The... Block license has negotiated the NSA and such other agreements as the Commission may require or allow with the Public Safety Broadband Licensee, and the NSA and related agreements or documents have been...
47 CFR 90.1415 - Establishment, execution, and application of the network sharing agreement.
2010-10-01
... the NSA: (a) Approval of NSA as pre-condition for granting the Upper 700 MHz D Block License. The Public Safety Broadband Licensee must negotiate an NSA and such other agreements as the Commission may require or allow with the winning bidder for the Upper 700 MHz D Block license. The NSA and related...
47 CFR 90.1425 - Resolution of disputes after grant of the upper 700 MHz D block license.
2010-10-01
... to the NSA has deviated from the terms of the NSA, or a petition for a declaratory ruling to resolve the proper interpretation of an NSA term or provision. The Commission also may at any time, on its own motion, determine to address any material breach or interpret any NSA term or provision. (b) The...
47 CFR 27.1325 - Resolution of disputes after grant of the upper 700 MHz D block license.
2010-10-01
... to the NSA has deviated from the terms of the NSA, or a petition for a declaratory ruling to resolve the proper interpretation of an NSA term or provision. The Commission also may at any time, on its own motion, determine to address any material breach or interpret any NSA term or provision. (b) The...
32 CFR 156.2 - Applicability and scope.
2010-07-01
... Agency (NSA) in paragraph (b) of this section (hereafter referred to collectively as “the DoD Components”). (b) The NSA is exempt from the provisions of this Directive. The personnel security program for the NSA is implemented pursuant to DoD Directive 5210.45, 3 and internal regulations of the NSA. 3 See...
46 CFR Sec. 2 - Authority for launch hire.
2010-10-01
..., only under the following circumstances: (a) When incurred by the Master of an NSA vessel, or by an agent of NSA or by his sub-agent, for the purpose of properly conducting the owners' activities and business of NSA vessels; (b) When incurred in transporting liberty parties to or from an NSA vessel with...
46 CFR 531.6 - NVOCC Service Arrangements.
2010-10-01
..., in the manner set forth in Appendix A of this part, a true and complete copy of every NSA or amendment before any cargo moves pursuant to that NSA or amendment. (b) Every NSA filed with the Commission shall include the complete terms of the NSA including, but not limited to, the following: (1) The origin...
Penultimate Glacial-Interglacial Climate Variability in the Southern Great Plains of North America
Bartow-Gillies, E.; Maupin, C. R.; Roark, E. B.; Chou, Y. C.; White, K.; Kampen-Lewis, S. V.; Shen, C. C.
2017-12-01
Projections of changes in rainfall under future warming scenarios vary in their sign and intensity over the Southern Great Plains (SGP). A scarcity of local paleoclimate information before the Last Glacial Maximum (LGM) limits our understanding of regional climate responses to changes in mean state and forcing. Here, we present absolutely U/Th-dated oxygen and carbon isotope records from a calcite stalagmite near Georgetown, Texas (30°N, 98°W), spanning 98 to 209 kyr before present (kyr BP). SGP moisture is primarily sourced from the Gulf of Mexico, and precipitation exhibits clear seasonality, with a biannual rainy season divided into late boreal spring and fall. We interpret the oxygen isotopic composition of the stalagmite to reflect changes in rainwater δ18O composition, as well as cave temperature, through time. There are no clear kinetic isotope effects observed within the stalagmite. More negative (positive) δ18O values are a reflection of warmer and wetter (cooler and drier) conditions based on modern observations of rainwater δ18O at the study site. Variations in stalagmite δ13C may be driven by shifts in overlying vegetation type and changes in the rates of karst flow and prior calcite precipitation. The stalagmite records include Marine Isotope Stage (MIS) 5e, an interval where global temperatures may have been as much as 2°C warmer and sea level 4-6 m higher than present. Thus, our δ18O record provides context of unique importance for how SGP hydroclimate may respond to future warming. Prominent features in the δ18O record, including a warm and wet MIS 5e appear to be paced by precession, with the timing of δ18O minima (maxima) broadly consistent with that of maxima (minima) in monthly insolation at 30°N. The δ13C record exhibits a striking similarity to canonical, sawtooth records of glacial-interglacial variability, which suggests Great Plains vegetation communities may be sensitive to the status of Northern Hemisphere glaciation. Our SGP
Retrievals and uncertainty analysis of aerosol single scattering albedo from MFRSR measurements
International Nuclear Information System (INIS)
Yin, Bangsheng; Min, Qilong; Joseph, Everette
2015-01-01
Aerosol single scattering albedo (SSA) can be retrieved from the ratio of diffuse horizontal and direct normal fluxes measured from multifilter rotating shadowband radiometer (MFRSR). In this study, the measurement channels at 415 nm and 870 nm are selected for aerosol optical depth (AOD) and Angstrom coefficient retrievals, and the measurements at 415 nm are used for aerosol SSA retrievals with the constraint of retrieved Angstrom coefficient. We extensively assessed various issues impacting on the accuracy of SSA retrieval from measurements to input parameters and assumptions. For cloud-free days with mean aerosol loading of 0.13–0.60, our sensitivity study indicated that: (1) 1% calibration uncertainty can result in 0.8–3.7% changes in retrieved SSA; (2) without considering the cosine respond correction and/or forward scattering correction will result in underestimation of 1.1–3.3% and/or 0.73% in retrieved SSA; (3) an overestimation of 0.1 in asymmetry factor can result in an underestimation of 2.54–3.4% in retrieved SSA; (4) for small aerosol loading (e.g., 0.13), the uncertainty associated with the choice of Rayleigh optical depth value can result in non-negligible change in retrieved SSA (e.g., 0.015); (5) an uncertainty of 0.05 for surface albedo can result in changes of 1.49–5.4% in retrieved SSA. We applied the retrieval algorithm to the MFRSR measurements at the Atmospheric Radiation Measurements (ARM) Southern Great Plains (SGP) site. The retrieved results of AOD, Angstrom coefficient, and SSA are basically consistent with other independent measurements from co-located instruments at the site. - Highlights: • Aerosol SSA is derived from MFRSR measured diffuse to direct normal irradiance ratio. • We extensively assessed various issues impacting on the accuracy of SSA retrieval. • The issues are mainly from measurements and model input parameters and assumptions. • We applied the retrieval algorithm to the MFRSR measurements at ARM SGP
75 FR 43494 - Privacy Act of 1974; System of Records
2010-07-26
... Register Liaison Officer, Department of Defense. GNSA 01 System name: NSA/CSS Access, Authority and Release... records are covered by GNSA 11, NSA/CSS Key Accountability Records, GNSA 10, NSA/CSS Personnel Security...
Nonlinear Saturation Amplitude in Classical Planar Richtmyer–Meshkov Instability
International Nuclear Information System (INIS)
Liu Wan-Hai; Jiang Hong-Bin; Ma Wen-Fang; Wang Xiang
2016-01-01
The classical planar Richtmyer–Meshkov instability (RMI) at a fluid interface supported by a constant pressure is investigated by a formal perturbation expansion up to the third order, and then according to definition of nonlinear saturation amplitude (NSA) in Rayleigh–Taylor instability (RTI), the NSA in planar RMI is obtained explicitly. It is found that the NSA in planar RMI is affected by the initial perturbation wavelength and the initial amplitude of the interface, while the effect of the initial amplitude of the interface on the NSA is less than that of the initial perturbation wavelength. Without marginal influence of the initial amplitude, the NSA increases linearly with wavelength. The NSA normalized by the wavelength in planar RMI is about 0.11, larger than that corresponding to RTI. (paper)
Optical Rain Gauge Instrument Handbook
Energy Technology Data Exchange (ETDEWEB)
Bartholomew, Mary Jane [Brookhaven National Lab. (BNL), Upton, NY (United States)
2016-04-01
To improve the quantitative description of precipitation processes in climate models, the U.S. Department of Energy (DOE)’s Atmospheric Radiation Measurement (ARM) Climate Research Facility deploys several types of rain gauges (MET, RAIN, and optical rain gauge [ORG] datastreams) as well as disdrometers (DISD and VDIS datastreams) at the Southern Great Plains (SGP) Site. This handbook deals specifically with the independent analog ORG (i.e., the ORG datastream).
Directory of Open Access Journals (Sweden)
Yan Xiaohong
2013-01-01
Full Text Available Abstract Background The fertile and sterile plants were derived from the self-pollinated offspring of the F1 hybrid between the novel restorer line NR1 and the Nsa CMS line in Brassica napus. To elucidate gene expression and regulation caused by the A and C subgenomes of B. napus, as well as the alien chromosome and cytoplasm from Sinapis arvensis during the development of young floral buds, we performed a genome-wide high-throughput transcriptomic sequencing for young floral buds of sterile and fertile plants. Results In this study, equal amounts of total RNAs taken from young floral buds of sterile and fertile plants were sequenced using the Illumina/Solexa platform. After filtered out low quality data, a total of 2,760,574 and 2,714,441 clean tags were remained in the two libraries, from which 242,163 (Ste and 253,507 (Fer distinct tags were obtained. All distinct sequencing tags were annotated using all possible CATG+17-nt sequences of the genome and transcriptome of Brassica rapa and those of Brassica oleracea as the reference sequences, respectively. In total, 3231 genes of B. rapa and 3371 genes of B. oleracea were detected with significant differential expression levels. GO and pathway-based analyses were performed to determine and further to understand the biological functions of those differentially expressed genes (DEGs. In addition, there were 1089 specially expressed unknown tags in Fer, which were neither mapped to B. oleracea nor to B. rapa, and these unique tags were presumed to arise basically from the added alien chromosome of S. arvensis. Fifteen genes were randomly selected and their expression levels were confirmed by quantitative RT-PCR, and fourteen of them showed consistent expression patterns with the digital gene expression (DGE data. Conclusions A number of genes were differentially expressed between the young floral buds of sterile and fertile plants. Some of these genes may be candidates for future research on CMS in
Yan, Xiaohong; Dong, Caihua; Yu, Jingyin; Liu, Wanghui; Jiang, Chenghong; Liu, Jia; Hu, Qiong; Fang, Xiaoping; Wei, Wenhui
2013-01-16
The fertile and sterile plants were derived from the self-pollinated offspring of the F1 hybrid between the novel restorer line NR1 and the Nsa CMS line in Brassica napus. To elucidate gene expression and regulation caused by the A and C subgenomes of B. napus, as well as the alien chromosome and cytoplasm from Sinapis arvensis during the development of young floral buds, we performed a genome-wide high-throughput transcriptomic sequencing for young floral buds of sterile and fertile plants. In this study, equal amounts of total RNAs taken from young floral buds of sterile and fertile plants were sequenced using the Illumina/Solexa platform. After filtered out low quality data, a total of 2,760,574 and 2,714,441 clean tags were remained in the two libraries, from which 242,163 (Ste) and 253,507 (Fer) distinct tags were obtained. All distinct sequencing tags were annotated using all possible CATG+17-nt sequences of the genome and transcriptome of Brassica rapa and those of Brassica oleracea as the reference sequences, respectively. In total, 3231 genes of B. rapa and 3371 genes of B. oleracea were detected with significant differential expression levels. GO and pathway-based analyses were performed to determine and further to understand the biological functions of those differentially expressed genes (DEGs). In addition, there were 1089 specially expressed unknown tags in Fer, which were neither mapped to B. oleracea nor to B. rapa, and these unique tags were presumed to arise basically from the added alien chromosome of S. arvensis. Fifteen genes were randomly selected and their expression levels were confirmed by quantitative RT-PCR, and fourteen of them showed consistent expression patterns with the digital gene expression (DGE) data. A number of genes were differentially expressed between the young floral buds of sterile and fertile plants. Some of these genes may be candidates for future research on CMS in Nsa line, fertility restoration and improved agronomic
VLBI2010 in NASA's Space Geodesy Project
Ma, Chopo
2012-01-01
In the summer of 20 11 NASA approved the proposal for the Space Geodesy Project (SGP). A major element is developing at the Goddard Geophysical and Astronomical Observatory a prototype of the next generation of integrated stations with co-located VLBI, SLR, GNSS and DORIS instruments as well as a system for monitoring the vector ties. VLBI2010 is a key component of the integrated station. The objectives ofSGP, the role of VLBI20 lOin the context of SGP, near term plans and possible future scenarios will be discussed.
Meszka-Jordan, Anna; Mahlapuu, Riina; Soomets, Ursel; Carlson, Gary P
2009-01-01
Styrene produces lung and liver damage that may be related to oxidative stress. The purpose of this study was to investigate the toxicity of (R)-styrene oxide (R-SO), the more active enantiomeric metabolite of styrene, and the protective properties of the antioxidants glutathione (GSH), N-acetylcysteine (NAC), and 4-methoxy-L-tyrosinyl-gamma-L-glutamyl-L-cysteinyl-glycine (UPF1) against R-SO-induced toxicity in non-Swiss Albino (NSA) mice. UPF1 is a synthetic GSH analog that was shown to have 60 times the ability to scavenge reactive oxygen species (ROS) in comparison to GSH. R-SO toxicity to the lung was measured by elevations in the activity of lactate dehydrogenase (LDH), protein concentration, and number of cells in bronchoalveolar lavage fluid (BALF). Toxicity to the liver was measured by increases in serum sorbitol dehydrogenase (SDH) activity. Antioxidants were not able to decrease the adverse effects of R-SO on lung. However, NAC (200 mg/kg) ip and GSH (600 mg/kg), administered orally prior to R-SO (300 mg/kg) ip, showed significant protection against liver toxicity as measured by SDH activity. Unexpectedly, a synthetic GSH analog, UPF1 (0.8 mg/kg), administered intravenously (iv) prior to R-SO, produced a synergistic effect with regard to liver and lung toxicity. Treatment with UPF1 (0.8 mg/kg) iv every other day for 1 wk for preconditioning prior to R-SO ip did not result in any protection against liver and lung toxicity, but rather enhanced the toxicity when administered prior R-SO. The results of the present study demonstrated protection against R-SO toxicity in liver but not lung by the administration of the antioxidants NAC and GSH.
Moss and soil contributions to the annual net carbon flux of a maturing boreal forest
Harden, J.W.; O'Neill, K. P.; Trumbore, S.E.; Veldhuis, H.; Stocks, B.J.
1997-01-01
We used input and decomposition data from 14C studies of soils to determine rates of vertical accumulation of moss combined with carbon storage inventories on a sequence of burns to model how carbon accumulates in soils and moss after a stand-killing fire. We used soil drainage - moss associations and soil drainage maps of the old black spruce (OBS) site at the BOREAS northern study area (NSA) to areally weight the contributions of each moderately well drained, feathermoss areas; poorly drained sphagnum - feathermoss areas; and very poorly drained brown moss areas to the carbon storage and flux at the OBS NSA site. On this very old (117 years) complex of black spruce, sphagnum bog veneer, and fen systems we conclude that these systems are likely sequestering 0.01-0.03 kg C m-2 yr-' at OBS-NSA today. Soil drainage in boreal forests near Thompson, Manitoba, controls carbon storage and flux by controlling moss input and decomposition rates and by controlling through fire the amount and quality of carbon left after burning. On poorly drained soils rich in sphagnum moss, net accumulation and long-term storage of carbon is higher than on better drained soils colonized by feathermosses. The carbon flux of these contrasting ecosystems is best characterized by soil drainage class and stand age, where stands recently burned are net sources of CO2, and maturing stands become increasingly stronger sinks of atmospheric CO2. This approach to measuring carbon storage and flux presents a method of scaling to larger areas using soil drainage, moss cover, and stand age information.
Directory of Open Access Journals (Sweden)
Sumin Kim
2017-01-01
Full Text Available As highly productive perennial grasses are evaluated as bioenergy feedstocks, a major consideration is biomass yield stability. Two experiments were conducted to examine some aspects of yield stability for two biofuel species: switchgrass (Panicum vigratum L. and Miscanthus x giganteus (Mxg. Biomass yields of these species were evaluated under various environmental conditions across the Southern Great Plains (SGP, including some sites with low soil fertility. In the first experiment, measured yields of four switchgrass ecotypes and Mxg varied among locations. Overall, plants showed optimal growth performance in study sites close to their geographical origins. Lowland switchgrass ecotypes and Mxg yields simulated by the ALMANAC model showed reasonable agreement with the measured yields across all study locations, while the simulated yields of upland switchgrass ecotypes were overestimated in northern locations. In the second experiment, examination of different N fertilizer rates revealed switchgrass yield increases over the range of 0, 80, or 160 kg N ha−1 year−1, while Mxg only showed yield increases between the low and medium N rates. This provides useful insights to crop management of two biofuel species and to enhance the predictive accuracy of process-based models, which are critical for developing bioenergy market systems in the SGP.
77 FR 56625 - Privacy Act of 1974; Systems of Records
2012-09-13
... a System of Records. SUMMARY: The National Security Agency (NSA) is proposing to amend a system of..., Alternate OSD Federal Register Liaison Officer, Department of Defense. GNSA 25 System Name: NSA/CSS Travel... ``Primary location: National Security Agency/Central Security Service (NSA/CSS), 9800 Savage Road, Ft...
75 FR 65457 - Privacy Act of 1974; System of Records
2010-10-25
... number.'' CONTESTING RECORD PROCEDURES: Delete entry and replace with ``The NSA/CSS rules for contesting...' published at the beginning of the NSA/CSS's compilation of record systems also apply to this record system... number. CONTESTING RECORD PROCEDURES: The NSA/CSS rules for contesting contents and appealing initial...
75 FR 36642 - Privacy Act of 1974; System of Records
2010-06-28
... Defense. GNSA 11 System name: NSA/CSS Key Accountability Records System location: National Security Agency... system: NSA/CSS civilian employees, personnel under contract or appointment and military assignees... `Blanket Routine Uses' set forth at the beginning of the NSA/CSS' compilation of systems of records notices...
78 FR 45913 - Privacy Act of 1974; Systems of Records
2013-07-30
... at http://dpclo.defense.gov/privacy/SORNs/component/nsa/index.html . The proposed system report, as... Register Liaison Officer, Department of Defense. GNSA 14 System Name: NSA/CSS Library Patron File Control....'' Categories of individuals covered by the system: Delete entry and replace with ``NSA civilian employees...
2010-10-01
... REPAIRS UNDER NATIONAL SHIPPING AUTHORITY MASTER LUMP SUM REPAIR CONTRACT-NSA-LUMPSUMREP Sec. 10 Bonds. (a... awarded work and the furnishing of the performance and payment bonds required by Article 14 of the NSA... of the NSA-LUMPSUMREP Contract, the standard form of individual performance bond (Standard Form 25...
77 FR 15360 - Privacy Act of 1974; Systems of Records
2012-03-15
... a System of Records. SUMMARY: The National Security Agency (NSA) is amending a system of records... Officer, Department of Defense. GNSA 06 System Name: NSA/CSS Health, Medical and Safety Files (February 10... of the NSA/CSS compilation of system of records notices apply to this system.'' * * * * * Storage...
76 FR 22614 - Privacy Act; Implementation
2011-04-22
... rule. SUMMARY: The National Security Agency/Central Security Services (NSA/ CSS) is adding an exemption rule for the system of records GNSA 23, ``NSA/CSS Operations Security Support Program and Training... read as follows: Sec. 322.7 Exempt systems of records. * * * * * (r) GNSA 23. (1) System name: NSA/CSS...
32 CFR 299.4 - Responsibilities.
2010-07-01
... INFORMATION ACT PROGRAM NATIONAL SECURITY AGENCY/CENTRAL SECURITY SERVICE (NSA/CSS) FREEDOM OF INFORMATION ACT... with NSA); (2) Receiving and handling all checks or money orders remitted in payment for FOIA requests... the requester upon being notified of such overpayment by the FOIA office. (d) The Deputy Director, NSA...
The effect of hip positioning on the projected femoral neck-shaft angle: a modeling study.
Bhashyam, Abhiram R; Rodriguez, Edward K; Appleton, Paul; Wixted, John J
2018-04-03
The femoral neck-shaft angle (NSA) is used to restore normal hip geometry during hip fracture repair. Femoral rotation is known to affect NSA measurement, but the effect of hip flexion-extension is unknown. The goals of this study were to determine and test mathematical models of the relationship between hip flexion-extension, femoral rotation and NSA. We hypothesized that hip flexion-extension and femoral rotation would result in NSA measurement error. Two mathematical models were developed to predict NSA in varying degrees of hip flexion-extension and femoral rotation. The predictions of the equations were tested in vitro using a model that varied hip flexion-extension while keeping rotation constant, and vice versa. The NSA was measured from an AP radiograph obtained with a C-arm. Attributable measurement error based on hip positioning was calculated from the models. The predictions of the model correlated well with the experimental data (correlation coefficient = 0.82 - 0.90). A wide range of patient positioning was found to result in less than 5-10 degree error in the measurement of NSA. Hip flexion-extension and femoral rotation had a synergistic effect in measurement error of the NSA. Measurement error was minimized when hip flexion-extension was within 10 degrees of neutral. This study demonstrates that hip flexion-extension and femoral rotation significantly affect the measurement of the NSA. To avoid inadvertently fixing the proximal femur in varus or valgus, the hip should be positioned within 10 degrees of neutral flexion-extension with respect to the C-arm to minimize positional measurement error. N/A, basic science study.
2010-07-01
... SERVICE OF PROCESS; RELEASE OF OFFICIAL INFORMATION IN LITIGATION; AND TESTIMONY BY NSA PERSONNEL AS WITNESSES § 93.5 Procedures. (a) Release of official information in litigation. NSA personnel shall not..., but a record of such approval will be made and retained in the OGC. NSA personnel shall not provide...
32 CFR 93.7 - Responsibilities.
2010-07-01
... ACCEPTANCE OF SERVICE OF PROCESS; RELEASE OF OFFICIAL INFORMATION IN LITIGATION; AND TESTIMONY BY NSA... overseeing NSA compliance with § 93.1(a) and this part 93, and for consulting with DoJ when appropriate. In response to a litigation demand requesting official information or the testimony of NSA personnel as...
32 CFR 299.7 - Exempt records.
2010-07-01
... INFORMATION ACT PROGRAM NATIONAL SECURITY AGENCY/CENTRAL SECURITY SERVICE (NSA/CSS) FREEDOM OF INFORMATION ACT... NSA/CSS to withhold information in whole or in part from public disclosure when there is a sound legal... source, including a source within NSA/CSS, state, local, or foreign agency or authority, or any private...
75 FR 74019 - Privacy Act of 1974; System of Records
2010-11-30
...-source data; and other published information on individuals and events of interest to NSA/CSS; actual or... and replace with ``Intelligence Reports: Permanent, transfer to the NSA/CSS Records Center when 5.... Intelligence Products: Permanent, transfer to the NSA/CSS Records Center when 5 years old and transfer to the...
Energy Technology Data Exchange (ETDEWEB)
Coulter, R. L.; Gao, W.; Lesht, B. M.
2000-04-04
Measurements at the central facility of the Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) are intended to verify, improve, and develop parameterizations in radiative flux models that are subsequently used in General Circulation Models (GCMs). The reliability of this approach depends upon the representativeness of the local measurements at the central facility for the site as a whole or on how these measurements can be interpreted so as to accurately represent increasingly large scales. The variation of surface energy budget terms over the SGP CART site is extremely large. Surface layer measurements of the sensible heat flux (H) often vary by a factor of 2 or more at the CART site (Coulter et al. 1996). The Planetary Boundary Layer (PBL) effectively integrates the local inputs across large scales; because the mixed layer height (h) is principally driven by H, it can, in principal, be used for estimates of surface heat flux over scales on the order of tens of kilometers. By combining measurements of h from radiosondes or radar wind profiles with a one-dimensional model of mixed layer height, they are investigating the ability of diagnosing large-scale heat fluxes. The authors have developed a procedure using the model described by Boers et al. (1984) to investigate the effect of changes in surface sensible heat flux on the mixed layer height. The objective of the study is to invert the sense of the model.
Femoral Neck Shaft Angle in Men with Fragility Fractures
Directory of Open Access Journals (Sweden)
S. P. Tuck
2011-01-01
Full Text Available Introduction. Femoral neck shaft angle (NSA has been reported to be an independent predictor of hip fracture risk in men. We aimed to assess the role of NSA in UK men. Methods. The NSA was measured manually from the DXA scan printout in men with hip (62, 31 femoral neck and 31 trochanteric, symptomatic vertebral (91, and distal forearm (67 fractures and 389 age-matched control subjects. Age, height, weight, and BMD (g/cm2: lumbar spine, femoral neck, and total femur measurements were performed. Results. There was no significant difference in mean NSA between men with femoral neck and trochanteric hip fractures, so all further analyses of hip fractures utilised the combined data. There was no difference in NSA between those with hip fractures and those without (either using the combined data or analysing trochanteric and femoral neck shaft fractures separately, nor between fracture subjects as a whole and controls. Mean NSA was smaller in those with vertebral fractures (129.2° versus 131°: P=0.001, but larger in those with distal forearm fractures (129.8° versus 128.5°: P=0.01. Conclusions. The conflicting results suggest that femoral NSA is not an important determinant of hip fracture risk in UK men.
Felician ALECU
2013-01-01
These days we are in the middle of a huge scandal about NSA fighting against terrorism by running a massive surveillance program. Mister Eduard Snowden, a former NSA employee, revealed classified documents that clearly show how NSA is targeting the communications of everyone by collecting, storing and filtering the data in various ways.
2010-07-01
... SERVICE OF PROCESS; RELEASE OF OFFICIAL INFORMATION IN LITIGATION; AND TESTIMONY BY NSA PERSONNEL AS WITNESSES § 93.6 Fees. Consistent with the guidelines in § 93.1(e), NSA may charge reasonable fees to... providing such information, and may include: (a) The costs of time expended by NSA employees to process and...
46 CFR Sec. 3 - Preparation of invoices.
2010-10-01
... NSA ORDER NO. 47 Sec. 3 Preparation of invoices. (a) Pursuant to Article 4 of the Service Agreement... under the applicable provisions of NSA Order No. 47. (1) Invoices shall be prepared so as to show... provisions of NSA Order No. 47 due the undersigned General Agent for the month of _____ under Service...
77 FR 56628 - Privacy Act of 1974; System of Records
2012-09-13
.../Central Security Service (NSA/CSS), Freedom of Information Act and Privacy Act Office, 9800 Savage Road... Agencies of Government who wrote to NSA on behalf of the constituent and who use it to respond to the.... The DoD Blanket Routine Uses published at the beginning of the NSA/ CSS's compilation of record...
Remote sensing of PM2.5 during cloudy and nighttime periods using ceilometer backscatter
Li, Siwei; Joseph, Everette; Min, Qilong; Yin, Bangsheng; Sakai, Ricardo; Payne, Megan K.
2017-06-01
Monitoring PM2.5 (particulate matter with aerodynamic diameter d ≤ 2.5 µm) mass concentration has become of more importance recently because of the negative impacts of fine particles on human health. However, monitoring PM2.5 during cloudy and nighttime periods is difficult since nearly all the passive instruments used for aerosol remote sensing are not able to measure aerosol optical depth (AOD) under either cloudy or nighttime conditions. In this study, an empirical model based on the regression between PM2.5 and the near-surface backscatter measured by ceilometers was developed and tested using 6 years of data (2006 to 2011) from the Howard University Beltsville Campus (HUBC) site. The empirical model can explain ˜ 56, ˜ 34 and ˜ 42 % of the variability in the hourly average PM2.5 during daytime clear, daytime cloudy and nighttime periods, respectively. Meteorological conditions and seasons were found to influence the relationship between PM2.5 mass concentration and the surface backscatter. Overall the model can explain ˜ 48 % of the variability in the hourly average PM2.5 at the HUBC site when considering the seasonal variation. The model also was tested using 4 years of data (2012 to 2015) from the Atmospheric Radiation Measurement (ARM) Southern Great Plains (SGP) site, which was geographically and climatologically different from the HUBC site. The results show that the empirical model can explain ˜ 66 and ˜ 82 % of the variability in the daily average PM2.5 at the ARM SGP site and HUBC site, respectively. The findings of this study illustrate the strong need for ceilometer data in air quality monitoring under cloudy and nighttime conditions. Since ceilometers are used broadly over the world, they may provide an important supplemental source of information of aerosols to determine surface PM2.5 concentrations.
On fracture in finite strain gradient plasticity
DEFF Research Database (Denmark)
Martínez Pañeda, Emilio; Niordson, Christian Frithiof
2016-01-01
In this work a general framework for damage and fracture assessment including the effect of strain gradients is provided. Both mechanism-based and phenomenological strain gradient plasticity (SGP) theories are implemented numerically using finite deformation theory and crack tip fields are invest......In this work a general framework for damage and fracture assessment including the effect of strain gradients is provided. Both mechanism-based and phenomenological strain gradient plasticity (SGP) theories are implemented numerically using finite deformation theory and crack tip fields...... are investigated. Differences and similarities between the two approaches within continuum SGP modeling are highlighted and discussed. Local strain hardening promoted by geometrically necessary dislocations (GNDs) in the vicinity of the crack leads to much higher stresses, relative to classical plasticity...... in the multiple parameter version of the phenomenological SGP theory. Since this also dominates the mechanics of indentation testing, results suggest that length parameters characteristic of mode I fracture should be inferred from nanoindentation....
Creation of a high-amylose durum wheat through mutagenesis of starch synthase II (SSIIa)
In cereal seeds mutations in one or more starch synthases lead to decreased amylopectin and increased amylose content. Here, the impact of starch synthase IIa (SSIIa or SGP-1) mutations upon durum starch was investigated. A screen of durum accessions identified two lines lacking SGP-A1, the A geno...
Space Geodesy Project Information and Configuration Management Procedure
Merkowitz, Stephen M.
2016-01-01
This plan defines the Space Geodesy Project (SGP) policies, procedures, and requirements for Information and Configuration Management (CM). This procedure describes a process that is intended to ensure that all proposed and approved technical and programmatic baselines and changes to the SGP hardware, software, support systems, and equipment are documented.
Carroll, T. R.; Cline, D. W.; Olheiser, C. M.; Rost, A. A.; Nilsson, A. O.; Fall, G. M.; Li, L.; Bovitz, C. T.
2005-12-01
. The NOHRSC NSA products are used operationally by NOAA's National Weather Service field offices when issuing hydrologic forecasts and warnings including river and flood forecasts, water supply forecasts, and spring flood outlooks for the nation. Additionally, the NOHRSC NSA products are used by a wide variety of federal, state, local, municipal, private-sector, and general-public end-users with a requirement for real-time snowpack information. The paper discusses, in detail, the techniques and procedures used to create the NOHRSC NSA products and gives a number of examples of the real-time snow products generated and distributed over the NOHRSC web site (www.nohrsc.noaa.gov). Also discussed are major limitations of the approach, the most notable being deficiencies in observation of snow water equivalent. Snow observation networks generally lack the consistency and coverage needed to significantly improve confidence in snow model states through updating. Many regions of the world simply lack snow water equivalent observations altogether, a significant constraint on global application of the NSA approach.
Energy Technology Data Exchange (ETDEWEB)
Knobelspiesse, Kirk D.; Cairns, Brian; Schmid, Beat; Roman, Miguel O.; Schaaf, Crystal B.
2008-10-21
The surface spectral albedo is an important component of climate models since it determines the amount of incident solar radiation that is absorbed by the ground. The albedo can be highly heterogeneous, both in space and time, and thus adequate measurement and modeling is challenging. One source of measurements that constrain the surface albedo are satellite instruments that observe the Earth, such as the Moderate Resolution Imaging Spectroradiometer (MODIS). Satellites estimate the surface bidirectional reflectance distribution function (BRDF) by correcting top of the atmosphere (TOA) radiances for atmospheric effects and accumulating observations at a variety of viewing geometries. The BRDF can then be used to determine the albedo that is required in climate modeling. Other measurements that provide a more direct constraint on surface albedo are those made by upward and downward looking radiometers at the ground. One product in particular, the Best Estimate Radiation Flux (BEFLUX) value added product of the Department of Energy’s Atmospheric Radiation Measurement (ARM) Program at the Southern Great Plains Central Facility (SGP CF) in central Oklahoma, has been used to evaluate the quality of the albedo products derived from MODIS BRDF estimates. These comparisons have highlighted discrepancies between the energy absorbed at the surface that is calculated from the BEFLUX products and that is predicted from the MODIS BRDF product. This paper attempts to investigate these discrepancies by using data from an airborne scanning radiometer, the Research Scanning Polarimeter (RSP) that was flown at low altitude in the vicinity of the SGP CF site during the Aerosol Lidar Validation Experiment (ALIVE) in September of 2005. The RSP is a polarimeter that scans in the direction of the aircraft ground track, and can thus estimate the BRDF in a period of seconds, rather than the days required by MODIS to accumulate enough viewing angles. Atmospheric correction is aided by the
Zhang, Y.; Klein, S. A.
2009-12-01
11 years of summertime observations at the Atmospheric Radiation Measurement (ARM) Climate Research Facility Southern Great Plains (SGP) site are used to investigate mechanisms controlling the transition from shallow to deep convection over land. A more humid environment above the boundary layer favors the occurrence of late-afternoon heavy precipitation events. The higher moisture content is brought by wind from south. Greater boundary layer inhomogeneity in moist static energy (MSE) is correlated to larger rain rates at the initial stage of precipitation. MSE inhomogeneity is attributed to both moisture and temperature fields, and is correlated with westerly winds. In an examination of afternoon rain statistics, higher relative humidity above the boundary layer is correlated to an earlier onset and longer duration of precipitation, while greater boundary layer inhomogeneity and atmospheric instability are positively correlated to the total rain amount and the maximum rain rate. On balance, these observations favor theories for the transition that involve a moist free troposphere and boundary layer heterogeneity in preference to those that involve convective available potential energy or convective inhibition. Thus the evidence presented here supports the current emphasis in the modeling community on the entraining nature of convection and the role of boundary layer cold pools in triggering new convection.
Energy Technology Data Exchange (ETDEWEB)
Fu, Qiang [Univ. of Washington, Seattle, WA (United States). Dept. of Atmospheric Sciences; Comstock, Jennifer [Univ. of Washington, Seattle, WA (United States). Dept. of Atmospheric Sciences
2018-01-29
The overall objective of this ASR funded project is to investigate the role of cloud radiative effects, especially those associated with tropical thin cirrus clouds in the tropical tropopause layer, by analyzing the ARM observations combined with numerical models. In particular, we have processed and analyzed the observations from the Raman lidar at the ARM SGP and TWP sites. In the tenure of the project (8/15/2013 – 8/14/2016 and with a no-cost extension to 8/14/2017), we have been concentrating on (i) developing an automated feature detection scheme of clouds and aerosols for the ARM Raman lidar; (ii) developing an automated retrieval of cloud and aerosol extinctions for the ARM Raman lidar; (iii) investigating cloud radiative effects based on the observations on the simulated temperatures in the tropical tropopause layer using a radiative-convective model; and (iv) examining the effect of changes of atmospheric composition on the tropical lower-stratospheric temperatures. In addition, we have examined the biases in the CALIPSO-inferred aerosol direct radiative effects using ground-based Raman lidars at the ARM SGP and TWP sites, and estimated the impact of lidar detection sensitivity on assessing global aerosol direct radiative effects. We have also investigated the diurnal cycle of clouds and precipitation at the ARM site using the cloud radar observations along with simulations from the multiscale modeling framework. The main results of our research efforts are reported in the six referred journal publications that acknowledge the DOE Grant DE-SC0010557.
Methods of reducing non-specific adsorption in microfluidic biosensors
International Nuclear Information System (INIS)
Choi, Seokheun; Chae, Junseok
2010-01-01
Non-specific adsorption (NSA) of biomolecules is a persistent challenge in microfluidic biosensors. Microfluidic biosensors often have immobilized bioreceptors such as antibodies, enzymes, DNAs, etc, via linker molecules such as SAMs (self-assembled monolayers) to enhance immobilization. However, the linker molecules are very susceptible to NSA, causing false responses and decreasing sensitivity. In this paper, we present design methods to reduce the NSA of alkanethiol SAMs, which are popular linker molecules on microfluidic biosensors. Three design parameters were studied for two different chain-length SAMs (n = 2 and 10): (i) SAM incubation time, (ii) surface roughness [0.8 nm and 4.4 nm RMS (root mean square)] and (iii) gold crystal re-growth along (1 1 1) the target orientation. NSA was monitored by surface plasmon resonance (SPR). The results suggest that increased SAM incubation time reduces NSA, and that short-chain SAMs respond more favorably than the long-chain SAMs. Both SAMs were shown to be sensitive to surface roughness, and long-chain SAMs reduced NSA by 75%. Gold crystal re-growth along (1 1 1) the target orientation profoundly reduced NSA on the short-chain SAM. On a gold surface where surface roughness was 0.8 nm and there was strong directional alignment along the (1 1 1) gold crystal, final concentrations of nonspecifically bound proteins were 0.05 ng mm −2 (fibrinogen) and 0.075 ng mm −2 (lysozyme)—significantly lower than other known methods. The results show that optimizing three parameters (SAM incubation time, gold surface roughness and gold crystal orientation) improved SAM sensitivity for fibrinogen–anti-fibrinogen conjugates by a factor of 5 in 2.94 pM, suggesting that the methods are effective for reducing NSA in microfluidic biosensors.
International Nuclear Information System (INIS)
Liu, Wanhai; Yu, Changping; Li, Xinliang
2014-01-01
Nonlinear saturation amplitudes (NSAs) of the first two harmonics in classical Rayleigh-Taylor instability (RTI) in cylindrical geometry for arbitrary Atwood numbers have been analytically investigated considering nonlinear corrections up to the fourth-order. The NSA of the fundamental mode is defined as the linear (purely exponential) growth amplitude of the fundamental mode at the saturation time when the growth of the fundamental mode (first harmonic) is reduced by 10% in comparison to its corresponding linear growth, and the NSA of the second harmonic can be obtained in the same way. The analytic results indicate that the effects of the initial radius of the interface (r 0 ) and the Atwood number (A) play an important role in the NSAs of the first two harmonics in cylindrical RTI. On the one hand, the NSA of the fundamental mode first increases slightly and then decreases quickly with increasing A. For given A, the smaller the r 0 /λ (with λ perturbation wavelength) is, the larger the NSA of the fundamental mode is. When r 0 /λ is large enough (r 0 ≫λ), the NSA of the fundamental mode is reduced to the prediction of previous literatures within the framework of third-order perturbation theory [J. W. Jacobs and I. Catton, J. Fluid Mech. 187, 329 (1988); S. W. Haan, Phys. Fluids B 3, 2349 (1991)]. On the other hand, the NSA of the second harmonic first decreases quickly with increasing A, reaching a minimum, and then increases slowly. Furthermore, the r 0 can reduce the NSA of the second harmonic for arbitrary A at r 0 ≲2λ while increase it for A ≲ 0.6 at r 0 ≳2λ. Thus, it should be included in applications where the NSA has a role, such as inertial confinement fusion ignition target design
International Nuclear Information System (INIS)
Dixon, Earle C.; Peterson, Kathleen
2003-01-01
The U. S. Department of Energy's (DOE) National Nuclear Security Administration Nevada Operations Office (NNSA/NV) Environmental Management (EM) Underground Test Area (UGTA) project addresses the characterization and needs for long-term monitoring of the subsurface contamination resulting from 828 underground nuclear weapon tests at the Nevada Test Site (NTS). EM promotes, and is required, to include stakeholders in its program. However, UGTA is a very complex program not easily understood by members of the public. The NTS Community Advisory Board (CAB), a federally chartered Site Specific Advisory Board (SSAB), has studied the UGTA project since 1996, and has found it a challenge to completely comprehend and provide NNSA/NV meaningful citizen input. The CAB realized the benefit of a technical peer review and in 2000 recommended to NNSA/NV that a peer review of the UGTA strategy would provide valuable feedback to the program to address underground contamination at the NTS. N NSA agreed to the CAB's recommendation, and moved forward with a scope of work to have the American Society of Mechanical Engineers (ASME) perform the peer review of the UGTA strategy. The ASME began the peer review in June 2001, and their final report was published in November 2001. In January 2002, the CAB devoted their monthly meeting in Las Vegas, Nevada to reporting the results of the peer review of the UGTA strategy to the public. Two public workshops were later held in the community of Amargosa, Nevada during the month of January to help educate and build interest in the CAB February 2002 monthly meeting which was also held in Amargosa. The CAB recommendation to NNSA to utilize a technical peer review has provided valuable information to NNSA, the State of Nevada, and the CAB. At other DOE sites SSABs are challenged by a number of complex, technical programs requiring considerable time and resources for the board to comprehend. It is worth considering the utilization of an independent
Necrosulfonamide Attenuates Spinal Cord Injury via Necroptosis Inhibition.
Wang, Yongxiang; Wang, Jingcheng; Wang, Hua; Feng, Xinmin; Tao, Yuping; Yang, Jiandong; Cai, Jun
2018-03-31
Spinal cord injury (SCI) is a serious trauma without efficient treatment currently. Necroptosis can be blocked post injury by special inhibitors. This study is to investigate the effects, mechanism, and potential benefit of necrosulfonamide (NSA) for SCI therapy. Pathologic condition was detected using hematoxylin-eosin staining on injured spinal cord and other major organs. Necroptosis-related factors-RIP1, RIP3, and MLKL-were detected using Western blot. Detections on mitochondrial functions such as adenosine triphosphate generation and activities of superoxide dismutase and caspase-3 were also performed. Finally, ethologic performance was detected using a 21-point open-field locomotion test. Reduced lesions and protected neurons were found in the injured spinal cord after treatment with NSA using hematoxylin-eosin staining for pathologic detection. No obvious toxicity on rat liver, kidney, heart, and spleen was detected. Rather than RIP1 and RIP3, MLKL was significantly inhibited by the NSA using Western blot detection. Adenosine triphosphate generation was obviously decreased post injury but slightly increased after the NSA treatment, especially 24 hours post injury. No significant changes were found on activities of superoxide dismutase and caspase-3 after the treatment of NSA. Ethologic performance was significantly improved using a 21-point, open-field locomotion test. Our research indicates NSA attenuates the spinal cord injury via necroptosis inhibition. It might be a potential and safe chemical benefit for SCI therapy. To our knowledge, this is the first study on the effects of NSA as treatment of traumatic SCI. Copyright © 2018 Elsevier Inc. All rights reserved.
Zhang, Damao; Wang, Zhien; Luo, Tao; Yin, Yan; Flynn, Connor
2017-03-01
Ice particle formation in slightly supercooled stratiform clouds is not well documented or understood. In this study, 4 years of combined lidar depolarization and radar reflectivity (Ze) measurements are analyzed to distinguish between cold drizzle and ice crystal formations in slightly supercooled Arctic stratiform clouds over the Atmospheric Radiation Measurement Program Climate Research Facility North Slope of Alaska Utqiaġvik ("Barrow") site. Ice particles are detected and statistically shown to be responsible for the strong precipitation in slightly supercooled Arctic stratiform clouds at cloud top temperatures as high as -4°C. For ice precipitating Arctic stratiform clouds, the lidar particulate linear depolarization ratio (δpar_lin) correlates well with radar Ze at each temperature range, but the δpar_lin-Ze relationship varies with temperature ranges. In addition, lidar depolarization and radar Ze observations of ice generation characteristics in Arctic stratiform clouds are consistent with laboratory-measured temperature-dependent ice growth habits.
Validation of French upper limb Erasmus modified Nottingham Sensory Assessment in stroke.
Villepinte, Claire; Catella, Emilie; Martin, Magali; Hidalgo, Sylvie; Téchené, Sabrina; Lebely, Claire; Castel-Lacanal, Evelyne; de Boissezon, Xavier; Chih, HuiJun; Gasq, David
2018-04-13
Somatosensory impairment of the upper limb (UL) occurs in approximately 50% of adults post-stroke, associated with loss of hand motor function, activity and participation. Measurement of UL sensory impairment is a component of rehabilitation contributing to the selection of sensorimotor techniques optimizing recovery and providing a prognostic estimate of UL function. To date, no standardized official French version of a measure of somatosensory impairment has been established. To develop and validate a French version of the Erasmus modified Nottingham Sensory Assessment somatosensory (EmNSA-SS) and stereognosis (EmNSA-ST) component for evaluating the UL among adults with stroke. This study is a single-center observational cross-sectional study. A French version of the EmNSA for UL was developed by forward-backward translation and cross-cultural adaptation. Fifty stroke patients were recruited to establish concurrent-criterion-related validity, internal consistency, intra- and inter-rater reproducibility with intracorrelation coefficients (ICCs) for reliability and the minimal detectable change with 95% confidence interval (MDC95) for agreement, as well as ceiling and floor effects. Criterion validity was assessed against the Fugl-Meyer Assessment-Sensory (FMA-S) for the UL. The median (range) EmNSA-SS score was 41.5 (1-44). The Spearman rank correlation coefficient between EmNSA-SS and FMA-S total scores was moderate (rho=0.74, P<0.001). The EmNSA-SS/ST internal consistency was adequate across subscales; with Cronbach α ranging from 0.82-0.96. For the EmNSA-SS total score, intra- and inter-rater reliability was excellent (ICC=0.92 in both cases), with MDC95 of 12.3 and 14.6, respectively. EmNSA-SS/ST total scores demonstrated no ceiling or floor effects. The French EmNSA is a valid and reproducible scale that can be used for comprehensive and accurate assessment of somatosensory modalities in adults post-stroke. Taking less than 30min to administer, the
Transcriptional regulation of Drosophila gonad formation.
Tripathy, Ratna; Kunwar, Prabhat S; Sano, Hiroko; Renault, Andrew D
2014-08-15
The formation of the Drosophila embryonic gonad, involving the fusion of clusters of somatic gonadal precursor cells (SGPs) and their ensheathment of germ cells, provides a simple and genetically tractable model for the interplay between cells during organ formation. In a screen for mutants affecting gonad formation we identified a SGP cell autonomous role for Midline (Mid) and Longitudinals lacking (Lola). These transcriptional factors are required for multiple aspects of SGP behaviour including SGP cluster fusion, germ cell ensheathment and gonad compaction. The lola locus encodes more than 25 differentially spliced isoforms and we have identified an isoform specific requirement for lola in the gonad which is distinct from that in nervous system development. Mid and Lola work in parallel in gonad formation and surprisingly Mid overexpression in a lola background leads to additional SGPs at the expense of fat body cells. Our findings support the idea that although the transcription factors required by SGPs can ostensibly be assigned to those being required for either SGP specification or behaviour, they can also interact to impinge on both processes. Copyright © 2014 Elsevier Inc. All rights reserved.
Characteristics and direct radiative effect of mid-latitude continental aerosols: the ARM case
Directory of Open Access Journals (Sweden)
M. G. Iziomon
2003-01-01
Full Text Available A multi-year field measurement analysis of the characteristics and direct radiative effect of aerosols at the Southern Great Plains (SGP central facility of the Atmospheric Radiation Measurement (ARM Program is presented. Inter-annual mean and standard deviation of submicrometer scattering fraction (at 550 nm and Ångström exponent å (450 nm, 700 nm at the mid-latitude continental site are indicative of the scattering dominance of fine mode aerosol particles, being 0.84±0.03 and 2.25±0.09, respectively. We attribute the diurnal variation of submicron aerosol concentration to coagulation, photochemistry and the evolution of the boundary layer. Precipitation does not seem to play a role in the observed afternoon maximum in aerosol concentration. Submicron aerosol mass at the site peaks in the summer (12.1±6.7mg m-3, with the summer value being twice that in the winter. Of the chemically analyzed ionic components (which exclude carbonaceous aerosols, SO4= and NH4+ constitute the dominant species at the SGP seasonally, contributing 23-30% and 9-12% of the submicron aerosol mass, respectively. Although a minor species, there is a notable rise in NO3- mass fraction in winter. We contrast the optical properties of dust and smoke haze. The single scattering albedo w0 shows the most remarkable distinction between the two aerosol constituents. We also present aircraft measurements of vertical profiles of aerosol optical properties at the site. Annually, the lowest 1.2 km contributes 70% to the column total light scattering coefficient. Column-averaged and surface annual mean values of hemispheric backscatter fraction (at 550 nm, w0 (at 550 nm and å (450 nm, 700 nm agree to within 5% in 2001. Aerosols produce a net cooling (most pronounced in the spring at the ARM site
The nuclear safety account and the Chernobyl nuclear power plant
International Nuclear Information System (INIS)
Maltini, F.
1996-01-01
In 1993, the G-7 officially proposed that the European Bank for Reconstruction and Development set up the Nuclear Safety Account (NSA) and act as the Account's secretariat. The Bank's Board of Directors approved this proposal and the Rules of the NSA on 22 March 1993 and the NSA became effective on 14 April 1993. The NSA finances, through grants, operational and near-term technical safety improvements for Soviet-designed nuclear reactors in the countries of the former Soviet Union, central and eastern Europe. Priority is given to those reactors which present the highest level of risk that can be significantly reduced by short-term and cost-effective safety improvements, and which are necessary to ensure the continuing electricity supply in the region. Efforts are therefore focused on WWER 440/230 and RBMK types of reactors and on the purchase of equipment as opposed to studies, which a number of donors already fund. Finance from the NSA is not used to extend the operating lifetime of unsafe reactors
2010-07-01
... PROGRAM NATIONAL SECURITY AGENCY/CENTRAL SECURITY SERVICE (NSA/CSS) FREEDOM OF INFORMATION ACT PROGRAM... requested. There are no fees associated with a Privacy Act request, except as stated in NSA/CSS Regulation...
Kumari, Suneeta; Malik, Mansoor; Florival, Christina; Manalai, Partam; Sonje, Snezana
2017-01-01
Scales measuring positive and negative symptoms in schizophrenia remain the primary mo Scales measuring positive and negative symptoms in schizophrenia remain the primary mode of assessing and diagnosing schizophrenia by clinicians and researchers. The scales are mainly used to monitor the severity of positive and negative symptoms and track treatment response in schizophrenics. Although these scales are widely used, quality as well as general utility of each scale varies. The quality is determined by the validity and reliability of the scales. The utility of the scale is determined by the time of administration and the settings for which the scales can be administered in research or clinical settings. There are relatively fewer articles on the utility of newer scales like CAINS (Clinical Assessment Interview for Negative Symptoms) and the BNSS (Brief Negative Symptom Scale) that compare them to the older scales PANSS (Positive and Negative Symptoms Scale), SAPS (Scale for the Assessment of Positive Symptoms) SANS (the Scale for the Assessment of Negative Symptoms), NSA-16 (Negative Symptom Assessment-16) and CGI-SCH (Clinical Global Impression Schizophrenia. The older scales were developed more than 30 years ago. Since then, our understanding of negative symptoms has evolved and currently there are newer rating scales evaluating the validity of negative symptoms. The older scales do not incorporate the latest research on negative symptoms. CAINS and BNSS are attractive for both their reliability and their concise accessible format, however, a scale that is simpler, accessible, user-friendly, that incorporates a multidimensional model of schizophrenia, addresses the psychosocial and cognitive component has yet to be developed.
Radiance Research Particle Soot/Absorption Photometer Instrument Handbook
Energy Technology Data Exchange (ETDEWEB)
Springston, S. R. [Brookhaven National Lab. (BNL), Upton, NY (United States)
2016-03-01
Radiance Research PSAPs as described in this Handbook are deployed in the second ARM Mobile Facility (AMF2) Aerosol Observing System (AOS), the third ARM Mobile Facility (AMF3) AOS, ENA AOS and Mobile Aerosol Observing System (MAOS)-A. An earlier version of the PSAP is currently operated in the ARM Aerial Facility and at SGP. The older SGP instrument is covered in a separate Handbook.
Remote sensing of PM2.5 during cloudy and nighttime periods using ceilometer backscatter
Directory of Open Access Journals (Sweden)
S. Li
2017-06-01
Full Text Available Monitoring PM2.5 (particulate matter with aerodynamic diameter d ≤ 2.5 µm mass concentration has become of more importance recently because of the negative impacts of fine particles on human health. However, monitoring PM2.5 during cloudy and nighttime periods is difficult since nearly all the passive instruments used for aerosol remote sensing are not able to measure aerosol optical depth (AOD under either cloudy or nighttime conditions. In this study, an empirical model based on the regression between PM2.5 and the near-surface backscatter measured by ceilometers was developed and tested using 6 years of data (2006 to 2011 from the Howard University Beltsville Campus (HUBC site. The empirical model can explain ∼ 56, ∼ 34 and ∼ 42 % of the variability in the hourly average PM2.5 during daytime clear, daytime cloudy and nighttime periods, respectively. Meteorological conditions and seasons were found to influence the relationship between PM2.5 mass concentration and the surface backscatter. Overall the model can explain ∼ 48 % of the variability in the hourly average PM2.5 at the HUBC site when considering the seasonal variation. The model also was tested using 4 years of data (2012 to 2015 from the Atmospheric Radiation Measurement (ARM Southern Great Plains (SGP site, which was geographically and climatologically different from the HUBC site. The results show that the empirical model can explain ∼ 66 and ∼ 82 % of the variability in the daily average PM2.5 at the ARM SGP site and HUBC site, respectively. The findings of this study illustrate the strong need for ceilometer data in air quality monitoring under cloudy and nighttime conditions. Since ceilometers are used broadly over the world, they may provide an important supplemental source of information of aerosols to determine surface PM2.5 concentrations.
2010-07-01
... PROGRAM NATIONAL SECURITY AGENCY/CENTRAL SECURITY SERVICE (NSA/CSS) FREEDOM OF INFORMATION ACT PROGRAM... 22161. 2 See footnote 1 to this section. (b) This part applies to all NSA/CSS elements, field activities...
Urantówka, Adam Dawid; Mackiewicz, Paweł; Strzała, Tomasz
2014-01-01
The Yellow-shouldered Amazon (Amazona barbadensis) is the sole parrot of the genus Amazona that inhabits only dry forests. Its population has been dropping; therefore it has been the topic of many studies and conservation efforts. However, the phylogenetic relationship of this species to potential relatives classified within the Yellow-Headed Amazon (YHA) complex are still not clear. Therefore, we used more extensive data sets, including the newly sequenced mitochondrial genome of A. barbadensis, to conduct phylogenetic analyses. Various combinations of genes and many phylogenetic approaches showed that A. barbadensis clustered significantly with A. ochrocephala ochrocephala from Colombia and Venezuela, which created the Northern South American (NSA) lineage, clearly separated from two other lineages within the YHA complex, the Central (CA) and South American (SA). Tree topology tests and exclusion of rapidly evolving sites provided support for a NSA+SA grouping. We propose an evolutionary scenario for the YHA complex and its colonization of the American mainland. The NSA lineage likely represents the most ancestral lineage, which derived from Lesser Antillean Amazons and colonized the northern coast of Venezuela about a million years ago. Then, Central America was colonized through the Isthmus of Panama, which led to the emergence of the CA lineage. The southward expansion to South America and the origin of the SA lineage happened almost simultaneously. However, more intensive or prolonged gene flow or migrations have led to much weaker geographic differentiation of genetic markers in the SA than in the CA lineage.
International Nuclear Information System (INIS)
Hu Juan; Yu Guofu; Tam, Hon-Wah
2012-01-01
The source generation procedure (SGP) is applied to a y-directional discrete version and an x-directional discrete version of the Leznov lattice. Consequently, a y-discrete Leznov lattice equation with self-consistent sources (y-discrete Leznov ESCS) and an x-discrete Leznov ESCS are presented. Also utilizing the SGP, a new type of Leznov lattice equation with self-consistent sources (new Leznov ESCS) is derived. It is interesting that the two semi-discrete Leznov ESCS produced constitute a y-discretization for the Leznov ESCS given by Wang et al (2007 J. Phys. A: Math. Theor. 40 12691) and an x-discretization for the new Leznov ESCS, respectively. This means that the commutativity of SGP and integrable semi-discretizations is valid for the two-dimensional Leznov lattice equation. (paper)
Strain gradient plasticity-based modeling of hydrogen environment assisted cracking
DEFF Research Database (Denmark)
Martínez Pañeda, Emilio; Niordson, Christian Frithiof; P. Gangloff, Richard
2016-01-01
Finite element analysis of stress about a blunt crack tip, emphasizing finite strain and phenomenologicaland mechanism-based strain gradient plasticity (SGP) formulations, is integrated with electrochemical assessment of occluded-crack tip hydrogen (H) solubility and two H-decohesion models...... to predict hydrogen environment assisted crack growth properties. SGP elevates crack tip geometrically necessary dislocation density and flow stress, with enhancement declining with increasing alloy strength. Elevated hydrostatic stress promotes high-trapped H concentration for crack tip damage......; it is imperative to account for SGP in H cracking models. Predictions of the threshold stress intensity factor and H-diffusion limited Stage II crack growth rate agree with experimental data for a high strength austenitic Ni-Cusuperalloy (Monel®K-500) and two modern ultra-high strength martensitic steels (Aer...
Energy Technology Data Exchange (ETDEWEB)
Gerald Heymsfield
2010-12-20
Data was taken with the NASA ER-2 aircraft with the Cloud Radar System and other instruments in conjunction with the DOE ARM CLASIC field campaign. The flights were near the SGP site in north Central Oklahoma and targeted small developing convection. The CRS is a 94 GHz nadir pointing Doppler radar. Also on board the ER-2 was the Cloud Physics Lidar (CPL). Seven science flights were conducted but the weather conditions did not cooperate in that there was neither developing convection, or there was heavy rain.
78 FR 17234 - Negotiated Service Agreement
2013-03-20
... (DFS) Negotiated Service Agreement (NSA) to the market dominant product list.\\1\\ After a [[Page 17235... dominant product list.\\2\\ On March 8, 2013, the Postal Service filed an amendment to the DFS NSA with the...
Determination of neuronal antibodies in suspected and definite Creutzfeldt-Jakob disease.
Grau-Rivera, Oriol; Sánchez-Valle, Raquel; Saiz, Albert; Molinuevo, José Luis; Bernabé, Reyes; Munteis, Elvira; Pujadas, Francesc; Salvador, Antoni; Saura, Júlia; Ugarte, Antonio; Titulaer, Maarten; Dalmau, Josep; Graus, Francesc
2014-01-01
Creutzfeldt-Jakob disease (CJD) and autoimmune encephalitis with antibodies against neuronal surface antigens (NSA-abs) may present with similar clinical features. Establishing the correct diagnosis has practical implications in the management of care for these patients. To determine the frequency of NSA-abs in the cerebrospinal fluid of patients with suspected CJD and in patients with pathologically confirmed (ie, definite) CJD. A mixed prospective (suspected) and retrospective (definite) CJD cohort study was conducted in a reference center for detection of NSA-abs. The population included 346 patients with suspected CJD and 49 patients with definite CJD. Analysis of NSA-abs in cerebrospinal fluid with brain immunohistochemistry optimized for cell-surface antigens was performed. Positive cases in the suspected CJD group were further studied for antigen specificity using cell-based assays. All definite CJD cases were comprehensively tested for NSA-abs, with cell-based assays used for leucine-rich glioma-inactivated 1 (LGI1), contactin-associated protein-like 2 (CASPR2), N-methyl-d-aspartate (NMDA), and glycine (GlY) receptors. Neuronal surface antigens were detected in 6 of 346 patients (1.7%) with rapid neurologic deterioration suggestive of CJD. None of these 6 patients fulfilled the diagnostic criteria for probable or possible CJD. The target antigens included CASPR2, LGI1, NMDAR, aquaporin 4, Tr (DNER [δ/notch-like epidermal growth factor-related receptor]), and an unknown protein. Four of the patients developed rapidly progressive dementia, and the other 2 patients had cerebellar ataxia or seizures that were initially considered to be myoclonus without cognitive decline. The patient with Tr-abs had a positive 14-3-3 test result. Small cell lung carcinoma was diagnosed in the patient with antibodies against an unknown antigen. All patients improved or stabilized after appropriate treatment. None of the 49 patients with definite CJD had NSA-abs. A low, but
Influence of Staphylococcus aureus on Outcomes after Valvular Surgery for Infective Endocarditis.
Han, Sang Myung; Sorabella, Robert A; Vasan, Sowmya; Grbic, Mark; Lambert, Daniel; Prasad, Rahul; Wang, Catherine; Kurlansky, Paul; Borger, Michael A; Gordon, Rachel; George, Isaac
2017-07-20
As Staphylococcus aureus (SA) remains one of the leading cause of infective endocarditis (IE), this study evaluates whether S. aureus is associated with more severe infections or worsened outcomes compared to non-S. aureus (NSA) organisms. All patients undergoing valve surgery for bacterial IE between 1995 and 2013 at our institution were included in this study (n = 323). Clinical data were retrospectively collected from the chart review. Patients were stratified according to the causative organism; SA (n = 85) and NSA (n = 238). Propensity score matched pairs (n = 64) of SA versus NSA were used in the analysis. SA patients presented with more severe IE compared to NSA patients, with higher rates of preoperative vascular complications, preoperative septic shock, preoperative embolic events, preoperative stroke, and annular abscess. Among the matched pairs, there were no significant differences in 30-day (9.4% SA vs. 7.8% NSA, OR = 1.20, p = 0.76) or 1-year mortality (20.3% SA vs. 14.1% NSA, OR = 1.57, p = 0.35) groups, though late survival was significantly worse in SA patients. There was also no significant difference in postoperative morbidity between the two matched groups. SA IE is associated with a more severe clinical presentation than IE caused by other organisms. Despite the clearly increased preoperative risk, valvular surgery may benefit SA IE patients by moderating the post-operative mortality and morbidity.
Parry, Joshua A; Barrett, Ian; Schoch, Bradley; Yuan, Brandon; Cass, Joseph; Cross, William
2018-04-01
To determine whether fixation of pertrochanteric hip fractures with cephalomedullary nails (CMNs) with a neck-shaft angle (NSA) less than the native NSA affects reduction and lag screw cutout. Retrospective comparative study. Level I trauma center. Patients treated with a CMN for unstable pertrochanteric femur fractures (OTA/AO 31-A2.2 and 31-A2.3) between 2005 and 2014. CMN fixation. NSA reduction and lag screw cutout. Patients fixed with a nail angle less than their native NSA were less likely to have good reductions [17% vs. 60%, 95% confidence interval (CI), -63% to -18%; P = 0.0005], secondary to more varus reductions (41% vs. 10%, 95% CI, 9%-46%; P = 0.01) and more fractures with ≥4 mm of displacement (63% vs. 35%, 95% CI, 3%-49%; P = 0.03). The cutout was not associated with the use of a nail angle less than the native NSA (60% vs. 76%, 95% CI, -56% to 18%; P = 0.5), varus reductions (60% vs. 32%, 95% CI, -13% to 62%; P = 0.3), or poor reductions (20% vs. 17%, 95% CI, -24% to 44%; P = 1.0). The fixation of unstable pertrochanteric hip fractures with a nail angle less than the native NSA was associated with more varus reductions and fracture displacement but did not affect the lag screw cutout. Therapeutic Level III. See Instructions for Authors for a complete description of levels of evidence.
Coxa vara in postseptic arthritis of the hip in children.
Johari, Ashok N; Hampannavar, Aravind; Johari, Ratna A; Dhawale, Arjun A
2017-07-01
The behavior and treatment of coxa vara and pseudarthrosis of the proximal femur secondary to sepsis is not well described. The aim of this study is to describe the pathoanatomy for coxa vara and pseudarthrosis in postseptic hips, evaluate progression of neck shaft angle (NSA), and discuss treatment. This is a retrospective case series of 20 patients (21 hips). There were 11 hips with predominant avascular necrosis of the capital femoral epiphysis without pseudarthrosis (type 1) and 10 with pseudarthrosis (type 2). The interobserver κ value was 0.79. There was a decrease in NSA from 110.3° to 99.3° during an average follow-up duration of 5.2 years (range: 2-14 years). The average change in NSA between the initial presentation and the final follow-up was 5.5° in type 1 and 17.1° in type 2. Nine patients underwent a surgical intervention. In cases where subtrochanteric valgus osteotomy was performed, the mean preoperative NSA was 94° and the mean NSA at the final follow-up was 128°; all operated pseudarthroses healed without bone grafting. Acetabuloplasty is not necessary in most cases.
Wang, Jun; Tang, Cheuk; Ferruzzi, Mario G; Gong, Bing; Song, Brian J; Janle, Elsa M; Chen, Tzu-Ying; Cooper, Bruce; Varghese, Merina; Cheng, Alice; Freire, Daniel; Bilski, Amanda; Roman, Jessica; Nguyen, Tuyen; Ho, Lap; Talcott, Stephen T; Simon, James E; Wu, Qingli; Pasinetti, Giulio M
2013-12-01
Metabolic syndrome has become an epidemic and poses tremendous burden on the health system. People with metabolic syndrome are more likely to experience cognitive decline. As obesity and sedentary lifestyles become more common, the development of early prevention strategies is critical. In this study, we explore the potential beneficial effects of a combinatory polyphenol preparation composed of grape seed extract, Concord purple grape juice extract, and resveratrol, referred to as standardized grape polyphenol preparation (SGP), on peripheral as well as brain dysfunction induced by metabolic syndrome. We found dietary fat content had minimal effect on absorption of metabolites of major polyphenols derived from SGP. Using a diet-induced animal model of metabolic syndrome (DIM), we found that brain functional connectivity and synaptic plasticity are compromised in the DIM mice. Treatment with SGP not only prevented peripheral metabolic abnormality but also improved brain synaptic plasticity. Our study demonstrated that SGP, comprised of multiple bioavailable and bioactive components targeting a wide range of metabolic syndrome related pathological features, provides greater global protection against peripheral and central nervous system dysfunctions and can be potentially developed as a novel prevention/treatment for improving brain connectivity and synaptic plasticity important for learning and memory. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Radioactive waste processing and disposal
International Nuclear Information System (INIS)
1975-07-01
Reference to 2140 publications related to radioactive waste, announced in Nuclear Science Abstracts (NSA) Volumes 28 (July Dec. 1973), 29 (Jan.--June 1974), and 30 (July--Dec. 1974), are presented. The references are arranged by the original NSA abstract number, which approximately places them in chronological order. Sequence numbers appear beside each reference and the NSA volume and abstract numbers appear at the end of the citations. Three indexes are provided: Personal Author, Subject, and Report Number. This document supplements the preceding six in the TID3311 series. (U.S.)
Flanagan, Lawrence B.; Brooks, J. Renee; Ehleringer, James R.
1997-12-01
In this paper we compare measurements of photosynthesis and carbon isotope discrimination characteristics among plants from three mature boreal forest types (Black spruce, Jack pine, and aspen) in order to help explain variation in ecosystem-level gas exchange processes. Measurements were made at the southern study area (SSA) and northern study area (NSA) of the boreal forest in central Canada as part of the Boreal Ecosystem-Atmosphere Study (BOREAS). In both the NSA and the SSA there were significant differences in photosynthesis among the major tree species, with aspen having the highest CO2 assimilation rates and spruce the lowest. Within a species, photosynthetic rates in the SSA were approximately twice those measured in the NSA, and this was correlated with similar variations in stomatal conductance. Calculations of the ratio of leaf intercellular to ambient CO2 concentration (ci/ca) from leaf carbon isotope discrimination (Δ) values indicated a relatively low degree of stomatal limitation of photosynthesis, despite the low absolute values of stomatal conductance in these boreal tree species. Within each ecosystem, leaf Δ values were strongly correlated with life-form groups (trees, shrubs, forbs, and mosses), and these differences are maintained between years. Although we observed significant variation in the 13C content of tree rings at the old Jack pine site in the NSA during the past decade (indicating interannual variation in the degree of stomatal limitation), changes in summer precipitation and temperature accounted for only 44% of the isotopic variance. We scaled leaf-level processes to the ecosystem level through analyses of well-mixed canopy air. On average, all three forest types had similar ecosystem-level Δ values (average value ± standard deviation, 19.1‰±0.5‰), calculated from measurements of change in the concentration and carbon isotope ratio of atmospheric CO2 during a diurnal cycle within a forest canopy. However, there were
DEFF Research Database (Denmark)
Rytter, Jens Elo
2014-01-01
Artiklen analyserer FEs adgang til at overvåge personer og videregive personoplysninger til fremmede efterretningester som NSA i USA.......Artiklen analyserer FEs adgang til at overvåge personer og videregive personoplysninger til fremmede efterretningester som NSA i USA....
Description and Performance Evaluation of the Moving Target Detector
1977-03-08
Precipitation spectrum at azimuth of 330 . 170 1701 A-8 SGP doppler spectra of angels (probably solitary soaring 172 seagulls ). A-9 SGP doppler...spectra of angels (probably multiple soaring 173 seagulls ). A-10 Airliner approaching radar at traffic pattern speed. 174 A-lI Airliner approaching radar...frequented by soaring seagulls . The three periodograms in Figure A-8 each show a single rather narrow peak. These are believed to be returns from solitary
46 CFR Sec. 5 - Procedure for negotiated price awards.
2010-10-01
... shall be furnished with the information provided for in Article 1(a) of the NSA-LUMPSUMREP Contract. (b... Article 27 of the NSA-LUMPSUMREP Contract. ... 46 Shipping 8 2010-10-01 2010-10-01 false Procedure for negotiated price awards. Sec. 5 Section 5...
Sadhana | Indian Academy of Sciences
Indian Academy of Sciences (India)
In this paper, we develop design tools for Near Surface Analysis (NSA) for understanding axisymmetric fretting. Axisymmetric Fretting Analysis (AFA) becomes formidable owing to localised tractions that call for Fourier transform techniques. We develop two different NSA strategies based on two-dimensional plane strain ...
Goebel, T. H. W.; Hauksson, E.; Plesch, A.; Shaw, J. H.
2017-06-01
A key parameter in engineering seismology and earthquake physics is seismic stress drop, which describes the relative amount of high-frequency energy radiation at the source. To identify regions with potentially significant stress drop variations, we perform a comparative analysis of source parameters in the greater San Gorgonio Pass (SGP) and Ventura basin (VB) in southern California. The identification of physical stress drop variations is complicated by large data scatter as a result of attenuation, limited recording bandwidth and imprecise modeling assumptions. In light of the inherently high uncertainties in single stress drop measurements, we follow the strategy of stacking large numbers of source spectra thereby enhancing the resolution of our method. We analyze more than 6000 high-quality waveforms between 2000 and 2014, and compute seismic moments, corner frequencies and stress drops. Significant variations in stress drop estimates exist within the SGP area. Moreover, the SGP also exhibits systematically higher stress drops than VB and shows more scatter. We demonstrate that the higher scatter in SGP is not a generic artifact of our method but an expression of differences in underlying source processes. Our results suggest that higher differential stresses, which can be deduced from larger focal depth and more thrust faulting, may only be of secondary importance for stress drop variations. Instead, the general degree of stress field heterogeneity and strain localization may influence stress drops more strongly, so that more localized faulting and homogeneous stress fields favor lower stress drops. In addition, higher loading rates, for example, across the VB potentially result in stress drop reduction whereas slow loading rates on local fault segments within the SGP region result in anomalously high stress drop estimates. Our results show that crustal and fault properties systematically influence earthquake stress drops of small and large events and should
Walton, N P; Wynn-Jones, H; Ward, M S; Wimhurst, J A
2005-11-01
The effect of femoral neck-shaft angle and implant type on the accuracy of lag screw placement in extra-capsular proximal femoral fracture fixation was investigated. Radiographs of all extra-capsular proximal femoral fractures seen in one unit over 18 months were reviewed. Of 399 cases, 307 (237 female, 70 male) were included in the study as they had no contra-lateral proximal femoral metal work. Femoral neck-shaft angle (NSA) of the uninjured hip and magnification adjusted tip-apex distance (TAD) of femoral head lag screw were measured. Type of fixation implant was 135 degrees classic hip screw (CHS) (n=144) or 130 degrees intra-medullary hip screw (IMHS) (n=163). Mean contra-lateral NSA was 130.2 degrees (112.9--148 degrees ) and 64 patients (58 female, 6 male) had a NSA TAD was 18.7 mm (5.8--43.8mm) and 88.9% of cases had a TAD of less than 25 mm. TAD values were significantly greater using an IMHS if NSA was 125 degrees (p=0.028). This was not the case with the CHS. The use of the 130 degrees -IMHS in patients with a NSA 125 degrees and caution is advocated when using this device in such cases.
2010-10-01
... REPAIRS UNDER NATIONAL SHIPPING AUTHORITY MASTER LUMP SUM REPAIR CONTRACT-NSA-LUMPSUMREP Sec. 13 Insurance. Article 9 of the NSA-LUMPSUMREP Contract sets forth the Contractor's liabilities and obligations with... 46 Shipping 8 2010-10-01 2010-10-01 false Insurance. Sec. 13 Section 13 Shipping MARITIME...
46 CFR Sec. 15 - Subcontracts.
2010-10-01
... REPAIRS UNDER NATIONAL SHIPPING AUTHORITY MASTER LUMP SUM REPAIR CONTRACT-NSA-LUMPSUMREP Sec. 15 Subcontracts. Under Article 29 of the NSA-LUMPSUMREP Contract, the Contractor is authorized to subcontract... 46 Shipping 8 2010-10-01 2010-10-01 false Subcontracts. Sec. 15 Section 15 Shipping MARITIME...
Protective role of marine macroalgae extracts against STZ induced diabetic rats
Directory of Open Access Journals (Sweden)
Marine macroalgae
2017-12-01
Full Text Available Objective: To study the anti-diabetic activity of marine macroalgae extracts (n = 31, purification and characterization of sulphated galactopyran (SGP from Gracilaria opuntia (FM4 in diabetic rats. Methods: The animals were separated into groups and STZ (55 mg/kg body weight was used to induce diabetics. Glucose, HbA1c, insulin, C-peptide levels and in vivo antioxidant levels were estimated and histopathological studies were done in STZ-induced diabetic and marine macroalgae treated rats. Results: Based on glucose and HbA1c levels and in vivo antioxidant levels, among the 31 marine macroalgae extracts, FM4 has showed high anti-diabetic activity. Hence, FM4 was purified and characterized by 1H-NMR spectra and FT-IR as sulphated galactopyran. During the survival analysis, SGP at dose of 100 mg/kg showed significant (P < 0.05 survival rate and elevations in C-peptide and insulin levels. The histopathological modulations of SGP were observed in diabetic rat tissues such as liver, kidney and brain. Hence obtained results reveal that SGP treated diabetic rats has significant changes in C-peptide and insulin levels which regulates the blood glucose levels and recovered the histopathological changes. Conclusions: Marine macroalgae have significant anti-diabetic activity. Hence, they could be used as nutraceutical supplement or natural green remedy against diabetes mellitus.
Correlations between motor and sensory functions in upper limb chronic hemiparetics after stroke
Directory of Open Access Journals (Sweden)
Thais Botossi Scalha
2011-08-01
Full Text Available OBJECTIVE: Describe the somatosensory function of the affected upper limb of hemiparetic stroke patients and investigate the correlations between measurements of motor and sensory functions in tasks with and without visual deprivation. METHOD: We applied the Fugl-Meyer Assessment (FMA, Nottingham Sensory Assessment (NSA, and several motor and sensory tests: Paper manipulation (PM, Motor Sequences (MS, Reaching and grasping (RG Tests Functional (TF, Tactile Discrimination (TD, Weight Discrimination (WD and Tactile Recognition of Objects (RO. RESULTS: We found moderate correlations between the FMA motor subscale and the tactile sensation score of the NSA. Additionally, the FMA sensitivity was correlated with the NSA total; and performance on the WD test items correlated with the NSA. CONCLUSION: There was a correlation between the sensory and motor functions of the upper limb in chronic hemiparetic stroke patients. Additionally, there was a greater reliance on visual information to compensate for lost sensory-motor skills.
DEFF Research Database (Denmark)
Bondarenko, Alexander S.; Stephens, Ifan E.L.; Bech, Lone
2012-01-01
The adsorption dynamics of *OH and *O species at Pt(111) and Cu/Pt(111) near-surface alloy (NSA) surfaces in oxygen-free and O2-saturated 0.1M HClO4 was investigated. Subsurface Cu modifies the electronic structure at the Pt(111) surface resulting in weaker bonding to adsorbates like *OH, *H or *O....... This provides a basis for the high oxygen reduction activity of the NSA, as predicted by density functional theory calculations. The shift in *OH adsorption of around 0.16V towards more positive potentials can be clearly monitored in absence of O2 and under the oxygen reduction reaction (ORR) conditions...... for the Cu/Pt(111) NSA. In both cases, for Pt(111) and NSA, the *OH(*O) adsorption dynamics is very similar in the absence of oxygen and under ORR conditions. Therefore, theoretical assumptions about the coverage of adsorbates in the absence of oxygen can be reasonably extrapolated to the situation when...
DEFF Research Database (Denmark)
Hogan, B L; Taylor, A; Kurkinen, M
1982-01-01
's membrane by mouse embryo parietal endoderm cells (Hogan, B. L.M., A. Taylor, and A.R. Cooper, 1982, Dev. Biol., 90:210-214). Both the Mr 180,000 and 150,000 sgps are deposited in the detergent-insoluble matrix of cultured cells, but they do not apparently undergo any disulphide-dependent intermolecular...... interactions and are not precursors or products of each other. They contain asparagine-linked oligosaccharides, but these are not the exclusive sites of sulphate labeling. Antiserum raised against the Mr 150,000 sgp C of Reichert's membranes has been used in an immunohistochemical analysis of rat skin...
Getting DNA copy numbers without control samples.
Ortiz-Estevez, Maria; Aramburu, Ander; Rubio, Angel
2012-08-16
The selection of the reference to scale the data in a copy number analysis has paramount importance to achieve accurate estimates. Usually this reference is generated using control samples included in the study. However, these control samples are not always available and in these cases, an artificial reference must be created. A proper generation of this signal is crucial in terms of both noise and bias.We propose NSA (Normality Search Algorithm), a scaling method that works with and without control samples. It is based on the assumption that genomic regions enriched in SNPs with identical copy numbers in both alleles are likely to be normal. These normal regions are predicted for each sample individually and used to calculate the final reference signal. NSA can be applied to any CN data regardless the microarray technology and preprocessing method. It also finds an optimal weighting of the samples minimizing possible batch effects. Five human datasets (a subset of HapMap samples, Glioblastoma Multiforme (GBM), Ovarian, Prostate and Lung Cancer experiments) have been analyzed. It is shown that using only tumoral samples, NSA is able to remove the bias in the copy number estimation, to reduce the noise and therefore, to increase the ability to detect copy number aberrations (CNAs). These improvements allow NSA to also detect recurrent aberrations more accurately than other state of the art methods. NSA provides a robust and accurate reference for scaling probe signals data to CN values without the need of control samples. It minimizes the problems of bias, noise and batch effects in the estimation of CNs. Therefore, NSA scaling approach helps to better detect recurrent CNAs than current methods. The automatic selection of references makes it useful to perform bulk analysis of many GEO or ArrayExpress experiments without the need of developing a parser to find the normal samples or possible batches within the data. The method is available in the open-source R package
Strain gradient plasticity modeling of hydrogen diffusion to the crack tip
DEFF Research Database (Denmark)
Martínez Pañeda, Emilio; del Busto, S.; Niordson, Christian Frithiof
2016-01-01
to characterize the gradient-enhanced stress elevation and subsequent diffusion of hydrogen towards the crack tip. Results reveal that GNDs, absent in conventional plasticity predictions, play a fundamental role on hydrogen transport ahead of a crack. SGP estimations provide a good agreement with experimental......In this work hydrogen diffusion towards the fracture process zone is examined accounting for local hardening due to geometrically necessary dislocations (GNDs) by means of strain gradient plasticity (SGP). Finite element computations are performed within the finite deformation theory...
46 CFR Sec. 12 - Disposition of removed equipment and scrap.
2010-10-01
... 46 Shipping 8 2010-10-01 2010-10-01 false Disposition of removed equipment and scrap. Sec. 12... CONTRACT-NSA-LUMPSUMREP Sec. 12 Disposition of removed equipment and scrap. (a) Article 8 of the NSA-LUMPSUMREP Contract provides that any ship equipment, fuel, lube oil, supplies, stores, furniture, fixtures...
Perrot, Danielle; Molotch, Noah P.; Williams, Mark W.; Jepsen, Steven M.; Sickman, James O.
2014-11-01
This study compares stream nitrate (NO3-) concentrations to spatially distributed snowmelt in two alpine catchments, the Green Lakes Valley, Colorado (GLV4) and Tokopah Basin, California (TOK). A snow water equivalent reconstruction model and Landsat 5 and 7 snow cover data were used to estimate daily snowmelt at 30 m spatial resolution in order to derive indices of new snowmelt areas (NSAs). Estimates of NSA were then used to explain the NO3- flushing behavior for each basin over a 12 year period (1996-2007). To identify the optimal method for defining NSAs and elucidate mechanisms underlying catchment NO3- flushing, we conducted a series of regression analyses using multiple thresholds of snowmelt based on temporal and volumetric metrics. NSA indices defined by volume of snowmelt (e.g., snowmelt ≤ 30 cm) rather than snowmelt duration (e.g., snowmelt ≤ 9 days) were the best predictors of stream NO3- concentrations. The NSA indices were better correlated with stream NO3- concentration in TOK (average R2= 0.68) versus GLV4 (average R2= 0.44). Positive relationships between NSA and stream NO3- concentration were observed in TOK with peak stream NO3- concentration occurring on the rising limb of snowmelt. Positive and negative relationships between NSA and stream NO3- concentration were found in GLV4 with peak stream NO3- concentration occurring as NSA expands. Consistent with previous works, the contrasting NO3- flushing behavior suggests that streamflow in TOK was primarily influenced by overland flow and shallow subsurface flow, whereas GLV4 appeared to be more strongly influenced by deeper subsurface flow paths.
Lang, Brian Hung-Hin; Wong, Carlos K H
2015-09-01
The issue of whether all incidental papillary thyroid microcarcinoma (PTMC) should be managed by early surgery (ES) has been questioned and there is a growing acceptance that a non-surgical approach (NSA) might be more appropriate. We conducted a cost-effectiveness analysis comparing the two strategies in managing incidental PTMC. Our base case was a hypothetical 40-year-old female diagnosed with a unifocal intra-thyroidal 9 mm PTMC. The PTMC was considered suitable for either strategy. A Markov decision tree model was constructed to compare the estimated cost-effectiveness between ES and NSA after 20 years. Outcome probabilities, utilities and costs were derived from the literature. The threshold for cost-effectiveness was set at USD 50,000/quality-adjusted life year (QALY). A further analysis was done for patients Sensitivity and threshold analyses were used to examine model uncertainty. Each patient who adopted NSA over ES cost an extra USD 682.54 but gained an additional 0.260 QALY. NSA was cost saving (i.e. less costly and more effective) up to 16 years from diagnosis and remained cost-effective from 17 years onward. In the sensitivity analysis, NSA remained cost-effective regardless of patient age (rates of progression, year cycle and discount rate. In the threshold analysis, none of the scenarios that could have changed the conclusion appeared clinically likely. For a selected group of incidental PTMC, adopting NSA was not only cost saving in the initial 16 years but also remained cost effective thereafter. This was irrespective of patient age, complication rate or rate of PTMC progression. © 2015 European Society of Endocrinology.
A review of sheep pox and goat pox: perspective of their control and eradication in Iran
Directory of Open Access Journals (Sweden)
Kamran Mirzaie
2015-12-01
Full Text Available Sheep pox and goat pox (SGP of small ruminants are most severing pox diseases of domestic animals, and they have a very important role in agricultural economy. Thereby, SGP are included in the notifiable diseases of Office International des Epizooties (OIE. Time and place distributions of these diseases are relatively stable worldwide. Transportation of infected animals could spread these viruses to the new areas. In most countries in which capripox are enzootic, vaccination and bio-security are the only two main control measures. SGP control programs have been commenced about 50 years ago in Iran, and there is a good situation for eradication of it. In this review, readers can find latest information in some essential aspects of etiology, distribution, transmission, and control of the diseases. Besides, current situation of the disease in Iran has been described, which perhaps are similar to the other endemic areas in the world.
Clinical Approach to Supranuclear Brainstem Saccadic Gaze Palsies
Directory of Open Access Journals (Sweden)
Alexandra Lloyd-Smith Sequeira
2017-08-01
Full Text Available Failure of brainstem supranuclear centers for saccadic eye movements results in the clinical presence of a brainstem-mediated supranuclear saccadic gaze palsy (SGP, which is manifested as slowing of saccades with or without range of motion limitation of eye movements and as loss of quick phases of optokinetic nystagmus. Limitation in the range of motion of eye movements is typically worse with saccades than with smooth pursuit and is overcome with vestibular–ocular reflexive eye movements. The differential diagnosis of SGPs is broad, although acute-onset SGP is most often from brainstem infarction and chronic vertical SGP is most commonly caused by the neurodegenerative condition progressive supranuclear palsy. In this review, we discuss the brainstem anatomy and physiology of the brainstem saccade-generating network; we discuss the clinical features of SGPs, with an emphasis on insights from quantitative ocular motor recordings; and we consider the broad differential diagnosis of SGPs.
Comparative evaluation of three capripoxvirus-vectored peste des petits ruminants vaccines.
Fakri, F; Bamouh, Z; Ghzal, F; Baha, W; Tadlaoui, K; Fihri, O Fassi; Chen, W; Bu, Z; Elharrak, M
2018-01-15
Sheep and goat pox (SGP) with peste des petits ruminants (PPR) are transboundary viral diseases of small ruminants that cause huge economic losses. Recombinant vaccines that can protect from both infections have been reported as a promising solution for the future. SGP was used as a vector to express two structural proteins hemagglutinin or the fusion protein of PPRV. We compared immunity conferred by recombinant capripoxvirus vaccines expressing H or F or both HF. Safety and efficacy were evaluated in goats and sheep. Two vaccine doses were tested in sheep, 10 4.5 TCDI50 in 1ml dose was retained for the further experiment. Results showed that the recombinant HF confers an earlier and stronger immunity against both SGP and PPR. This recombinant vaccine protect also against the disease in exposed and unexposed sheep. The potential Differentiating Infected from Vaccinated Animals of recombinant vaccines is of great advantage in any eradication program. Copyright © 2017 Elsevier Inc. All rights reserved.
Loeb measures in practice recent advances
Cutland, Nigel J
2000-01-01
This expanded version of the 1997 European Mathematical Society Lectures given by the author in Helsinki, begins with a self-contained introduction to nonstandard analysis (NSA) and the construction of Loeb Measures, which are rich measures discovered in 1975 by Peter Loeb, using techniques from NSA. Subsequent chapters sketch a range of recent applications of Loeb measures due to the author and his collaborators, in such diverse fields as (stochastic) fluid mechanics, stochastic calculus of variations ("Malliavin" calculus) and the mathematical finance theory. The exposition is designed for a general audience, and no previous knowledge of either NSA or the various fields of applications is assumed.
Radioactive waste processing and disposal
International Nuclear Information System (INIS)
1976-08-01
References to 1841 publications related to radioactive waste, announced in Nuclear Science Abstracts (NSA) Volumes 31 (Jan.--June 1975), 32 (July--Dec. 1975), and 33 (Jan.--June 1976), are cumulated in this bibliography. The references are arranged by the original NSA abstract number, which approximately places them in chronological order. Sequence numbers appear beside each reference and the NSA volume and abstract number appears at the end of each bibliographic citation. A listing of the subject descriptors used to describe each reference for machine storage and retrieval is shown. Four indexes are provided: Corporate Author, Personal Author, Subject, and Report Number. These indexes refer to the sequence numbers for the references
2010-07-01
... PROGRAM NATIONAL SECURITY AGENCY/CENTRAL SECURITY SERVICE (NSA/CSS) FREEDOM OF INFORMATION ACT PROGRAM..., requests for information that would not be withheld if requested under the FOIA or the Privacy Act (PA) may... Internet. Copies of records which have been released under the FOIA and which NSA/CSS has determined are...
Shields, Michael F.
1993-01-01
The need to manage large amounts of data on robotically controlled devices has been critical to the mission of this Agency for many years. In many respects this Agency has helped pioneer, with their industry counterparts, the development of a number of products long before these systems became commercially available. Numerous attempts have been made to field both robotically controlled tape and optical disk technology and systems to satisfy our tertiary storage needs. Custom developed products were architected, designed, and developed without vendor partners over the past two decades to field workable systems to handle our ever increasing storage requirements. Many of the attendees of this symposium are familiar with some of the older products, such as: the Braegen Automated Tape Libraries (ATL's), the IBM 3850, the Ampex TeraStore, just to name a few. In addition, we embarked on an in-house development of a shared disk input/output support processor to manage our every increasing tape storage needs. For all intents and purposes, this system was a file server by current definitions which used CDC Cyber computers as the control processors. It served us well and was just recently removed from production usage.
46 CFR Sec. 8 - Extra work and changes.
2010-10-01
... Contractor may appeal such contract price or revised completion date as provided in Article 27 of the NSA... 46 Shipping 8 2010-10-01 2010-10-01 false Extra work and changes. Sec. 8 Section 8 Shipping... ACCOMPLISHMENT OF VESSEL REPAIRS UNDER NATIONAL SHIPPING AUTHORITY MASTER LUMP SUM REPAIR CONTRACT-NSA-LUMPSUMREP...
Energy Technology Data Exchange (ETDEWEB)
Oteo, I.; Ivison, R. J.; Dunne, L.; Zhang, Z-Y.; Lewis, A.; Maddox, S. [Institute for Astronomy, University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh EH9 3HJ UK (United Kingdom); Smail, I.; Swinbank, A. M. [Centre for Extragalactic Astronomy, Department of Physics, Durham University, South Road, Durham DH1 3LE UK (United Kingdom); Riechers, D. [Department of Astronomy, Cornell University, Ithaca, NY 14853 (United States); Serjeant, S. [Department of Physical Sciences, The Open University, Milton Keynes, MK7 6AA (United Kingdom); Werf, P. Van der [Leiden Observatory, Leiden University, P.O. Box 9513, NL-2300 RA Leiden (Netherlands); Biggs, A. D. [European Southern Observatory, Karl-Schwarzschild-Str. 2, D-85748 Garching (Germany); Bremer, M. [H.H. Wills Physics Laboratory, University of Bristol, Tyndall Avenue, Bristol BS8 1TL (United Kingdom); Cigan, P.; Eales, S. [School of Physics and Astronomy, Cardiff University, The Parade, Cardiff CF24 3AA (United Kingdom); Clements, D. L. [Physics Department, Blackett Lab, Imperial College, Prince Consort Road, London SW7 2AZ (United Kingdom); Cooray, A. [Department of Physics and Astronomy, University of California, Irvine, CA 92697 (United States); Dannerbauer, H. [Universität Wien, Institut für Astrophysik, Türkenschanzstrasse 17, 1180 Wien (Austria); Ibar, E. [Instituto de Física y Astronomía, Universidad de Valparaíso, Avda. Gran Bretaña 1111, Valparaíso (Chile); Messias, H., E-mail: ivanoteogomez@gmail.com [Instituto de Astrofśica e Ciências do Espaço, Universidade de Lisboa, OAL, Tapada da Ajuda, PT1349-018 Lisboa (Portugal); and others
2016-08-10
Exploiting the sensitivity and spatial resolution of the Atacama Large Millimeter/submillimeter Array, we have studied the morphology and the physical scale of the interstellar medium—both gas and dust—in SGP 38326, an unlensed pair of interacting starbursts at z = 4.425. SGP 38326 is the most luminous star bursting system known at z > 4, with a total IR luminosity of L {sub IR} ∼ 2.5 × 10{sup 13} L {sub ⊙} and a star formation rate of ∼ 4500 M {sub ⊙} yr{sup −1}. SGP 38326 also contains a molecular gas reservoir among the most massive yet found in the early universe, and it is the likely progenitor of a massive, red-and-dead elliptical galaxy at z ∼ 3. Probing scales of ∼0.″1 or ∼800 pc we find that the smooth distribution of the continuum emission from cool dust grains contrasts with the more irregular morphology of the gas, as traced by the [C ii] fine structure emission. The gas is also extended over larger physical scales than the dust. The velocity information provided by the resolved [C ii] emission reveals that the dynamics of the two interacting components of SGP 38326 are each compatible with disk-like, ordered rotation, but also reveals an ISM which is turbulent and unstable. Our observations support a scenario where at least a subset of the most distant extreme starbursts are highly dissipative mergers of gas-rich galaxies.
Oteo, I.; Ivison, R. J.; Dunne, L.; Smail, I.; Swinbank, A. M.; Zhang, Z.-Y.; Lewis, A.; Maddox, S.; Riechers, D.; Serjeant, S.; Van der Werf, P.; Biggs, A. D.; Bremer, M.; Cigan, P.; Clements, D. L.; Cooray, A.; Dannerbauer, H.; Eales, S.; Ibar, E.; Messias, H.; Michałowski, M. J.; Pérez-Fournon, I.; van Kampen, E.
2016-08-01
Exploiting the sensitivity and spatial resolution of the Atacama Large Millimeter/submillimeter Array, we have studied the morphology and the physical scale of the interstellar medium—both gas and dust—in SGP 38326, an unlensed pair of interacting starbursts at z = 4.425. SGP 38326 is the most luminous star bursting system known at z > 4, with a total IR luminosity of L IR ˜ 2.5 × 1013 L ⊙ and a star formation rate of ˜ 4500 M ⊙ yr-1. SGP 38326 also contains a molecular gas reservoir among the most massive yet found in the early universe, and it is the likely progenitor of a massive, red-and-dead elliptical galaxy at z ˜ 3. Probing scales of ˜0.″1 or ˜800 pc we find that the smooth distribution of the continuum emission from cool dust grains contrasts with the more irregular morphology of the gas, as traced by the [C II] fine structure emission. The gas is also extended over larger physical scales than the dust. The velocity information provided by the resolved [C II] emission reveals that the dynamics of the two interacting components of SGP 38326 are each compatible with disk-like, ordered rotation, but also reveals an ISM which is turbulent and unstable. Our observations support a scenario where at least a subset of the most distant extreme starbursts are highly dissipative mergers of gas-rich galaxies.
Steiger-Ronay, Valerie; Merlini, Andrea; Wiedemeier, Daniel B; Schmidlin, Patrick R; Attin, Thomas; Sahrmann, Philipp
2017-11-28
An in vitro model for peri-implantitis treatment was used to identify areas that are clinically difficult to clean by analyzing the pattern of residual stain after debridement with commonly employed instruments. Original data from two previous publications, which simulated surgical (SA) and non-surgical (NSA) implant debridement on two different implant systems respectively, were reanalyzed regarding the localization pattern of residual stains after instrumentation. Two blinded examiners evaluated standardized photographs of 360 initially ink-stained dental implants, which were cleaned at variable defect angulations (30, 60, or 90°), using different instrument types (Gracey curette, ultrasonic scaler or air powder abrasive device) and treatment approaches (SA or NSA). Predefined implant surface areas were graded for residual stain using scores ranging from one (stain-covered) to six (clean). Score differences between respective implant areas were tested for significance by pairwise comparisons using Wilcoxon-rank-sum-tests with a significance level α = 5%. Best scores were found at the machined surface areas (SA: 5.58 ± 0.43, NSA: 4.76 ± 1.09), followed by the tips of the threads (SA: 4.29 ± 0.44, NSA: 4.43 ± 0.61), and areas between threads (SA: 3.79 ± 0.89, NSA: 2.42 ± 1.11). Apically facing threads were most difficult to clean (SA: 1.70 ± 0.92, NSA: 2.42 ± 1.11). Here, air powder abrasives provided the best results. Machined surfaces at the implant shoulder were well accessible and showed least amounts of residual stain. Apically facing thread surfaces constituted the area with most residual stain regardless of treatment approach.
The Shell gasification technology offers clean solutions for refineries and utility companies
Energy Technology Data Exchange (ETDEWEB)
Vlaswinkel, E.E.; Posthuma, S.A.; Zuideveld, P.L. [Shell International Oil Products BV, Amsterdam (Netherlands)
1997-12-31
Shell has developed two dedicated gasification technologies, the Shell Gasification Process (SGP) for gaseous and liquid feed stocks and the Shell Coal Gasification Process (SCGP) for coal, lignite and petroleum coke. These processes are described. One of the most recent applications of SGP is the PER+ Shell Refinery project in the Netherlands which is nearly completed. A 250 MWe coal gasification combined cycle plant based on SCGP has recently been built by Demkolec, a development partnership of the Dutch Electricity Generating Board (N.V. Sep). These two projects are discussed.
Getting DNA copy numbers without control samples
Directory of Open Access Journals (Sweden)
Ortiz-Estevez Maria
2012-08-01
Full Text Available Abstract Background The selection of the reference to scale the data in a copy number analysis has paramount importance to achieve accurate estimates. Usually this reference is generated using control samples included in the study. However, these control samples are not always available and in these cases, an artificial reference must be created. A proper generation of this signal is crucial in terms of both noise and bias. We propose NSA (Normality Search Algorithm, a scaling method that works with and without control samples. It is based on the assumption that genomic regions enriched in SNPs with identical copy numbers in both alleles are likely to be normal. These normal regions are predicted for each sample individually and used to calculate the final reference signal. NSA can be applied to any CN data regardless the microarray technology and preprocessing method. It also finds an optimal weighting of the samples minimizing possible batch effects. Results Five human datasets (a subset of HapMap samples, Glioblastoma Multiforme (GBM, Ovarian, Prostate and Lung Cancer experiments have been analyzed. It is shown that using only tumoral samples, NSA is able to remove the bias in the copy number estimation, to reduce the noise and therefore, to increase the ability to detect copy number aberrations (CNAs. These improvements allow NSA to also detect recurrent aberrations more accurately than other state of the art methods. Conclusions NSA provides a robust and accurate reference for scaling probe signals data to CN values without the need of control samples. It minimizes the problems of bias, noise and batch effects in the estimation of CNs. Therefore, NSA scaling approach helps to better detect recurrent CNAs than current methods. The automatic selection of references makes it useful to perform bulk analysis of many GEO or ArrayExpress experiments without the need of developing a parser to find the normal samples or possible batches within the
Effects of bronchoscopy on lung function in asthmatics.
Bellinger, Christina; Bleecker, Eugene R; Peters, Stephen; Pascual, Rodolfo; Krings, Jeffrey; Smith, Regina; Hastie, Annette T; Moore, Wendy C
2017-10-01
To better understand the changes in pulmonary physiology related to asthma severity following bronchoscopy, we performed scheduled pre- and post-procedure spirometry on subjects undergoing bronchoscopy in our research program. Control subjects and asthma subjects were recruited for bronchoscopy. On the day of bronchoscopy, subjects underwent spirometry pre-bronchoscopy and then up to three sets within 2 hour following the completion of bronchoscopy. A subset of patients had a second bronchoscopy after 2 weeks of treatment with oral prednisolone (40mg daily). A total of 92 subjects had at least one bronchoscopy (12 control subjects, 56 nonsevere asthma (NSA), 24 severe asthma (SA)). The SA and NSA groups had similar decreases in forced expiratory volume in 1 second (FEV1) (-20±13% vs.-19±16%, p = 0.92) and forced vital capacity (FVC) (-20±12% vs.-20±14%, p = 0.80), but no change in FEV1/FVC ratio. The control and NSA group had more rapid recovery of both FEV1 and FVC by 2 hour compared to the SA group (p = 0.01). In the subset of 36 subjects (22 NSA, 14 SA) who underwent a second bronchoscopy following the administration of oral prednisolone for 14 days, steroids resulted in more rapid recovery of lung function (p NSA subjects recovered more quickly than SA subjects. Treatment with oral corticosteroids was associated with a quicker recovery of FEV1 which suggests an inflammatory mechanism for these changes in lung compliance.
Directory of Open Access Journals (Sweden)
Yu. V. Dmitriev
2017-01-01
Full Text Available The study was aimed at comparative assessment of cardioprotective properties of various necroptosis inhibitors in the isolated perfused rat heart subjected to global ischemia-reperfusion.Materials and Methods. The study was performed on 38 male Wistar rats weighting 250–300 g. The following necroptosis inhibitors were tested: necrostatin-1 (Nec-1, necrostatin-5 (Nec-5, necrostatin-1s (Nec1s, and necrosulfonamide (NSA. All tested substances were administered intraperitoneally (i.p. 1 hour prior to heart perfusion. Control animals were treated either with the vehicle (dimethyl sulfoxide, DMSO or with 0,9% sodium chloride solution (Controls. The dose of necroptosis inhibitors was calculated on the basis of effective concentration (EC50 data. One hour after i.p. injection, the animals were anesthetized, the hearts were rapidly excised, the aorta was cannulated and retrogradely perfused according to Langendorff. After stabilization, the perfusion was stopped for 35 minutes, which was followed by 2 hours of reperfusion. Prior to stabilization, fluid-filled polyethylene balloon was placed into the left ventricle for left ventricular pressure registration. Coronary flow was measured at baseline and during reperfusion by means of perfusate collection. The volume of necrotic myocardium was expressed as a percentage of triphenyltetrazolium chloride-negative tissue relative to the entire heart volume.Results. The volume of myocardial necrosis and functional heart parameters were not different between Controls and DMSO group. All tested necroptosis inhibitors demonstrated infarct-limiting effect. However, there were no differences between the groups. The volume of necrotic myocardium was (50,5 ± 7,82%, (29,9 ± 3,42%, (27,7 ± 3,42%, (30,6 ± 3,82%, and (34,7 ± 5,82% in DMSO, Nec-1, Nec-5, Nec-1s, and NSA groups, respectively (p < 0,01 vs. DMSO group.Nec-1s and NSA were shown to improve functional recovery of the heart after ischemia. In particular, left
Data management and scientific integration within the Atmospheric Radiation Measurement Program
Gracio, Deborah K.; Hatfield, Larry D.; Yates, Kenneth R.; Voyles, Jimmy W.; Tichler, Joyce L.; Cederwall, Richard T.; Laufersweiler, Mark J.; Leach, Martin J.; Singley, Paul
1995-01-01
The Atmospheric Radiation Measurement (ARM) Program has been developed by the U.S. Department of Energy with the goal to improve the predictive capabilities of General Circulation Models (GCM's) in their treatment of clouds and radiative transfer effects. To achieve this goal, three experimental testbeds were designed for the deployment of instruments that will collect atmospheric data used to drive the GCM's. Each site, known as a Cloud and Radiation Testbed (CART), consists of a highly available, redundant data system for the collection of data from a variety of instrumentation. The first CART site was deployed in April 1992 in the Southern Great Plains (SGP), Lamont, Oklahoma, with the other two sites to follow in September 1995 in the Tropical Western Pacific and in 1997 on the North Slope of Alaska. Approximately 400 MB of data are transferred per day via the Internet from the SGP site to the ARM Experiment Center at Pacific Northwest Laboratory in Richland, Washington. The Experiment Center is central to the ARM data path and provides for the collection, processing, analysis, and delivery of ARM data. Data are received from the CART sites from a variety of instrumentation, observational systems, amd external data sources. The Experiment Center processes these data streams on a continuous basis to provide derived data products to the ARM Science Team in near real-time while providing a three-month running archive of data. A primary requirement of the ARM Program is to preserve and protect all data produced or acquired. This function is performed at Oak Ridge National Laboratory where leading edge technology is employed for the long-term storage of ARM data. The ARM Archive provides access to data for participation outside of the ARM Program. The ARM Program involves a collaborative effort by teams from various DOE National Laboratories, providing multi-disciplinary areas of expertise. This paper will discuss the collaborative methods in which the ARM teams
Directory of Open Access Journals (Sweden)
Marcinek Jerzy
2014-03-01
Full Text Available The paper presents correction of inaccuracies to the article entitled .Does Polish soil classification, V edition, refer to all soils in our country. by Stanisław Brożek published in Soil Science Annual, vol. 63, No. 3/2012: 49.56. The article of Stanisław Brożek is not a discussion paper but only a collection of numerous remarks, mostly non-professional, on .Polish soil classification. ed. 5, 2011 (SgP5. Since the article of Stanisław Brożek contains a lot of mistakes and inaccuracies arising from misunderstanding merits of a soil classification, as well as SgP5‘s text assessed, therefore in our paper wider merits discussion has not been taken. Correction of the erroneous statements of Author which relate to SgP5 were shown instead. Moreover, this paper is necessary as the Author is not a specialist in the field of soil classification, and his article was published in a pedological scientific journal.
The effects of IL-6 and its receptors on bone loss in postmenopausal women
International Nuclear Information System (INIS)
Huang Xin; Yang Weiwen; Zhang Xueguang
2001-01-01
Objective: To investigate the effects of IL-6 and its receptors on bone loss in healthy women, and to assess the pathogenesis of the postmenopausal osteoporosis in women. Methods: One hundred and thirty one healthy women aged 31-72 including 64 sexual maturity women aged 31-52 were enrolled in four groups and 67 postmenopausal women, the years of menopause from 1 month to 23 years, were also enrolled in four groups. The bone mass of the lumbar-spine and femur were measured using dual-energy X-rays absorptiometry; the serum E 2 , FSH, BGP by radioimmunoassay (RIA); the serum IL-6, sIL-6R, sgp 130 by ELISA; the serum AKP, calcium, phosphate by auto-biochemistry instrument. Results: The BMD of lumbar-spine and right femur decreased following increase of age and the duration of menopause. Significant positive correlation was observed between BMD and E 2 . The serum IL-6, sIL-6R, sgp 130 level was low, and stable before menopause. The level of IL-6, sIL-6R, sgp 130 increased with variation of age and the duration of menopause. Significant negative correlation was observed between IL-6, sIL-6R, sgp 130 and E 2 , BMD. Serum AKP and BGP level was higher in postmenopausal women than that in sexual maturity women. The serum calcium level increased significantly soon after menopausal, then decreased to the normal level. The serum phosphate level had no difference in these groups. Conclusion: The main cause of postmenopausal osteoporosis is the unbalance of the bone formation and resorption
Effects of tributyltin on placental cytokine production.
Arita, Yuko; Kirk, Michael; Gupta, Neha; Menon, Ramkumar; Getahun, Darios; Peltier, Morgan R
2018-03-15
Tributyltin (TBT) is a persistent pollutant but its effects on placental function are poorly understood as are its possible interactions with infection. We hypothesized that TBT alters the production of sex hormones and biomarkers for inflammation and neurodevelopment in an infection-dependent manner. Placental explant cultures were treated with 0-5000 nM TBT in the presence and absence of Escherichia coli. A conditioned medium was harvested and concentrations of steroids (progesterone, P4; testosterone, T and estradiol, E2) as well as biomarkers of inflammation [interleukin (IL)-1β (IL-1β), tumor necrosis factor (TNF-α), IL-10, IL-6, soluble glycoprotein 130 (sgp-130) and heme oxygenase-1 (HO-1)], oxidative stress [8-iso-prostaglandin (8-IsoP)] and neurodevelopment [brain-derived neurotrophic factor (BDNF)] were quantified. TBT increased P4 slightly but had little or no effect on T or E2 production. IL-1β, IL-6, sgp-130, IL-10 and 8-IsoP production was enhanced by TBT. P4 and IL-6 production was also enhanced by TBT for bacteria-stimulated cultures but TBT significantly inhibited bacteria-induced IL-1β and sgp-130 production. High doses of TBT also inhibited BDNF production. TBT increases P4 but has minimal effect on downstream steroids. It enhances the production of inflammatory biomarkers such as IL-1β, TNF-α, IL-10 and IL-6. Inhibition of sgp-130 by TBT suggests that TBT may increase bioactive IL-6 production which has been associated with adverse neurodevelopmental outcomes. Reduced expression of BDNF also supports this possibility.
Enhanced Soundings for Local Coupling Studies Field Campaign Report
Energy Technology Data Exchange (ETDEWEB)
Ferguson, Craig R [University at Albany, State University of New York; Santanello, Joseph A [NASA Goddard Space Flight Center (GSFC), Greenbelt, MD (United States); Gentine, Pierre [Columbia Univ., New York, NY (United States)
2016-04-01
This document presents initial analyses of the enhanced radiosonde observations obtained during the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility Enhanced Soundings for Local Coupling Studies Field Campaign (ESLCS), which took place at the ARM Southern Great Plains (SGP) Central Facility (CF) from June 15 to August 31, 2015. During ESLCS, routine 4-times-daily radiosonde measurements at the ARM-SGP CF were augmented on 12 days (June 18 and 29; July 11, 14, 19, and 26; August 15, 16, 21, 25, 26, and 27) with daytime 1-hourly radiosondes and 10-minute ‘trailer’ radiosondes every 3 hours. These 12 intensive operational period (IOP) days were selected on the basis of prior-day qualitative forecasts of potential land-atmosphere coupling strength. The campaign captured 2 dry soil convection advantage days (June 29 and July 14) and 10 atmospherically controlled days. Other noteworthy IOP events include: 2 soil dry-down sequences (July 11-14-19 and August 21-25-26), a 2-day clear-sky case (August 15-16), and the passing of Tropical Storm Bill (June 18). To date, the ESLCS data set constitutes the highest-temporal-resolution sampling of the evolution of the daytime planetary boundary layer (PBL) using radiosondes at the ARM-SGP. The data set is expected to contribute to: 1) improved understanding and modeling of the diurnal evolution of the PBL, particularly with regard to the role of local soil wetness, and (2) new insights into the appropriateness of current ARM-SGP CF thermodynamic sampling strategies.
Diurnal Cycle of ITCZ Convection during the MJO Suppressed Phase in DYNAMO
Ciesielski, P. E.; Johnson, R. H.; Schubert, W. H.
2017-12-01
During the special observing period of the Dynamics of the MJO (DYNAMO) experiment, conducted over the Indian Ocean from 1 October to 30 November 2011, two sounding arrays - one north and one south of the equator, referred to here as the NSA and SSA, respectively - took 4-8 soundings/day. We augment this 3-h dataset with observations of radiation and rainfall to investigate the diurnal cycle of convection during the suppressed phase of the October MJO. During this 14-day period when convection was suppressed over the NSA but prominent over the SSA, the circulation over the sounding arrays could be characterized as a local Hadley cell embedded within a monsoonal flow. Strong rising motion was present within the ITCZ and compensating subsidence over the NSA. A prominent diurnal pulsing of this cell was observed, impacting conditions on both sides of the equator, with the cell running strongest in the early morning hours (05-08 LT) and notably weakening later in the day (17-20LT). The reduction in evening subsidence over the NSA may have assisted the moistening of the low to mid-troposphere there during the pre-onset stage of the MJO. Apparent heating Q1 within the ITCZ exhibits a diurnal evolution from early morning bottom-heavy profiles to weaker daytime top-heavy profiles. Making use of the weak temperature gradient approximation, results suggest that direct radiative effects played a dominant role in controlling diurnal variations of vertical motion and convection within the ITCZ while non-radiative processes were more prominent over the NSA.
The Expanding Spectrum of Espionage by Americans, 1947-2015
2017-08-01
ended. Some variables were included for identification and documentary purposes only and were not used for analysis. Some were qualifying...handler and serves as a link to the ultimate recipient. The role of handler is a demanding and delicate one that requires managing the spy’s...NSA contractor Glenn Greenwald, a reporter for The Guardian, and Laura Poitras, a documentary filmmaker Details of NSA domestic surveillance
Microwave and Millimeter-Wave Radiometric Studies of Temperature, Water Vapor and Clouds
Energy Technology Data Exchange (ETDEWEB)
Westwater, Edgeworth
2011-05-06
The importance of accurate measurements of column amounts of water vapor and cloud liquid has been well documented by scientists within the Atmospheric Radiation Measurement (ARM) Program. At the North Slope of Alaska (NSA), both microwave radiometers (MWR) and the MWRProfiler (MWRP), been used operationally by ARM for passive retrievals of the quantities: Precipitable Water Vapor (PWV) and Liquid Water Path (LWP). However, it has been convincingly shown that these instruments are inadequate to measure low amounts of PWV and LWP. In the case of water vapor, this is especially important during the Arctic winter, when PWV is frequently less than 2 mm. For low amounts of LWP (< 50 g/m{sup 2}), the MWR and MWRP retrievals have an accuracy that is also not acceptable. To address some of these needs, in March-April 2004, NOAA and ARM conducted the NSA Arctic Winter Radiometric Experiment - Water Vapor Intensive Operational Period at the ARM NSA/Adjacent Arctic Ocean (NSA/AAO) site. After this experiment, the radiometer group at NOAA moved to the Center for Environmental Technology (CET) of the Department of Electrical and Computer Engineering of the University of Colorado at Boulder. During this 2004 experiment, a total of 220 radiosondes were launched, and radiometric data from 22.235 to 380 GHz were obtained. Primary instruments included the ARM MWR and MWRP, a Global Positioning System (GPS), as well as the CET Ground-based Scanning Radiometer (GSR). We have analyzed data from these instruments to answer several questions of importance to ARM, including: (a) techniques for improved water vapor measurements; (b) improved calibration techniques during cloudy conditions; (c) the spectral response of radiometers to a variety of conditions: clear, liquid, ice, and mixed phase clouds; and (d) forward modeling of microwave and millimeter wave brightness temperatures from 22 to 380 GHz. Many of these results have been published in the open literature. During the third year of
Serum erythropoietin level in anemic and non-anemic nephrotic children with normal kidney functions
International Nuclear Information System (INIS)
Moustafa, A.M.E.; Moawad, A.T.; Gad, A.A.; Ahmed, S.M.
2005-01-01
Nephrotic syndrome (NS) is associated with a significant alteration in protein metabolism. While lowering the concentration of certain proteins, the disease often raises the level of certain other proteins. The current study aimed to investigate the serum erythropoietin (EPO) levels in children with NS either anemic or non-anemic and to compare them to children with iron deficiency anemia (IDA) and healthy controls with normal hemoglobin level (NHB). Sixteen nephrotic children with anemia (NS-A) and 15 nephrotic children with normal hemoglobin level (NS-NHB) were examined and compared with 10 children with iron deficiency anemia (IDA) and 10 healthy controls (NHB). Circulating serum EPO levels, blood indices and iron status were measured in nephrotic patients with anemia (NS-A) and compared to those nephrotic patients with normal HE (NS-NHB). Most NS-A children were steroid resistant. The NS-A children showed greater EPO levels than those without anemia (21.01 ±4.02 mlU/ml versus 9.18 ± 0.79 mlU/ml; P < 0.001) but their response to treatment of anemia was inappropriately low when compared to IDA (EPO 96.9 ±4.9 mlU/ml) despite similar HB concentration. A significant positive correlation was observed between serum EPO and serum albumin in NS-A (r = 0.84, P < 0.001) and in NS-NHB group (r = 0.89, P < 0.001). Moreover, a significant positive correlation was observed between serum EPO and HB in the nephrotic groups indicating a blunted EPO response to anemia in NS-A (r 0.63, P < 0.05) and in NS-NHB group (r = 0.80, P < 0.001). In conclusion, anemia is a common feature of NS and is present even before the worsening of kidney function. Depletion of the iron stores due to loss of iron and transferrin in urine due to massive proteinurea may contribute to the development of anemia, but it was found that iron replacement was ineffective alone
Directory of Open Access Journals (Sweden)
Daniela H. F. Lima
2010-04-01
Full Text Available OBJETIVO: Verificar a concordância inter e intraexaminador, validade construtiva e consistência interna da versão brasileira do instrumento Nottingham Sensory Assessment para hemiparéticos após acidente vascular encefálico (AVE. MÉTODOS: O instrumento foi traduzido para língua portuguesa com base na sua versão original em Inglês por um tradutor bilíngue e, posteriormente, revertido para a língua inglesa. Vinte e um hemiparéticos foram avaliados por dois examinadores pela Avaliação Sensorial de Nottingham para pacientes pós-AVE (ASN e pelo Protocolo de Desempenho Físico de Fugl-Meyer (FM. RESULTADOS: Foi encontrada correlação entre os instrumentos FM e ASN (0,752; excelente consistência interna da ASN (0,86; excelentes coeficientes de concordância interexaminador e intraexaminador para todos os itens da ASN, exceto temperatura e efeito teto significativo para ASN e FM. CONCLUSÃO: A versão brasileira da Nottingham Sensory Assessment cumpriu os critérios de concordância, consistência interna e validade concorrente, sendo um instrumento de rápida e fácil aplicação, podendo ser utilizada nos ambulatórios de neuroreabilitação para avaliar a função sensorial pós-AVE. O efeito teto significativo da ASN não limita seu uso, tendo em vista que, para os mesmos pacientes, o Protocolo de Fugl-Meyer também revelou efeito teto.OBJECTIVES: To investigate the inter-rater and intra-rater reliability, construct validity and internal consistency of the Brazilian version of the Nottingham Sensory Assessment for Stroke Patients (NSA. METHODS: The instrument was translated into Portuguese from its original in English by a bilingual translator and was then back-translated into English. Twenty-one hemiparetics were evaluated by two examiners using the NSA and the Fugl-Meyer Assessment (FMA of physical performance. RESULTS: Significant correlation were found between the FMA and the NSA (r=0.752. The NSA showed excellent internal
Characterizing the Vertical Distribution of Aerosols using Ground-based Multiwavelength Lidar Data
Ferrare, R. A.; Thorsen, T. J.; Clayton, M.; Mueller, D.; Chemyakin, E.; Burton, S. P.; Goldsmith, J.; Holz, R.; Kuehn, R.; Eloranta, E. W.; Marais, W.; Newsom, R. K.; Liu, X.; Sawamura, P.; Holben, B. N.; Hostetler, C. A.
2016-12-01
Observations of aerosol optical and microphysical properties are critical for developing and evaluating aerosol transport model parameterizations and assessing global aerosol-radiation impacts on climate. During the Combined HSRL And Raman lidar Measurement Study (CHARMS), we investigated the synergistic use of ground-based Raman lidar and High Spectral Resolution Lidar (HSRL) measurements to retrieve aerosol properties aloft. Continuous (24/7) operation of these co-located lidars during the ten-week CHARMS mission (mid-July through September 2015) allowed the acquisition of a unique, multiwavelength ground-based lidar dataset for studying aerosol properties above the Southern Great Plains (SGP) site. The ARM Raman lidar measured profiles of aerosol backscatter, extinction and depolarization at 355 nm as well as profiles of water vapor mixing ratio and temperature. The University of Wisconsin HSRL simultaneously measured profiles of aerosol backscatter, extinction and depolarization at 532 nm and aerosol backscatter at 1064 nm. Recent advances in both lidar retrieval theory and algorithm development demonstrate that vertically-resolved retrievals using such multiwavelength lidar measurements of aerosol backscatter and extinction can help constrain both the aerosol optical (e.g. complex refractive index, scattering, etc.) and microphysical properties (e.g. effective radius, concentrations) as well as provide qualitative aerosol classification. Based on this work, the NASA Langley Research Center (LaRC) HSRL group developed automated algorithms for classifying and retrieving aerosol optical and microphysical properties, demonstrated these retrievals using data from the unique NASA/LaRC airborne multiwavelength HSRL-2 system, and validated the results using coincident airborne in situ data. We apply these algorithms to the CHARMS multiwavelength (Raman+HSRL) lidar dataset to retrieve aerosol properties above the SGP site. We present some profiles of aerosol effective
Determination of neuronal antibodies in suspected and definite Creutzfeldt-Jakob disease
Grau-Rivera, O.; Sánchez del Valle Díaz, Raquel; Saiz Hinajeros, Albert; Molinuevo, José L.; Bernabé, Reyes; Munteis, Elvira; Pujadas, Francesc; Salvador, Antoni; Saura, Júlia; Ugarte, Antonio; Titulaer, Maarten; Dalmau Obrador, Josep; Graus Ribas, Francesc
2014-01-01
IMPORTANCE Creutzfeldt-Jakob disease (CJD) and autoimmune encephalitis with antibodies against neuronal surface antigens (NSA-abs) may present with similar clinical features. Establishing the correct diagnosis has practical implications in the management of care for these patients. OBJECTIVE To determine the frequency of NSA-abs in the cerebrospinal fluid of patients with suspected CJD and in patients with pathologically confirmed (ie, definite) CJD. DESIGN, SETTING, AND PARTICIPANTS A mixed ...
Shedding of soluble glycoprotein 1 detected during acute Lassa virus infection in human subjects.
Branco, Luis M; Grove, Jessica N; Moses, Lina M; Goba, Augustine; Fullah, Mohammed; Momoh, Mambu; Schoepp, Randal J; Bausch, Daniel G; Garry, Robert F
2010-11-09
Lassa hemorrhagic fever (LHF) is a neglected tropical disease with significant impact on the health care system, society, and economy of Western and Central African nations where it is endemic. With a high rate of infection that may lead to morbidity and mortality, understanding how the virus interacts with the host's immune system is of great importance for generating vaccines and therapeutics. Previous work by our group identified a soluble isoform of the Lassa virus (LASV) GP1 (sGP1) in vitro resulting from the expression of the glycoprotein complex (GPC) gene [1, 2]. Though no work has directly been done to demonstrate the function of this soluble isoform in arenaviral infections, evidence points to immunomodulatory effects against the host's immune system mediated by a secreted glycoprotein component in filoviruses, another class of hemorrhagic fever-causing viruses. A significant fraction of shed glycoprotein isoforms during viral infection and biogenesis may attenuate the host's inflammatory response, thereby enhancing viral replication and tissue damage. Such shed glycoprotein mediated effects were previously reported for Ebola virus (EBOV), a filovirus that also causes hemorrhagic fever with nearly 90 percent fatality rates [3 - 5]. The identification of an analogous phenomenon in vivo could establish a new correlate of LHF infection leading to the development of sensitive diagnostics targeting the earliest molecular events of the disease. Additionally, the reversal of potentially untoward immunomodulatory functions mediated by sGP1 could potentiate the development of novel therapeutic intervention. To this end, we investigated the presence of sGP1 in the serum of suspected LASV patients admitted to the Kenema Government Hospital (KGH) Lassa Fever Ward (LFW), in Kenema, Sierra Leone that tested positive for viral antigen or displayed classical signs of Lassa fever. It is reasonable to expect that a narrow window exists for detection of sGP1 as the sole
Hong, Z.; Hasan, E.; Hong, Y.; Xia, B.; Zhong, H.
2016-12-01
This study is a contribution to how NASA's Gravity Recovery and Climate Experiment (GRACE) data may be used to track anthropogenic related change in the groundwater in the Southern Great Plains (SGP) as well recently increased seismicity in the southern states. The SGP contains one of the most important groundwater aquifers in the United States, the Ogallala groundwater aquifer, which has been exploited since 1900. Meanwhile, the recent activities of oil and gas extraction from the unconventional shall reservoir systems has led to significantly increased groundwater withdrawal and injection of wastewater. Consequently, numerous induced fracture related earthquakes have been recorded in Oklahoma and Texas between 2002 and 2016 The current paper investigates the utility of GRACE data along with the Land Water Content (LWC) information from the Global Land Data Assimilation System (GLDAS) to monitor and track the groundwater changes in three southern states of SGP (Oklahoma, Texas and New Mexico). Additionally, the paper investigates links between active seismicity and the injection of the wastewater due to the oil and gas production. Using GRACE data yields unprecedented information about the inter-annual changes in the Total Water Storage (TWS) from 2002 to 2016 over SGP. The LWC data set sums the soil moisture records with the the total canopy water storage to reveal the total land surface water content. The arithmetic difference between the TWS and LWC is the Groundwater Anomaly (GWA) for any particular region. In the current study, the GWA analysis reveals the following: (1) statistically significant drop of the GWA of about - 27 mm from 2002 to 2007 due to natural and anthropogenic causes; (2) the increased precipitation records from 2008 to 2011 over SGP leads to significant recovery in TWS and an increase in the groundwater content of about 40 mm; (3) the period from 2012 to 2015 experienced increased GWA of about - 6 mm for the period. Using the available
Su, Hua
2014-02-22
The Southern Great Plains (SGP) has been shown as a region of significant soil moisture-precipitation (S-P) coupling. However, how strong evapotranspiration (ET) can affect regional precipitation remains largely unclear, impeding a full grasp of the S-P feedback in that area. The current study seeks to unravel, in a spring month (April), the potential role played by large-scale atmospheric conditions in shaping S (ET)-P feedback. Our regional climate modeling experiments demonstrate that the presence of anomalous low (high) pressure and cyclonic (anticyclonic) flows at the upper/middle troposphere over the relevant areas is associated with strongest (minimum) positive S-P feedback in the SGP. Their impacts are interpreted in terms of large-scale atmospheric dynamical disturbance, including the intensity and location of synoptic eddies. Further analyses of the vertical velocity fields corroborate these interpretations. In addition, the relationship between lower tropospheric moisture conditions (including winds) and feedback composites is evaluated. Key Points The S-P feedback strength in SGP in April varies inter-annually The atmospheric dynamic features affect significantly the feedback strength composite moisture conditions are related to atmospheric circulation structure ©2014. American Geophysical Union. All Rights Reserved.
[Role of aerodynamic parameters in voice function assessment].
Guo, Yong-qing; Lin, Sheng-zhi; Xu, Xin-lin; Zhou, Li; Zhuang, Pei-yun; Jiang, Jack J
2012-10-01
To investigate the application and significance of aerodynamic parameters in voice function assessment. The phonatory aerodynamic system (PAS) was used to collect aerodynamic parameters from subjects with normal voice, vocal fold polyp, vocal fold cyst, and vocal fold immobility. Multivariate statistical analysis was used to compare measurements across groups. Phonation threshold flow (PTF), mean flow rate (MFR), maximum phonation time (MPT), and glottal resistance (GR) in one hundred normal subjects were significantly affected by sex (P efficiency (VE) were not (P > 0.05). PTP, PTF, MFR, SGP, and MPT were significantly different between normal voice and voice disorders (P 0.05). Receiver operating characteristic (ROC) analysis found that PTP, PTF, SGP, MFR, MPT, and VE in one hundred thirteen voice dis orders had similar diagnostic utility (P aerodynamic parameters of the three degrees of voice dysfunction due to vocal cord polyps were compared and found to have no significant differences (P > 0.05). PTP, PTF, MFR, SGP and MPT in forty one patients with vocal polyps were significantly different after surgical resection of vocal cord polyps (P aerodynamic parameters can objectively and effectively evaluate the variations of vocal function, and have good auxiliary diagnostic value.
Su, Hua; Yang, Zong-Liang; Dickinson, Robert E.; Wei, Jiangfeng
2014-01-01
The Southern Great Plains (SGP) has been shown as a region of significant soil moisture-precipitation (S-P) coupling. However, how strong evapotranspiration (ET) can affect regional precipitation remains largely unclear, impeding a full grasp of the S-P feedback in that area. The current study seeks to unravel, in a spring month (April), the potential role played by large-scale atmospheric conditions in shaping S (ET)-P feedback. Our regional climate modeling experiments demonstrate that the presence of anomalous low (high) pressure and cyclonic (anticyclonic) flows at the upper/middle troposphere over the relevant areas is associated with strongest (minimum) positive S-P feedback in the SGP. Their impacts are interpreted in terms of large-scale atmospheric dynamical disturbance, including the intensity and location of synoptic eddies. Further analyses of the vertical velocity fields corroborate these interpretations. In addition, the relationship between lower tropospheric moisture conditions (including winds) and feedback composites is evaluated. Key Points The S-P feedback strength in SGP in April varies inter-annually The atmospheric dynamic features affect significantly the feedback strength composite moisture conditions are related to atmospheric circulation structure ©2014. American Geophysical Union. All Rights Reserved.
Lifescience Database Archive (English)
Full Text Available lcy*dlikirikn*pkqnllntlremailhtlivikflklltwiktdvflqmnykngskk eelitqewflqevqivkfsw...ilfykvlkfgt*kkkkik*ifnffk*sy*lylf* gk Frame B: ---gr*yf*gitgswcfvfns*sgp*w*ihisrnc*vlcrrgkkkmlnkmlrllhwlmlk
The neck shaft angle: CT reference values of 800 adult hips
Energy Technology Data Exchange (ETDEWEB)
Boese, Christoph Kolja; Jostmeier, Janine; Oppermann, Johannes; Dargel, Jens; Eysel, Peer [University Hospital of Cologne, Department of Orthopaedic and Trauma Surgery, Cologne (Germany); Chang, De-Hua [University Hospital of Cologne, Department of Radiology and Neuroradiology, Cologne (Germany); Lechler, Philipp [University of Giessen and Marburg, Center of Orthopedic and Trauma Surgery, Marburg (Germany)
2016-04-15
A precise understanding of the radiological anatomy and biomechanics as well as reliable reference values of the hip are essential. The primary goal of this study was to provide reference values of the neck-shaft angle (NSA) for adult patients based on the analysis of rotation corrected computed tomography (CT) scans of 800 hips. The secondary aim was to compare these measurements with simulated anteroposterior roentgenograms of the pelvis. Pelvic CT scans of 400 patients (54.3 years, range 18-100 years; 200 female) were reconstructed in the derotated coronal plane of the proximal femur and as CT-based simulated anteroposterior roentgenograms of the pelvis in the anterior pelvic plane. Femora were categorized as coxa vara (<120 ), physiologic (≥120 to <135 ), and coxa valga (≥135 ). Intra- and inter-rater reliability were analyzed. Primary research question: Mean NSA for male adults was 129.6 (range 113.2 -148.2 ; SD 5.9 ) and 131.9 (range 107.1 -151.9 ; SD 6.8 ) for females in derotated coronal reconstructions. Age (p < 0.001 in both views) and sex influenced the NSA significantly (p = 0.002 and p < 0.001); no significant differences were found between sides (p = 0.722 and p = 0.955). Overall, an excellent reliability of repeated measurements of one or two observers was found (ICC 0.891-0.995). Secondary research question: NSA values measured in the simulated anteroposterior roentgenogram and the rotation corrected coronal reconstruction differed significantly (p < 0.001). While anteroposterior pelvis radiographs are susceptible to rotational errors, the coronal reconstruction of the proximal femur in the femoral neck plane allows the correct measurement of the NSA. (orig.)
The neck shaft angle: CT reference values of 800 adult hips
International Nuclear Information System (INIS)
Boese, Christoph Kolja; Jostmeier, Janine; Oppermann, Johannes; Dargel, Jens; Eysel, Peer; Chang, De-Hua; Lechler, Philipp
2016-01-01
A precise understanding of the radiological anatomy and biomechanics as well as reliable reference values of the hip are essential. The primary goal of this study was to provide reference values of the neck-shaft angle (NSA) for adult patients based on the analysis of rotation corrected computed tomography (CT) scans of 800 hips. The secondary aim was to compare these measurements with simulated anteroposterior roentgenograms of the pelvis. Pelvic CT scans of 400 patients (54.3 years, range 18-100 years; 200 female) were reconstructed in the derotated coronal plane of the proximal femur and as CT-based simulated anteroposterior roentgenograms of the pelvis in the anterior pelvic plane. Femora were categorized as coxa vara (<120 ), physiologic (≥120 to <135 ), and coxa valga (≥135 ). Intra- and inter-rater reliability were analyzed. Primary research question: Mean NSA for male adults was 129.6 (range 113.2 -148.2 ; SD 5.9 ) and 131.9 (range 107.1 -151.9 ; SD 6.8 ) for females in derotated coronal reconstructions. Age (p < 0.001 in both views) and sex influenced the NSA significantly (p = 0.002 and p < 0.001); no significant differences were found between sides (p = 0.722 and p = 0.955). Overall, an excellent reliability of repeated measurements of one or two observers was found (ICC 0.891-0.995). Secondary research question: NSA values measured in the simulated anteroposterior roentgenogram and the rotation corrected coronal reconstruction differed significantly (p < 0.001). While anteroposterior pelvis radiographs are susceptible to rotational errors, the coronal reconstruction of the proximal femur in the femoral neck plane allows the correct measurement of the NSA. (orig.)
Grzybowska, Magdalena Emilia; Piaskowska-Cala, Justyna; Wydra, Dariusz Grzegorz
2017-12-29
The aim of the study was to translate into Polish the Pelvic Organ Prolapse/Incontinence Sexual Questionnaire, IUGA-Revised (PISQ-IR), which evaluates sexual function in sexually active (SA) and not SA (NSA) women with pelvic floor disorders (PFD), and to validate the Polish version. After translation, back-translation and cognitive interviews, the final version of PISQ-IR was established. The study group included 252 women with PFD (124 NSA and 128 SA). All women underwent clinical evaluation and completed the PISQ-IR. For test-retest reliability, the questionnaire was administered to 99 patients twice at an interval of 2 weeks. The analysis of criterion validity required the subjects to complete self-reported measures. Internal consistency and criterion validity were assessed separately for NSA and SA women for the PISQ-IR subscales. The mean age of the women was 60.9 ± 10.6 years and their mean BMI was 27.9 ± 4.9 kg/m 2 . Postmenopausal women constituted 82.5% of the study group. Urinary incontinence (UI) was diagnosed in 60 women (23.8%), pelvic organ prolapse (POP) in 90 (35.7%), and UI and POP in 102 (40.5%). Fecal incontinence was reported by 45 women (17.9%). The PISQ-IR Polish version proved to have good internal consistency in NSA women (α 0.651 to 0.857) and SA women (α 0.605 to 0.887), and strong reliability in all subscales (Pearson's coefficient 0.759-0.899; p NSA women. The PISQ-IR Polish version is a valid tool for evaluating sexual function in women with PFD.
Emissions from pre-Hispanic metallurgy in the South American atmosphere.
Directory of Open Access Journals (Sweden)
François De Vleeschouwer
Full Text Available Metallurgical activities have been undertaken in northern South America (NSA for millennia. However, it is still unknown how far atmospheric emissions from these activities have been transported. Since the timing of metallurgical activities is currently estimated from scarce archaeological discoveries, the availability of reliable and continuous records to refine the timing of past metal deposition in South America is essential, as it provides an alternative to discontinuous archives, as well as evidence for global trace metal transport. We show in a peat record from Tierra del Fuego that anthropogenic metals likely have been emitted into the atmosphere and transported from NSA to southern South America (SSA over the last 4200 yrs. These findings are supported by modern time back-trajectories from NSA to SSA. We further show that apparent anthropogenic Cu and Sb emissions predate any archaeological evidence for metallurgical activities. Lead and Sn were also emitted into the atmosphere as by-products of Inca and Spanish metallurgy, whereas local coal-gold rushes and the industrial revolution contributed to local contamination. We suggest that the onset of pre-Hispanic metallurgical activities is earlier than previously reported from archaeological records and that atmospheric emissions of metals were transported from NSA to SSA.
Emissions from pre-Hispanic metallurgy in the South American atmosphere.
De Vleeschouwer, François; Vanneste, Heleen; Mauquoy, Dmitri; Piotrowska, Natalia; Torrejón, Fernando; Roland, Thomas; Stein, Ariel; Le Roux, Gaël
2014-01-01
Metallurgical activities have been undertaken in northern South America (NSA) for millennia. However, it is still unknown how far atmospheric emissions from these activities have been transported. Since the timing of metallurgical activities is currently estimated from scarce archaeological discoveries, the availability of reliable and continuous records to refine the timing of past metal deposition in South America is essential, as it provides an alternative to discontinuous archives, as well as evidence for global trace metal transport. We show in a peat record from Tierra del Fuego that anthropogenic metals likely have been emitted into the atmosphere and transported from NSA to southern South America (SSA) over the last 4200 yrs. These findings are supported by modern time back-trajectories from NSA to SSA. We further show that apparent anthropogenic Cu and Sb emissions predate any archaeological evidence for metallurgical activities. Lead and Sn were also emitted into the atmosphere as by-products of Inca and Spanish metallurgy, whereas local coal-gold rushes and the industrial revolution contributed to local contamination. We suggest that the onset of pre-Hispanic metallurgical activities is earlier than previously reported from archaeological records and that atmospheric emissions of metals were transported from NSA to SSA.
Multiple new-particle growth pathways observed at the US DOE Southern Great Plains field site
Directory of Open Access Journals (Sweden)
A. L. Hodshire
2016-07-01
Full Text Available New-particle formation (NPF is a significant source of aerosol particles into the atmosphere. However, these particles are initially too small to have climatic importance and must grow, primarily through net uptake of low-volatility species, from diameters ∼ 1 to 30–100 nm in order to potentially impact climate. There are currently uncertainties in the physical and chemical processes associated with the growth of these freshly formed particles that lead to uncertainties in aerosol-climate modeling. Four main pathways for new-particle growth have been identified: condensation of sulfuric-acid vapor (and associated bases when available, condensation of organic vapors, uptake of organic acids through acid–base chemistry in the particle phase, and accretion of organic molecules in the particle phase to create a lower-volatility compound that then contributes to the aerosol mass. The relative importance of each pathway is uncertain and is the focus of this work. The 2013 New Particle Formation Study (NPFS measurement campaign took place at the DOE Southern Great Plains (SGP facility in Lamont, Oklahoma, during spring 2013. Measured gas- and particle-phase compositions during these new-particle growth events suggest three distinct growth pathways: (1 growth by primarily organics, (2 growth by primarily sulfuric acid and ammonia, and (3 growth by primarily sulfuric acid and associated bases and organics. To supplement the measurements, we used the particle growth model MABNAG (Model for Acid–Base chemistry in NAnoparticle Growth to gain further insight into the growth processes on these 3 days at SGP. MABNAG simulates growth from (1 sulfuric-acid condensation (and subsequent salt formation with ammonia or amines, (2 near-irreversible condensation from nonreactive extremely low-volatility organic compounds (ELVOCs, and (3 organic-acid condensation and subsequent salt formation with ammonia or amines. MABNAG is able to corroborate the
International Nuclear Information System (INIS)
Ivannikov, Alexander I.; Khailov, Artem M.; Orlenko, Sergey P.; Skvortsov, Valeri G.; Stepanenko, Valeri F.; Zhumadilov, Kassym Sh.; Williams, Benjamin B.; Flood, Ann B.; Swartz, Harold M.
2016-01-01
The aim of the study is to determine the average intensity and variation of the native background signal amplitude (NSA) and of the solar light-induced signal amplitude (LSA) in electron paramagnetic resonance (EPR) spectra of tooth enamel for different kinds of teeth and different groups of people. These values are necessary for determination of the intensity of the radiation-induced signal amplitude (RSA) by subtraction of the expected NSA and LSA from the total signal amplitude measured in L-band for in vivo EPR dosimetry. Variation of these signals should be taken into account when estimating the uncertainty of the estimated RSA. A new analysis of several hundred EPR spectra that were measured earlier at X-band in a large-scale examination of the population of the Central Russia was performed. Based on this analysis, the average values and the variation (standard deviation, SD) of the amplitude of the NSA for the teeth from different positions, as well as LSA in outer enamel of the front teeth for different population groups, were determined. To convert data acquired at X-band to values corresponding to the conditions of measurement at L-band, the experimental dependencies of the intensities of the RSA, LSA and NSA on the m.w. power, measured at both X and L-band, were analysed. For the two central upper incisors, which are mainly used in in vivo dosimetry, the mean LSA annual rate induced only in the outer side enamel and its variation were obtained as 10 ± 2 (SD = 8) mGy y"-"1, the same for X- and L-bands (results are presented as the mean ± error of mean). Mean NSA in enamel and its variation for the upper incisors was calculated at 2.0 ± 0.2 (SD = 0.5) Gy, relative to the calibrated RSA dose-response to gamma radiation measured under non-power saturation conditions at X-band. Assuming the same value for L-band under non-power saturating conditions, then for in vivo measurements at L-band at 25 mW (power saturation conditions), a mean NSA and its
2015-06-12
Agency by Edward Snowden exposed only intelligence collection activities, and not means and methods of cyberspace operations under Title 10 and Joint...Kopstein, Joshua. 2014. “How the NSA Recruits in a Post- Snowden World.” The Daily Beast. Accessed May 6, 2015. http://www.thedailybeast.com...articles/ 2014/01/17/how-the-nsa-recruits-in-a-post- snowden -world.html. Koyfman, Tanya. 2014. “Ukraine versus Russia in a Cyber-Duel.” SenseCy. Accessed
Oliver, June; Coggins, Candace; Compton, Peggy; Hagan, Susan; Matteliano, Deborah; Stanton, Marsha; St. Marie, Barbara; Strobbe, Stephen; Turner, Helen N.
2012-01-01
The American Society for Pain Management Nursing (ASPMN) has updated its position statement on managing pain in patients with substance use disorders. This position statement is endorsed by the International Nurses Society on Addictions (IntNSA) and includes clinical practice recommendations based on current evidence. It is the position of ASPMN and IntNSA that every patient with pain, including those with substance use disorders, has the right to be treated with dignity, respect, and high qu...
Polyaniline nanotubes and their dendrites doped with different naphthalene sulfonic acids
International Nuclear Information System (INIS)
Zhang Zhiming; Wei Zhixiang; Zhang Lijuan; Wan Meixiang
2005-01-01
Polyaniline (PANI) nanotubes (130-250 nm in average diameter) doped with α-naphthalene sulfonic acid (α-NSA), β-naphthalene sulfonic acid (β-NSA) and 1,5-naphthalene disulfonic acid were synthesized via a self-assembly process. It was found that the formation yield, morphology (hollow or solid), size, crystalline and electrical properties of the nanostructures are affected by the position and number of -SO 3 H groups attached to the naphthalene ring of NSA as well as the synthesis conditions. Moreover, these nanotubes aggregate to form a dendritic morphology when the polymerization is performed at a static state. The micelles composed of dopant or dopant/anilinium cations might act in a template-like fashion in forming self-assembled PANI nanotubes, which was further confirmed by X-ray diffraction measurements, while the aggregated morphology of the nanotubes might result from polymer chain interactions including π-π interactions, hydrogen and ionic bonds
International Nuclear Information System (INIS)
Li Zhe; Liu Min; Shi Rui; Wu Xuemei; Tuo Xianguo
2012-01-01
Background: Non-standard analysis (NSA) technique is one of the most important development directions of energy dispersive X-ray fluorescence (EDXRF). Purpose: This NSA technique is mainly based on Monte Carlo (MC) simulation and full energy peak broadening, which were studied preliminarily in this paper. Methods: A kind of MC model was established for Si-PIN based EDXRF setup, and the flux spectra were obtained for iron ore sample. Finally, the flux spectra were broadened by Gaussian broaden parameters calculated by a new method proposed in this paper, and the broadened spectra were compared with measured energy spectra. Results: MC method can be used to simulate EDXRF measurement, and can correct the matrix effects among elements automatically. Peak intensities can be obtained accurately by using the proposed Gaussian broaden technique. Conclusions: This study provided a key technique for EDXRF to achieve advanced NSA technology. (authors)
An exploration of diffusion tensor eigenvector variability within human calf muscles.
Rockel, Conrad; Noseworthy, Michael D
2016-01-01
To explore the effect of diffusion tensor imaging (DTI) acquisition parameters on principal and minor eigenvector stability within human lower leg skeletal muscles. Lower leg muscles were evaluated in seven healthy subjects at 3T using an 8-channel transmit/receive coil. Diffusion-encoding was performed with nine signal averages (NSA) using 6, 15, and 25 directions (NDD). Individual DTI volumes were combined into aggregate volumes of 3, 2, and 1 NSA according to number of directions. Tensor eigenvalues (λ1 , λ2 , λ3 ), eigenvectors (ε1 , ε2 , ε3 ), and DTI metrics (fractional anisotropy [FA] and mean diffusivity [MD]) were calculated for each combination of NSA and NDD. Spatial maps of signal-to-noise ratio (SNR), λ3 :λ2 ratio, and zenith angle were also calculated for region of interest (ROI) analysis of vector orientation consistency. ε1 variability was only moderately related to ε2 variability (r = 0.4045). Variation of ε1 was affected by NDD, not NSA (P < 0.0002), while variation of ε2 was affected by NSA, not NDD (P < 0.0003). In terms of tensor shape, vector variability was weakly related to FA (ε1 :r = -0.1854, ε2 : ns), but had a stronger relation to the λ3 :λ2 ratio (ε1 :r = -0.5221, ε2 :r = -0.1771). Vector variability was also weakly related to SNR (ε1 :r = -0.2873, ε2 :r = -0.3483). Zenith angle was found to be strongly associated with variability of ε1 (r = 0.8048) but only weakly with that of ε2 (r = 0.2135). The second eigenvector (ε2 ) displayed higher directional variability relative to ε1 , and was only marginally affected by experimental conditions that impacted ε1 variability. © 2015 Wiley Periodicals, Inc.
Shedding of soluble glycoprotein 1 detected during acute Lassa virus infection in human subjects
Directory of Open Access Journals (Sweden)
Momoh Mambu
2010-11-01
Full Text Available Abstract Background Lassa hemorrhagic fever (LHF is a neglected tropical disease with significant impact on the health care system, society, and economy of Western and Central African nations where it is endemic. With a high rate of infection that may lead to morbidity and mortality, understanding how the virus interacts with the host's immune system is of great importance for generating vaccines and therapeutics. Previous work by our group identified a soluble isoform of the Lassa virus (LASV GP1 (sGP1 in vitro resulting from the expression of the glycoprotein complex (GPC gene 12. Though no work has directly been done to demonstrate the function of this soluble isoform in arenaviral infections, evidence points to immunomodulatory effects against the host's immune system mediated by a secreted glycoprotein component in filoviruses, another class of hemorrhagic fever-causing viruses. A significant fraction of shed glycoprotein isoforms during viral infection and biogenesis may attenuate the host's inflammatory response, thereby enhancing viral replication and tissue damage. Such shed glycoprotein mediated effects were previously reported for Ebola virus (EBOV, a filovirus that also causes hemorrhagic fever with nearly 90% fatality rates 345. The identification of an analogous phenomenon in vivo could establish a new correlate of LHF infection leading to the development of sensitive diagnostics targeting the earliest molecular events of the disease. Additionally, the reversal of potentially untoward immunomodulatory functions mediated by sGP1 could potentiate the development of novel therapeutic intervention. To this end, we investigated the presence of sGP1 in the serum of suspected LASV patients admitted to the Kenema Government Hospital (KGH Lassa Fever Ward (LFW, in Kenema, Sierra Leone that tested positive for viral antigen or displayed classical signs of Lassa fever. Results It is reasonable to expect that a narrow window exists for
Interface width effect on the classical Rayleigh-Taylor instability in the weakly nonlinear regime
International Nuclear Information System (INIS)
Wang, L. F.; Ye, W. H.; Li, Y. J.
2010-01-01
In this paper, the interface width effects (i.e., the density gradient effects or the density transition layer effects) on the Rayleigh-Taylor instability (RTI) in the weakly nonlinear (WN) regime are investigated by numerical simulation (NS). It is found that the interface width effects dramatically influence the linear growth rate in the linear growth regime and the mode coupling process in the WN growth regime. First, the interface width effects decrease the linear growth rate of the RTI, particularly for the short perturbation wavelengths. Second, the interface width effects suppress (reduce) the third-order feedback to the fundamental mode, which induces the nonlinear saturation amplitude (NSA) to exceed the classical prediction, 0.1λ. The wider the density transition layer is, the larger the NSA is. The NSA in our NS can reach a half of its perturbation wavelength. Finally, the interface width effects suppress the generation and the growth of the second and the third harmonics. The ability to suppress the harmonics' growth increases with the interface width but decreases with the perturbation wavelength. On the whole, in the WN regime, the interface width effects stabilize the RTI, except for an enhancement of the NSA, which is expected to improve the understanding of the formation mechanism for the astrophysical jets, and for the jetlike long spikes in the high energy density physics.
Polonsky, I. N.; Davis, A. B.; Love, S. P.
2004-05-01
WAIL was designed to determine physical and geometrical characteristics of optically thick clouds using the off-beam component of the lidar return that can be accurately modeled within the 3D photon diffusion approximation. The theory shows that the WAIL signal depends not only on the cloud optical characteristics (phase function, extinction and scattering coefficients) but also on the outer thickness of the cloud layer. This makes it possible to estimate the mean optical and geometrical thicknesses of the cloud. The comparison with Monte Carlo simulation demonstrates the high accuracy of the diffusion approximation for moderately to very dense clouds. During operation WAIL is able to collect a complete data set from a cloud every few minutes, with averaging over horizontal scale of a kilometer or so. In order to validate WAIL's ability to deliver cloud properties, the LANL instrument was deployed as a part of the THickness from Off-beam Returns (THOR) validation IOP. The goal was to probe clouds above the SGP CART site at night in March 2002 from below (WAIL and ARM instruments) and from NASA's P3 aircraft (carrying THOR, the GSFC counterpart of WAIL) flying above the clouds. The permanent cloud instruments we used to compare with the results obtained from WAIL were ARM's laser ceilometer, micro-pulse lidar (MPL), millimeter-wavelength cloud radar (MMCR), and micro-wave radiometer (MWR). The comparison shows that, in spite of an unusually low cloud ceiling, an unfavorable observation condition for WAIL's present configuration, cloud properties obtained from the new instrument are in good agreement with their counterparts obtained by other instruments. So WAIL can duplicate, at least for single-layer clouds, the cloud products of the MWR and MMCR together. But WAIL does this with green laser light, which is far more representative than microwaves of photon transport processes at work in the climate system.
Sky cover from MFRSR observations
Directory of Open Access Journals (Sweden)
E. Kassianov
2011-07-01
Full Text Available The diffuse all-sky surface irradiances measured at two nearby wavelengths in the visible spectral range and their modeled clear-sky counterparts are the main components of a new method for estimating the fractional sky cover of different cloud types, including cumuli. The performance of this method is illustrated using 1-min resolution data from a ground-based Multi-Filter Rotating Shadowband Radiometer (MFRSR. The MFRSR data are collected at the US Department of Energy Atmospheric Radiation Measurement (ARM Climate Research Facility (ACRF Southern Great Plains (SGP site during the summer of 2007 and represent 13 days with cumuli. Good agreement is obtained between estimated values of the fractional sky cover and those provided by a well-established independent method based on broadband observations.
Site specific information in site selection
International Nuclear Information System (INIS)
Aeikaes, T.; Hautojaervi, A.
1998-01-01
The programme for the siting of a deep repository for final disposal of spent nuclear fuel was started already in 1983 and is carried out today by Posiva Oy which continues the work started by Teollisuuden Voima Oy. The programme aims at site selection by the end of the year 2000. The programme has progressed in successive interim stages with defined goals. After an early phase for site identification, five sites were selected in 1987 for preliminary site characterisation. Three of these were selected and judged to be best suited for the more detailed characterisation in 1992. An additional new site was included into the programme based on a separate feasibility study in the beginning of 1997. Since the year 1983 several safety assessments together with technical plans of the facility have been completed. When approaching the site selection the needs for more detailed consideration of the site specific properties in the safety assessment have been increased. The Finnish regulator STUK has published a proposal for general safety requirements for the final disposal of spent nuclear fuel in Finland. This set of requirements has been projected to be used in conjunction of the decision making by the end 2000. Based on the site evaluation all sites can provide a stable environment and there is evidence that the requirements for the longevity of the canister can be fulfilled at each site. In this manner the four candidate sites do not differ too much from each other. The main difference between the sites is in the salinity of the deep groundwater. The significance of differences in the salinity for the long-term safety cannot be defined yet. The differences may contribute to the discussion of the longevity of the bentonite buffer and also to the modelling of the groundwater flow and transport. The use of the geosphere as a transport barrier is basically culminated on the questions about sparse but fast flow routes and 'how bad channeling can be'. To answer these questions
Li, Hao; Ma, Yong; Liang, Kun; Tian, Yong; Wang, Rui
2012-01-01
Wavelet parameters (e.g., wavelet type, level of decomposition) affect the performance of the wavelet denoising algorithm in hyperspectral applications. Current studies select the best wavelet parameters for a single spectral curve by comparing similarity criteria such as spectral angle (SA). However, the method to find the best parameters for a spectral library that contains multiple spectra has not been studied. In this paper, a criterion named normalized spectral angle (NSA) is proposed. By comparing NSA, the best combination of parameters for a spectral library can be selected. Moreover, a fast algorithm based on threshold constraint and machine learning is developed to reduce the time of a full search. After several iterations of learning, the combination of parameters that constantly surpasses a threshold is selected. The experiments proved that by using the NSA criterion, the SA values decreased significantly, and the fast algorithm could save 80% time consumption, while the denoising performance was not obviously impaired.
Is the intercloud medium pervasive
International Nuclear Information System (INIS)
Heiles, C.
1980-01-01
We consider the pervasiveness of the ''not strongly absorbing'' (NSA) H I gas, which is the intercloud medium in steady state theories of the interstellar medium. We study the question by analyzing wide emission components in nearby gas, and the absence of absorption components in distant gas. We conclude that the NSA material is deficient in the immediately local solar vicinity. In nearby regions it contains 38% of the interstellar H I; it is generally pervasive and often has internal motions which greatly increase its velocity dispersion above the 5 km s -1 minimum value. It contains large holes, perhaps ranging up to 400 pc diameter, which probably occupy 10--20% of the volume. In distant regions the NSA material seems to be pervasive outside 8 kpc galactic radius. For galactic radii between 8 and 10 kpc its thickness agrees with previous determinations of 370 pc for nearby regions. Outside 10 kpc the thickness increases dramatically. Inside 8 kpc there are no data
Site organization and site arrangement
International Nuclear Information System (INIS)
Boissonnet, B.; Macqueron, J.F.
1976-01-01
The present paper deals with criteria for the choice of a production unit or power plant site, the organization and development of a site in terms of its particular characteristics and takes into account personnel considerations in site organizations as well as the problem of integrating the architecture into the environment. (RW) [de
Directory of Open Access Journals (Sweden)
Crispin Maalu-Bungi
2012-01-01
Full Text Available
Le cilubà est l’une des quatre langues nationales congolaises parlée au centre-sud du pays. Elle a acquis le statut de langue écrite depuis la fin du 19ème siècle et possède à ce jour plusieurs ouvrages lexicographiques dont le premier, daté de 1881, est un lexique ciluba-allemand réalisé par un explorateur allemand. Nkòngamyakù Cilubà–Mfwàlànsa est un dictionnaire bilingue élaboré par NgoSemzara Kabuta, professeur de linguistique et littérature africaines à l’Université de Gand, dans le triple but de compléter et combler les lacunes du dernier dictionnaire du genre publié en 1960 par un prêtre catholique, rendre compte de l’évolution de la langue et proposer la forme standard du cilubà tel qu’il doit être utilisé dans les communications institutionnelles, notamment dans l’enseignement. Par rapport aux ouvrages des prédécesseurs, missionnaires et agents territoriaux, ce nouvel outil de référence apporte plusieurs innovations, dont principale-ment: l’existence du dictionnaire sous formats électronique et support papier, l’augmentation du nombre d’entrées de 10 000 à 16 000, l’utilisation d’une orthographe simple, pratique et efficace susceptible de faciliter la lecture comme l’apprentissage de la langue, le nombre significatif de paramètres et de justifications sur chaque entrée pour en rendre la compréhension plus aisée, l’ajout d’un abrégé de grammaire, entièrement en cilubà, une manière de contribuer au développement, à la promotion et à l’enrichissement de cette langue à travers notamment la terminologie grammaticale. Malgré les erreurs dues à son caractère novateur, cet ouvrage lexicographique dont la valeur est, à divers égards, incontestable, constitue une réponse à l’appel lancé naguère aux dictionnairistes africains, singulièrement bantu, en faveur de travaux plus complets.
Hall, Forrest G. (Editor); Nickeson, Jaime (Editor); Harding, D. J.; Blair, J. B.; Rabine, D. L.; Still, K. L.
2000-01-01
SLICER data were acquired in support of BOREAS at all of the TF sites in the SSA and NSA, and along transects between the study areas. Data were acquired on 5 days between 18-Jul and 30-Jul-1996. Each coverage of a tower site is typically 40 km in length, with a minimum of 3 and a maximum of 10 lines across each tower oriented in a variety of azimuths. The SLICER data were acquired simultaneously with ASAS hyperspectral, multiview angle images. The SLICER Level 3 products consist of binary files for each flight line with a data record for each laser shot composed of 13 parameters and a 600-byte waveform that is the raw record of the backscatter laser energy reflected from Earth's surface. The SLICER data are stored in a combination of ASCII and binary data files.
ARM Enhanced Shortwave Experiment (ARESE) Solar Radiation Data
National Aeronautics and Space Administration — The ARM Enhanced Shortwave Experiment (ARESE) was conducted at the Department of Energy's ARM Southern Great Plains (SGP) Central Facility between September 22, 1995...
Shaw, J. A.; Nugent, P. W.
2016-12-01
Ground-based longwave-infrared (LWIR) cloud imaging can provide continuous cloud measurements in the Arctic. This is of particular importance during the Arctic winter when visible wavelength cloud imaging systems cannot operate. This method uses a thermal infrared camera to observe clouds and produce measurements of cloud amount and cloud optical depth. The Montana State University Optical Remote Sensor Laboratory deployed an infrared cloud imager (ICI) at the Atmospheric Radiation Monitoring North Slope of Alaska site at Barrow, AK from July 2012 through July 2014. This study was used to both understand the long-term operation of an ICI in the Arctic and to study the consistency of the ICI data products in relation to co-located active and passive sensors. The ICI was found to have a high correlation (> 0.92) with collocated cloud instruments and to produce an unbiased data product. However, the ICI also detects thin clouds that are not detected by most operational cloud sensors. Comparisons with high-sensitivity actively sensed cloud products confirm the existence of these thin clouds. Infrared cloud imaging systems can serve a critical role in developing our understanding of cloud cover in the Arctic by provided a continuous annual measurement of clouds at sites of interest.
The Space Geodesy Project and Radio Frequency Interference Characterization and Mitigation
Lawrence, Hilliard M.; Beaudoin, C.; Corey, B. E.; Tourain, C. L.; Petrachenko, B.; Dickey, John
2013-01-01
The Space Geodesy Project (SGP) development by NASA is an effort to co-locate the four international geodetic techniques Satellite Laser Ranging (SLR) and Lunar Laser Ranging (LLR), Very Long Baseline Interferometry (VLBI), Global Navigation Satellite System (GNSS), and Doppler Orbitography and Radiopositioning Integrated by Satellite (DORIS) into one tightly referenced campus and coordinated reference frame analysis. The SGP requirement locates these stations within a small area to maintain line-of-sight and frequent automated survey known as the vector tie system. This causes a direct conflict with the new broadband VLBI technique. Broadband means 2-14 GHz, and RFI susceptibility at -80 dBW or higher due to sensitive RF components in the front end of the radio receiver.
Ivannikov, Alexander I; Khailov, Artem M; Orlenko, Sergey P; Skvortsov, Valeri G; Stepanenko, Valeri F; Zhumadilov, Kassym Sh; Williams, Benjamin B; Flood, Ann B; Swartz, Harold M
2016-12-01
The aim of the study is to determine the average intensity and variation of the native background signal amplitude (NSA) and of the solar light-induced signal amplitude (LSA) in electron paramagnetic resonance (EPR) spectra of tooth enamel for different kinds of teeth and different groups of people. These values are necessary for determination of the intensity of the radiation-induced signal amplitude (RSA) by subtraction of the expected NSA and LSA from the total signal amplitude measured in L-band for in vivo EPR dosimetry. Variation of these signals should be taken into account when estimating the uncertainty of the estimated RSA. A new analysis of several hundred EPR spectra that were measured earlier at X-band in a large-scale examination of the population of the Central Russia was performed. Based on this analysis, the average values and the variation (standard deviation, SD) of the amplitude of the NSA for the teeth from different positions, as well as LSA in outer enamel of the front teeth for different population groups, were determined. To convert data acquired at X-band to values corresponding to the conditions of measurement at L-band, the experimental dependencies of the intensities of the RSA, LSA and NSA on the m.w. power, measured at both X and L-band, were analysed. For the two central upper incisors, which are mainly used in in vivo dosimetry, the mean LSA annual rate induced only in the outer side enamel and its variation were obtained as 10 ± 2 (SD = 8) mGy y -1 , the same for X- and L-bands (results are presented as the mean ± error of mean). Mean NSA in enamel and its variation for the upper incisors was calculated at 2.0 ± 0.2 (SD = 0.5) Gy, relative to the calibrated RSA dose-response to gamma radiation measured under non-power saturation conditions at X-band. Assuming the same value for L-band under non-power saturating conditions, then for in vivo measurements at L-band at 25 mW (power saturation conditions), a mean NSA and its
Influence of muscle groups' activation on proximal femoral growth tendency.
Yadav, Priti; Shefelbine, Sandra J; Pontén, Eva; Gutierrez-Farewik, Elena M
2017-12-01
Muscle and joint contact force influence stresses at the proximal growth plate of the femur and thus bone growth, affecting the neck shaft angle (NSA) and femoral anteversion (FA). This study aims to illustrate how different muscle groups' activation during gait affects NSA and FA development in able-bodied children. Subject-specific femur models were developed for three able-bodied children (ages 6, 7, and 11 years) using magnetic resonance images. Contributions of different muscle groups-hip flexors, hip extensors, hip adductors, hip abductors, and knee extensors-to overall hip contact force were computed. Specific growth rate for the growth plate was computed, and the growth was simulated in the principal stress direction at each element in the growth front. The predicted growth indicated decreased NSA and FA (of about [Formula: see text] over a four-month period) for able-bodied children. Hip abductors contributed the most, and hip adductors, the least, to growth rate. All muscles groups contributed to a decrease in predicted NSA ([Formula: see text]0.01[Formula: see text]-0.04[Formula: see text] and FA ([Formula: see text]0.004[Formula: see text]-[Formula: see text]), except hip extensors and hip adductors, which showed a tendency to increase the FA ([Formula: see text]0.004[Formula: see text]-[Formula: see text]). Understanding influences of different muscle groups on long bone growth tendency can help in treatment planning for growing children with affected gait.
Mochales López, Tania; Pueyo Morer, Emilio L.; Casas Sanz, Antonio
2011-01-01
El interés científico que tradicionalmente ha suscitado la cuenca de Aínsa reside en la configuración oblicua de sus estructuras, implicadas en un contexto sintectónico caracterizado por el registro continuo de la secuencia estratigráfica Eocena. Por otra parte, el mundo de la investigación petrolera también ha centrado sus estudios en esta zona debido a que la secuencia turbidítica de la cuenca de Aínsa constituye un modelo análogo de reservorio excepcionalmente conservado. Dentro de este co...
Badalyan, O. G.; Obridko, V. N.
2017-07-01
Context. Since the occurrence of north-south asymmetry (NSA) of alternating sign may be determined by different mechanisms, the frequency and amplitude characteristics of this phenomenon should be considered separately. Aims: We propose a new approach to the description of the NSA of solar activity. Methods: The asymmetry defined as A = (N-S)/(N + S) (where N and S are, respectively, the indices of activity of the northern and southern hemispheres) is treated as a superposition of two functions: the sign of asymmetry (signature) and its absolute value (modulus). This approach is applied to the analysis of the NSA of sunspot group areas for the period 1874-2013. Results: We show that the sign of asymmetry provides information on the behavior of the asymmetry. In particular, it displays quasi-periodic variation with a period of 12 yr and quasi-biennial oscillations as the asymmetry itself. The statistics of the so-called monochrome intervals (long periods of positive or negative asymmetry) are considered and it is shown that the distribution of these intervals is described by the random distribution law. This means that the dynamo mechanisms governing the cyclic variation of solar activity must involve random processes. At the same time, the asymmetry modulus has completely different statistical properties and is probably associated with processes that determine the amplitude of the cycle. One can reliably isolate an 11-yr cycle in the behavior of the asymmetry absolute value shifted by half a period with respect to the Wolf numbers. It is shown that the asymmetry modulus has a significant prognostic value: the higher the maximum of the asymmetry modulus, the lower the following Wolf number maximum. Conclusions: A fundamental nature of this concept of NSA is discussed in the context of the general methodology of cognizing the world. It is supposed that the proposed description of the NSA will help clarify the nature of this phenomenon.
Directory of Open Access Journals (Sweden)
Cesilia Meti Dwiriani
2012-11-01
Full Text Available This study was aimed to analyze the effect of multi-micronutrients (MMN supplementation and nutrition education on nutrition knowledge, mean adequacy ratio (MAR and iron status of young adolescent girls (YAG. The study was done in three purposively selected junior high schools (JHS in rural Bogor by implementing a quasi experiment control trial for 112 YAG for 16 weeks: thirty five YAG in the first JHS as a MMN group (SG were given three times of MMN tablets per week, forty two YAG in the second JHS were given MMN tablet plus nutrition education delivered by trained teacher fortnightly called SGP group and thirty five YAG in the third JHS as a control group. The result showed that the increment of nutrition knowledge score as well as MAR of SGP group were significantly higher than the other two groups. The decrement level of hemoglobin (Hb in SG and SGP groups was significantly lower than in control group, but in the subset data of anemic group, both intervention groups had significantly increased level of Hb. This imply that nutrition education improved nutrition knowledge of YAG, but MMN tablet could not improve Hb level in general and only had effect on YAG suffering from anemia.Key words: multi-micro nutrients, nutrition education, iron status, adolescent girls
Blanco, Gabriela S.; Quintana, Flavio
2014-08-01
To study habitat use and at-sea movements of southern giant petrels (SGP) during non-breeding period, we deployed 15 satellite transmitters (six adults, nine juveniles) at Isla Arce and Isla Gran Robredo colonies in Patagonia, Argentina. Birds were instrumented during 81.4 ± 37 days. Adult birds used 74% of the Argentine shelf concentrating mainly at the shelf break, middle shelf waters, and the surroundings of the colony. After fledging, juveniles spread to the Argentine, Uruguayan and Brazilian shelves within the South Atlantic. Adults alternated at-sea excursions (12 ± 5 days) with periods at the colony of 3 ± 0.3 days. Contrarily, juveniles moved first to the shelf break and then traveled northwards reaching the south of Brazil. There was some spatial overlap between age classes, but only during the first 30 days after juveniles had fledged; thereafter there was not overlap between the areas used by both age classes. The Argentine shelf is widely used by different species offering a suitable environment for foraging; this may be why adults SGP from Patagonian colonies spend all year-round within the Argentine shelf. The identification of used areas of non-breeding SGP fills a gap in the species knowledge contributing not only to the preservation the species, but also to the management of marine areas globally recognized as important for many other Procellariiformes.
Directory of Open Access Journals (Sweden)
Jorion Romengga*
2011-12-01
Full Text Available Cross-linked sago starch phosphate (SgP with high phosphorus contents was successfully synthesized by reacting sago with a mixture of primary and secondary sodium phosphates under acidic condition. The experimental variables investigated include pH, temperature, reaction time, and mixture rate. The physicochemical properties evaluated were moisture, swelling power, water binding capacity, transmittance (%T and percent amylose (%Am, while the pasting properties examined were pasting time, pasting temperature, viscosity at peak, final, and setback. The granule structure was observed by scanning electron microscope and X-ray diffraction. The results showed that the maximum degree of phosphate substitution was obtained at pH of 6.50, 40°C, 20 minutes of reaction time and 300 rpm of mixing rate. The physicochemical (%T and %Am and pasting (viscosity at peak, final, and setback properties of SgP were significantly different (P<0.01 from Sg. Structure of SgP was characterized by FT-IR and the results indicated a new absorption peak at 2362.87 cm-1 which was characterized as the phospho-diester (RO-PO3-R’ stretching vibration. In the fingerprint area, there were two new absorption peaks at 1242.05 and 989.79 cm-1 which were characterized as the P=O and C-O-P vibration, respectively. Sago granules were substantially altered after cross-linking.
Directory of Open Access Journals (Sweden)
Helene L Kammoun
Full Text Available Non-alcoholic steatohepatitis (NASH is a liver disease with the potential to lead to cirrhosis and hepatocellular carcinoma. Interleukin-6 (IL-6 has been implicated in the pathogenesis of NASH, with the so-called IL-6 'trans-signaling' cascade being responsible for the pro-inflammatory actions of this cytokine. We aimed to block IL-6 'trans-signaling', using a transgenic mouse that overexpresses human soluble glycoprotein130 (sgp130Fc Tg mice fed a commonly used dietary model of inducing NASH (methionine and choline deficient-diet; MCD diet and hypothesized that markers of NASH would be ameliorated in such mice. Sgp130Fc Tg and littermate control mice were fed a MCD or control diet for 4 weeks. The MCD diet induced many hallmarks of NASH including hepatomegaly, steatosis, and liver inflammation. However, in contrast with other mouse models and, indeed, human NASH, the MCD diet model did not increase the mRNA or protein expression of IL-6. Not surprisingly, therefore, markers of MCD diet-induced NASH were unaffected by sgp130Fc transgenic expression. While the MCD diet model induces many pathophysiological markers of NASH, it does not induce increased IL-6 expression in the liver, a key hallmark of human NASH. We, therefore, caution the use of the MCD diet as a viable mouse model of NASH.
International Nuclear Information System (INIS)
1993-01-01
In August 1991, the Joint Contractors came to agreement with Sandia National Laboratories (SNL) and the Department of Energy (DOE) on a workscope for the cost-shared Early Site Permit Demonstration Program. One task within the scope was the development of a guide for site selection criteria and procedures. A generic Siting Guide his been prepared that is a roadmap and tool for applicants to use developing detailed siting plans for their specific region of the country. The guide presents three fundamental principles that, if used, ensure a high degree of success for an ESP applicant. First, the site selection process should take into consideration environmentally diverse site locations within a given region of interest. Second, the process should contain appropriate opportunities for input from the public. Third, the process should be applied so that it is clearly reasonable to an impartial observer, based on appropriately selected criteria, including criteria which demonstrate that the site can host an advanced light water reactor (ALWR). The Siting Guide provides for a systematic, comprehensive site selection process in which three basic types of criteria (exclusionary, avoidance, and suitability) are presented via a four-step procedure. It provides a check list of the criteria for each one of these steps. Criteria are applied qualitatively, as well as presented numerically, within the guide. The applicant should use the generic guide as an exhaustive checklist, customizing the guide to his individual situation
Directory of Open Access Journals (Sweden)
Ling Ye
Full Text Available Several conserved neutralizing epitopes have been identified in the HIV Env protein and among these, the MPER of gp41 has received great attention and is widely recognized as a promising target. However, little success has been achieved in eliciting MPER-specific HIV neutralizing antibodies by a number of different vaccine strategies. We investigated the ability of HA/gp41 chimeric protein-based vaccines, which were designed to enhance the exposure of the MPER in its native conformation, to induce MPER-specific HIV neutralizing antibodies. In characterization of the HA/gp41 chimeric protein, we found that by mutating an unpaired Cys residue (Cys-14 in its HA1 subunit to a Ser residue, the modified chimeric protein HA-C14S/gp41 showed increased reactivity to a conformation-sensitive monoclonal antibody against HA and formed more stable trimers in VLPs. On the other hand, HA-C14S/gp41 and HA/gp41 chimeric proteins expressed on the cell surfaces exhibited similar reactivity to monoclonal antibodies 2F5 and 4E10. Immunization of guinea pigs using the HA-C14S/gp41 DNA or VLP vaccines induced antibodies against the HIV gp41 as well as to a peptide corresponding to a segment of MPER at higher levels than immunization by standard HIV VLPs. Further, sera from vaccinated guinea pigs were found to exhibit HIV neutralizing activities. Moreover, sera from guinea pigs vaccinated by HA-C14S/gp41 DNA and VLP vaccines but not the standard HIV VLPs, were found to neutralize HIV pseudovirions containing a SIV-4E10 chimeric Env protein. The virus neutralization could be blocked by a MPER-specific peptide, thus demonstrating induction of MPER-specific HIV neutralizing antibodies by this novel vaccine strategy. These results show that induction of MPER-specific HIV neutralizing antibodies can be achieved through a rationally designed vaccine strategy.
A distributed biosphere hydrological model, the so called water and energy budget-based distributed hydrological model (WEB-DHM), has been developed by fully coupling a biosphere scheme (SiB2) with a geomorphology-based hydrological model (GBHM). SiB2 describes the transfer of turbulent fluxes (ener...
Dong, Xiquan; Xi, Baike; Qiu, Shaoyue; Minnis, Patrick; Sun-Mack, Sunny; Rose, Fred
2016-09-01
Retrievals of cloud microphysical properties based on passive satellite imagery are especially difficult over snow-covered surfaces because of the bright and cold surface. To help quantify their uncertainties, single-layered overcast liquid-phase Arctic stratus cloud microphysical properties retrieved by using the Clouds and the Earth's Radiant Energy System Edition 2 and Edition 4 (CERES Ed2 and Ed4) algorithms are compared with ground-based retrievals at the Atmospheric Radiation Measurement North Slope of Alaska (ARM NSA) site at Barrow, AK, during the period from March 2000 to December 2006. A total of 206 and 140 snow-free cases (Rsfc ≤ 0.3), and 108 and 106 snow cases (Rsfc > 0.3), respectively, were selected from Terra and Aqua satellite passes over the ARM NSA site. The CERES Ed4 and Ed2 optical depth (τ) and liquid water path (LWP) retrievals from both Terra and Aqua are almost identical and have excellent agreement with ARM retrievals under snow-free and snow conditions. In order to reach a radiation closure study for both the surface and top of atmosphere (TOA) radiation budgets, the ARM precision spectral pyranometer-measured surface albedos were adjusted (63.6% and 80% of the ARM surface albedos for snow-free and snow cases, respectively) to account for the water and land components of the domain of 30 km × 30 km. Most of the radiative transfer model calculated SW↓sfc and SW↑TOA fluxes by using ARM and CERES cloud retrievals and the domain mean albedos as input agree with the ARM and CERES flux observations within 10 W m-2 for both snow-free and snow conditions. Sensitivity studies show that the ARM LWP and re retrievals are less dependent on solar zenith angle (SZA), but all retrieved optical depths increase with SZA.
Soil Temperature and Moisture Profile (STAMP) System Handbook
Energy Technology Data Exchange (ETDEWEB)
Cook, David R. [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-11-01
The soil temperature and moisture profile system (STAMP) provides vertical profiles of soil temperature, soil water content (soil-type specific and loam type), plant water availability, soil conductivity, and real dielectric permittivity as a function of depth below the ground surface at half-hourly intervals, and precipitation at one-minute intervals. The profiles are measured directly by in situ probes at all extended facilities of the SGP climate research site. The profiles are derived from measurements of soil energy conductivity. Atmospheric scientists use the data in climate models to determine boundary conditions and to estimate the surface energy flux. The data are also useful to hydrologists, soil scientists, and agricultural scientists for determining the state of the soil. The STAMP system replaced the SWATS system in early 2016.
Soil Water and Temperature System (SWATS) Instrument Handbook
Energy Technology Data Exchange (ETDEWEB)
Cook, David R. [Argonne National Lab. (ANL), Argonne, IL (United States)
2016-04-01
The soil water and temperature system (SWATS) provides vertical profiles of soil temperature, soil-water potential, and soil moisture as a function of depth below the ground surface at hourly intervals. The temperature profiles are measured directly by in situ sensors at the Central Facility and many of the extended facilities of the U.S. Department of Energy (DOE)’s Atmospheric Radiation Measurement (ARM) Climate Research Facility Southern Great Plains (SGP) site. The soil-water potential and soil moisture profiles are derived from measurements of soil temperature rise in response to small inputs of heat. Atmospheric scientists use the data in climate models to determine boundary conditions and to estimate the surface energy flux. The data are also useful to hydrologists, soil scientists, and agricultural scientists for determining the state of the soil.
Site Closure Strategy Model for Creosote Site
International Nuclear Information System (INIS)
Coll, F.R.; Gray, D.R.
2009-01-01
In conjunction with RCRA site corrective action at an active wood preserving facility, a risk-based site closure strategy was developed and incorporated the performance of a dense non-aqueous phase liquid (DNAPL) source recovery remedy, a monitored natural attenuation (MNA) remedy for dissolved phase groundwater, and institutional controls. Innovative creosote DNAPL source recovery has been undertaken at the Site since 1998. Pooled creosote DNAPL is present 90 feet below ground within a transmissive sand and gravel aquifer with a saturated thickness of approximately 80 feet. The creosote DNAPL source is situated on the property boundary of the site and has generated a 1/2 mile off-site dissolved phase plume, creating significant NAPL management and remedial technology verification issues. To date, over 120,000 gallons of creosote DNAPL have been recovered from the subsurface utilizing a modified circulation well technology. A mass discharge flux protocol was developed to serve as a major performance metrics for the continuation of source removal efforts and to support the application of monitored natural attenuation as an associated remedial technology for groundwater. The mass removal success has supported the MNA remedy for dissolved phase groundwater and the associated development of institutional controls. The enacted site management strategy outlines the current and future risk management activities for the Site and represents an appropriate site closure strategy for the Site. (authors)
Equivalence of the Traditional and Non-Standard Definitions of Concepts from Real Analysis
Directory of Open Access Journals (Sweden)
John Cowles
2014-06-01
Full Text Available ACL2(r is a variant of ACL2 that supports the irrational real and complex numbers. Its logical foundation is based on internal set theory (IST, an axiomatic formalization of non-standard analysis (NSA. Familiar ideas from analysis, such as continuity, differentiability, and integrability, are defined quite differently in NSA–some would argue the NSA definitions are more intuitive. In previous work, we have adopted the NSA definitions in ACL2(r, and simply taken as granted that these are equivalent to the traditional analysis notions, e.g., to the familiar epsilon-delta definitions. However, we argue in this paper that there are circumstances when the more traditional definitions are advantageous in the setting of ACL2(r, precisely because the traditional notions are classical, so they are unencumbered by IST limitations on inference rules such as induction or the use of pseudo-lambda terms in functional instantiation. To address this concern, we describe a formal proof in ACL2(r of the equivalence of the traditional and non-standards definitions of these notions.
BOREAS TE-9 In Situ Understory Spectral Reflectance Within the NSA
Hall, Forrest G. (Editor); Curd, Shelaine (Editor); Supronowicz, Jan; Edwards, Geoffrey; Viau, Alain; Thomson, Keith
2000-01-01
The Boreal Ecosystem-Atmospheric Study (BOREAS) TE-9 (Terrestrial Ecology) team collected several data sets related to chemical and photosynthetic properties of leaves in boreal forest tree species. Spectral reflection coefficients of the forest understory at the ground level, in three boreal forest sites of Northern Manitoba (56 N latitude and 98 W longitude), were obtained and analyzed in 1994. In particular, angular variation of the reflection coefficients in the old jack pine and young jack pine forests, as well as nadir reflection coefficient in the young aspen forest, were investigated. The complexity of understory composition and the light patterns limited quantitative conclusions; however, a number of interesting trends in the behavior of the measured values can be inferred. In particular, the unique spectral profiles of lichens show very strongly in the old jack pine understory, yet are definitely less conspicuous for young jack pine, and virtually absent in the aspen forest. The angular variation of the reflection coefficient by the young pine understory seems to be significantly toned down by fine-structured branches and their shadows. Our study also indicates how difficult the ground reflection coefficient problem in a forest is, compared to certain previously investigated areas that have a more uniform appearance, such as prairie grassland, bare soil, or agricultural crops. This is due to several factors, generally typical of a forest environment, that may influence the overall understory reflection coefficient, including: (1) a strong diversity of the forest floor due to the presence of dead tree trunks, holes in the ground, patches of different types of vegetation or litter, etc.; (2) pronounced 3-D structures at the ground level, such as shrubs, bushes, and young trees; and (3) an irregular shadow mosaic, which not only varies with the time of the day, causing intensity variations, but likely also effectively modifies the spectrum of the
Study of site layout in the Rokkasho site
International Nuclear Information System (INIS)
Sato, Kazuyoshi; Tamura, Kousaku; Yagenji, Akira; Sekiya, Shigeki; Takahashi, Hideo; Neyatani, Yuzuru; Uehara, Masaharu; Motohashi, Keiichi; Hashimoto, Masayoshi; Ogino, Shunji; Nagamatsu, Nobuhide
2006-03-01
The Final Design Report (FDR) of the International Thermonuclear Experimental Reactor (ITER) was published on July 2001 as a summary of the Engineering Design Activity (EDA). After the EDA, site dependent design has been investigated for the invitation of ITER toward Rokkasho Site (Iyasakadai area) in Aomori prefecture. This report describes the results of site layout of major buildings and structures of ITER in the Rokkasho-Site. The data of the ground near the site and the results of site dependent design in Japan were applied to this study. Through this study, the most appropriate site layout has been constructed with satisfaction of following conditions. (1) Bedrock level at the tokamak complex building is relatively high and it can be reduced the cost of excavation and foundation work. (2) Total amount of excavation soil for site preparation is minimized and the flexibility of the layout is ensured with flat ground level. (3) Accessibility of human and equipments, reduction of noise and vibration to the environment can be obtained. Total length of ducts and piping between buildings in site is minimized. (author)
Energy Technology Data Exchange (ETDEWEB)
Alexander P. Trishchenko; Yi Luo; Konstantin V. Khlopenkov, William M. Park; Zhanqing Li; Maureen Cribb
2008-11-28
Surface spectral reflectance (albedo) is a fundamental variable affecting the transfer of solar radiation and the Earth’s climate. It determines the proportion of solar energy absorbed by the surface and reflected back to the atmosphere. The International Panel on Climate Change (IPCC) identified surface albedo among key factors influencing climate radiative forcing. Accurate knowledge of surface reflective properties is important for advancing weather forecasting and climate change impact studies. It is also important for determining radiative impact and acceptable levels of greenhouse gases in the atmosphere, which makes this work strongly linked to major scientific objectives of the Climate Change Research Division (CCRD) and Atmospheric Radiation Measurement (ARM) Program. Most significant accomplishments of eth project are listed below. I) Surface albedo/BRDF datasets from 1995 to the end of 2004 have been produced. They were made available to the ARM community and other interested users through the CCRS public ftp site ftp://ftp.ccrs.nrcan.gc.ca/ad/CCRS_ARM/ and ARM IOP data archive under “PI data Trishchenko”. II) Surface albedo properties over the ARM SGP area have been described for 10-year period. Comparison with ECMWF data product showed some deficiencies in the ECMWF surface scheme, such as missing some seasonal variability and no dependence on sky-conditions which biases surface energy budget and has some influence of the diurnal cycle of upward radiation and atmospheric absorption. III) Four surface albedo Intensive Observation Period (IOP) Field Campaigns have been conducted for every season (August, 2002, May 2003, February 2004 and October 2004). Data have been prepared, documented and transferred to ARM IOP archive. Nine peer-reviewed journal papers and 26 conference papers have been published.
International Nuclear Information System (INIS)
Simmonds, J.R.; Linsley, G.S.
1982-01-01
The Normalised Specific Activity (NSA), a quantity which relates the concentration of a contaminant per unit mass of vegetation to its daily rate of ground deposition, has been used as the basis for determining interception factors and retention half-lives for radioactive contaminants deposited on grain and leafy vegetables. The values are for use in assessing contamination levels on crops at harvest during condition of continuous deposition. The approach implicitly takes account of other processes which influence foliar contamination, namely, translocation and dilution due to plant growth. The respective NSA values for grain and prepared leafy vegetables determined from several separate experimental studies are fairly constant and are of about the same level for fall-out strontium and caesium. There is evidence from previous studies on herbage to suggest that similar NSA values might be expected for other contaminants on grain and leafy vegetables. Plutonium is an exception in that NSA values for grain and prepared leafy vegetables are lower than those for the fission products by factors of between 5 and 10 depending upon the source of the contaminant. Consideration has been given to determining the most appropriate value of the fraction of activity transferred from grain to flour during refining. This is an element dependent parameter and the values estimated for strontium, caesium and plutonium are respectively 0.15, 0.5 and 0.1. The study has indicated the need for data in several areas in order to improve the capability to model interception and retention on field crops in continuous and acute release conditions. (author)
International Nuclear Information System (INIS)
Johnson, E.
1977-01-01
A theory for site-site pair distribution functions of molecular fluids is derived from the Ornstein-Zernike equation. Atom-atom pair distribution functions of this theory which were obtained by using different approximations for the Percus-Yevick site-site direct correlation functions are compared
SitesIdentify: a protein functional site prediction tool
Directory of Open Access Journals (Sweden)
Doig Andrew J
2009-11-01
Full Text Available Abstract Background The rate of protein structures being deposited in the Protein Data Bank surpasses the capacity to experimentally characterise them and therefore computational methods to analyse these structures have become increasingly important. Identifying the region of the protein most likely to be involved in function is useful in order to gain information about its potential role. There are many available approaches to predict functional site, but many are not made available via a publicly-accessible application. Results Here we present a functional site prediction tool (SitesIdentify, based on combining sequence conservation information with geometry-based cleft identification, that is freely available via a web-server. We have shown that SitesIdentify compares favourably to other functional site prediction tools in a comparison of seven methods on a non-redundant set of 237 enzymes with annotated active sites. Conclusion SitesIdentify is able to produce comparable accuracy in predicting functional sites to its closest available counterpart, but in addition achieves improved accuracy for proteins with few characterised homologues. SitesIdentify is available via a webserver at http://www.manchester.ac.uk/bioinformatics/sitesidentify/
DEFF Research Database (Denmark)
Dall, M.; Primdahl, A.; Damborg, F.
2014-01-01
on the observed blood loss and the need for blood transfusions among this group. We compared the blood loss between users of SA, users of non-serotonergic antidepressants (NSA) and non-users, while adjusting for potential confounders using multivariate linear regression. We indentified 1318 patients...... that underwent a THA in the study period. The average volume of surgical bleeding was 350 ml. The adjusted incremental blood loss associated with use of SA and NSA was 93, 95% confidence interval (38-147) ml and -50 (-125 to 25) ml compared with non-use. Only 48 subjects (3.6%) had transfusions. Use of SA...
Holistic Interactions of Shallow Clouds, Aerosols, and Land-Ecosystems (HI-SCALE) Science Plan
Energy Technology Data Exchange (ETDEWEB)
Fast, JD [Pacific Northwest National Laboratory; Berg, LK [Pacific Northwest National Laboratory
2015-12-01
Cumulus convection is an important component in the atmospheric radiation budget and hydrologic cycle over the Southern Great Plains and over many regions of the world, particularly during the summertime growing season when intense turbulence induced by surface radiation couples the land surface to clouds. Current convective cloud parameterizations contain uncertainties resulting in part from insufficient coincident data that couples cloud macrophysical and microphysical properties to inhomogeneities in boundary layer and aerosol properties. The Holistic Interactions of Shallow Clouds, Aerosols, and Land-Ecosystems (HI-SCALE) campaign is designed to provide a detailed set of measurements that are needed to obtain a more complete understanding of the life cycle of shallow clouds by coupling cloud macrophysical and microphysical properties to land surface properties, ecosystems, and aerosols. HI-SCALE consists of 2, 4-week intensive observational periods, one in the spring and the other in the late summer, to take advantage of different stages and distribution of “greenness” for various types of vegetation in the vicinity of the Atmospheric Radiation and Measurement (ARM) Climate Research Facility’s Southern Great Plains (SGP) site as well as aerosol properties that vary during the growing season. Most of the proposed instrumentation will be deployed on the ARM Aerial Facility (AAF) Gulfstream 1 (G-1) aircraft, including those that measure atmospheric turbulence, cloud water content and drop size distributions, aerosol precursor gases, aerosol chemical composition and size distributions, and cloud condensation nuclei concentrations. Routine ARM aerosol measurements made at the surface will be supplemented with aerosol microphysical properties measurements. The G-1 aircraft will complete transects over the SGP Central Facility at multiple altitudes within the boundary layer, within clouds, and above clouds.
Fast, J. D.; Berg, L. K.; Schmid, B.; Alexander, M. L. L.; Bell, D.; D'Ambro, E.; Hubbe, J. M.; Liu, J.; Mei, F.; Pekour, M. S.; Pinterich, T.; Schobesberger, S.; Shilling, J.; Springston, S. R.; Thornton, J. A.; Tomlinson, J. M.; Wang, J.; Zelenyuk, A.
2016-12-01
Cumulus convection is an important component in the atmospheric radiation budget and hydrologic cycle over the southern Great Plains and over many regions of the world, particularly during the summertime growing season when intense turbulence induced by surface radiation couples the land surface to clouds. Current convective cloud parameterizations, however, contain uncertainties resulting from insufficient coincident data that couples cloud macrophysical and microphysical properties to inhomogeneity in surface layer, boundary layer, and aerosol properties. We describe the measurement strategy and preliminary findings from the recent Holistic Interactions of Shallow Clouds, Aerosols, and Land-Ecosystems (HI-SCALE) campaign conducted in May and September of 2016 in the vicinity of the DOE's Atmospheric Radiation Measurement (ARM) Southern Great Plains (SGP) site located in Oklahoma. The goal of the HI-SCALE campaign is to provide a detailed set of aircraft and surface measurements needed to obtain a more complete understanding and improved parameterizations of the lifecycle of shallow clouds. The sampling is done in two periods, one in the spring and the other in the late summer to take advantage of variations in the "greenness" for various types of vegetation, new particle formation, anthropogenic enhancement of biogenic secondary organic aerosol (SOA), and other aerosol properties. The aircraft measurements will be coupled with extensive routine ARM SGP measurements as well as Large Eddy Simulation (LES), cloud resolving, and cloud-system resolving models. Through these integrated analyses and modeling studies, the affects of inhomogeneity in land use, vegetation, soil moisture, convective eddies, and aerosol properties on the evolution of shallow clouds will be determined, including the feedbacks of cloud radiative effects.
Energy Technology Data Exchange (ETDEWEB)
1993-03-24
In August 1991, the Joint Contractors came to agreement with Sandia National Laboratories (SNL) and the Department of Energy (DOE) on a workscope for the cost-shared Early Site Permit Demonstration Program. One task within the scope was the development of a guide for site selection criteria and procedures. A generic Siting Guide his been prepared that is a roadmap and tool for applicants to use developing detailed siting plans for their specific region of the country. The guide presents three fundamental principles that, if used, ensure a high degree of success for an ESP applicant. First, the site selection process should take into consideration environmentally diverse site locations within a given region of interest. Second, the process should contain appropriate opportunities for input from the public. Third, the process should be applied so that it is clearly reasonable to an impartial observer, based on appropriately selected criteria, including criteria which demonstrate that the site can host an advanced light water reactor (ALWR). The Siting Guide provides for a systematic, comprehensive site selection process in which three basic types of criteria (exclusionary, avoidance, and suitability) are presented via a four-step procedure. It provides a check list of the criteria for each one of these steps. Criteria are applied qualitatively, as well as presented numerically, within the guide. The applicant should use the generic guide as an exhaustive checklist, customizing the guide to his individual situation.
Preliminary siting characterization Salt Disposition Facility - Site B
International Nuclear Information System (INIS)
Wyatt, D.
2000-01-01
A siting and reconnaissance geotechnical program has been completed in S-Area at the Savannah River Site in South Carolina. This program investigated the subsurface conditions for the area known as ''Salt Disposition Facility (SDF), Site B'' located northeast of H-Area and within the S-Area. Data acquired from the Site B investigation includes both field exploration and laboratory test data
Automatic web site authoring with SiteGuide
de Boer, V.; Hollink, V.; van Someren, M.W.; Kłopotek, M.A.; Przepiórkowski, A.; Wierzchoń, S.T.; Trojanowski, K.
2009-01-01
An important step in the design process for a web site is to determine which information is to be included and how the information should be organized on the web site’s pages. In this paper we describe ’SiteGuide’, a tool that automatically produces an information architecture for a web site that a
A cloud climatology of the Southern Great Plains ARM CART
Energy Technology Data Exchange (ETDEWEB)
Lazarus, S.M.; Krueger, S.K.; Mace, G.G.
2000-05-15
Cloud amount statistics from three different sources were processed and compared. Surface observations from a National Centers for Environmental Prediction dataset were used. The data (Edited Cloud Report; ECR) consist of synoptic weather reports that have been edited to facilitate cloud analysis. Two stations near the Southern Great Plains (SGP) Cloud and Radiation Test Bed (CART) in north-central Oklahoma (Oklahoma City, Oklahoma and Wichita, Kansas) were selected. The ECR data span a 10-yr period from December 1981 to November 1991. The International Satellite Cloud Climatology Project (ISCCP) provided cloud amounts over the SGP CART for an 8-yr period (1983--91). Cloud amounts were also obtained from Micro Pulse Lidar (MPL) and Belfort Ceilometer (BLC) cloud-base height measurements made at the SGP CART over a 1-yr period. The annual and diurnal cycles of cloud amount as a function of cloud height and type were analyzed. The three datasets closely agree for total cloud amount. Good agreement was found in the ECR and MPL-BLC monthly low cloud amounts. With the exception of summer and midday in other seasons, the ISCCP low cloud amount estimates are generally 5%--10% less than the others. The ECR high cloud amount estimates are typically 10%--15% greater than those obtained from either the ISCCP or MPL-BLC datasets. The observed diurnal variations of altocumulus support the authors' model results of radiatively induced circulations.
International Nuclear Information System (INIS)
Edgeworth R. Westwater; Yong Han
1997-01-01
Previously, the proposers have delivered to ARM a documented algorithm, that is now applied operationally, and which derives water vapor profiles from combined remote sensor measurements of water vapor radiometers, cloud-base ceilometers, and radio acoustic sounding systems (RASS). With the expanded deployment of a Raman lidar at the CART Central Facility, high quality, high vertical-resolution, water vapor profiles will be provided during nighttime clear conditions, and during clear daytime conditions, to somewhat lower altitudes. The object of this proposal was to use Kalman Filtering, previously applied to the combination of nighttime Raman lidar and microwave radiometer data, to derive high-quality water vapor profiles, during non-precipitating conditions, from data routinely available at the CART site. Input data to the algorithm would include: Raman lidar data, highly quality-controlled data of integrated moisture from microwave radiometers and GPS, RASS, and radiosondes. The algorithm will include recently-developed quality control procedures for radiometers. The focus of this years activities has been on the intercomparison of data obtained during an intensive operating period at the SGP CART site in central Oklahoma
Directory of Open Access Journals (Sweden)
Sri Sugiarti2
2012-12-01
Full Text Available Crosslinked-sago-starch-phosphate (SgP has been successfully synthesized from native sago starch (Sg and Na2HPO4-NaH2PO4 in an acidic condition. The compound was designed as bioadsorbent for removing Hg(II inside human digestion tract as shown by in vitro test. The bioadsorption followed pseudo-second order of reaction kinetic and Freundlich equation as chemisorption. As a result, 21% of Hg(II was removed at pH of 6.80 and reached the isothermal equilibrium of the bioadsorption at pH of 5.80 and 8.60 for 29.95% and 31.39%, respectively. The result showed that SgP is more feasible than activated carbon to be used as bioadsorbent in removing Hg(II in human digestion tract as proved by in vitro system.
Space-Time Dynamics of Soil Moisture and Temperature: Scale issues
Mohanty, Binayak P.; Miller, Douglas A.; Th.vanGenuchten, M.
2003-01-01
The goal of this project is to gain further understanding of soil moisture/temperature dynamics at different spatio-temporal scales and physical controls/parameters.We created a comprehensive GIS database, which has been accessed extensively by NASA Land Surface Hydrology investigators (and others), is located at the following URL: http://www.essc.psu.edu/nasalsh. For soil moisture field experiments such as SGP97, SGP99, SMEX02, and SMEX03, cartographic products were designed for multiple applications, both pre- and post-mission. Premission applications included flight line planning and field operations logistics, as well as general insight into the extent and distribution of soil, vegetation, and topographic properties for the study areas. The cartographic products were created from original spatial information resources that were imported into Adobe Illustrator, where the maps were created and PDF versions were made for distribution and download.
Mean-Variance stochastic goal programming for sustainable mutual funds' portfolio selection.
Directory of Open Access Journals (Sweden)
García-Bernabeu, Ana
2015-11-01
Full Text Available Mean-Variance Stochastic Goal Programming models (MV-SGP provide satisficing investment solutions in uncertain contexts. In this work, an MV-SGP model is proposed for portfolio selection which includes goals with regards to traditional and sustainable assets. The proposed approach is based on a two-step procedure. In the first step, sustainability and/or financial screens are applied to a set of assets (mutual funds previously evaluated with TOPSIS to determine the opportunity set. In a second step, satisficing portfolios of assets are obtained using a Goal Programming approach. Two different goals are considered. The first goal reflects only the purely financial side of the target while the second goal is referred to the sustainable side. Aversion to Risk Absolute (ARA coefficients are estimated and incorporated in our investment decision making approach using two different approaches.
Site description of Forsmark at completion of the site investigation phase. SDM-Site Forsmark
Energy Technology Data Exchange (ETDEWEB)
2008-12-15
The Swedish Nuclear Fuel and Waste Management Co., SKB, has undertaken site characterisation in two different areas, Forsmark and Laxemar-Simpevarp, in order to identify a suitable location for a geological repository of spent nuclear fuel according to the KBS-3 method. The site investigations have been conducted in campaigns, punctuated by data freezes. After each data freeze, the site data have been analysed and modelling has been carried out with the overall purpose to develop a site descriptive model (SDM). The site descriptive model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It is also essential for safety assessment, since the model is the only source for site-specific input. Another important use of the site descriptive model is in the environmental impact assessment. An SDM is an integrated model for geology, thermal properties, rock mechanics, hydrogeology, hydrogeochemistry, bedrock transport properties and a description of the surface system. The site descriptive model compiled in the current report, SDM-Site, presents an integrated understanding of the Forsmark area at the completion of the surface-based investigations, which were conducted at Forsmark during the period 2002 to 2007. It also provides a summary of the abundant underlying data and the discipline-specific models that support the site understanding. The description relies heavily on background reports that address, in particular, details in data analyses and modelling in the different disciplines. The Forsmark area is located in northern Uppland within the municipality of Oesthammar, about 120 km north of Stockholm. The candidate area for site investigation is located along the shoreline of Oeregrundsgrepen, within the north-western part of a major tectonic lens that formed between 1.87 and 1.85 billion years ago during the Svecokarelian orogeny. The candidate area is approximately 6 km long and 2 km wide. The
Site description of Laxemar at completion of the site investigation phase. SDM-Site Laxemar
Energy Technology Data Exchange (ETDEWEB)
2009-12-15
The Swedish Nuclear Fuel and Waste Management Company (SKB) has undertaken site characterisation in two different areas, Forsmark and Laxemar-Simpevarp, in order to identify a suitable location for a geological repository of spent nuclear fuel according to the KBS-3 method. The site investigations have been conducted in campaigns, punctuated by data freezes. After each data freeze, the site data have been analysed and modelling has been carried out with the overall purpose to develop a site descriptive model (SDM). The site descriptive model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It is also essential for safety assessment, since the SDM is the only source for site-specific input. Another important use of the site descriptive model is in the environmental impact assessment. An SDM is an integrated model of geology, thermal properties, rock mechanics, hydrogeology, hydrogeochemistry, bedrock transport properties and a description of the surface system. The site descriptive model compiled in the current report, SDM-Site Laxemar, presents an integrated understanding of the Laxemar-Simpevarp area (with special emphasis on the Laxemar subarea) at the completion of the surface-based investigations, which were conducted during the period 2002 to 2007. A summary is also provided of the abundant underlying data and the discipline specific models that support the site understanding. The description relies heavily on background reports that address, in particular, details of the data analyses and modelling of the different disciplines. The Laxemar-Simpevarp area is located in the province of Smaaland within the municipality of Oskarshamn, about 230 km south of Stockholm. The candidate area for site investigation is located along the shoreline of the strait of Kalmarsund, within a 1.8 billion year old suite of well preserved bedrock belonging to the Transscandinavian Igneous Belt formed during
Site description of Laxemar at completion of the site investigation phase. SDM-Site Laxemar
International Nuclear Information System (INIS)
2009-12-01
The Swedish Nuclear Fuel and Waste Management Company (SKB) has undertaken site characterisation in two different areas, Forsmark and Laxemar-Simpevarp, in order to identify a suitable location for a geological repository of spent nuclear fuel according to the KBS-3 method. The site investigations have been conducted in campaigns, punctuated by data freezes. After each data freeze, the site data have been analysed and modelling has been carried out with the overall purpose to develop a site descriptive model (SDM). The site descriptive model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It is also essential for safety assessment, since the SDM is the only source for site-specific input. Another important use of the site descriptive model is in the environmental impact assessment. An SDM is an integrated model of geology, thermal properties, rock mechanics, hydrogeology, hydrogeochemistry, bedrock transport properties and a description of the surface system. The site descriptive model compiled in the current report, SDM-Site Laxemar, presents an integrated understanding of the Laxemar-Simpevarp area (with special emphasis on the Laxemar subarea) at the completion of the surface-based investigations, which were conducted during the period 2002 to 2007. A summary is also provided of the abundant underlying data and the discipline specific models that support the site understanding. The description relies heavily on background reports that address, in particular, details of the data analyses and modelling of the different disciplines. The Laxemar-Simpevarp area is located in the province of Smaaland within the municipality of Oskarshamn, about 230 km south of Stockholm. The candidate area for site investigation is located along the shoreline of the strait of Kalmarsund, within a 1.8 billion year old suite of well preserved bedrock belonging to the Transscandinavian Igneous Belt formed during
Site description of Forsmark at completion of the site investigation phase. SDM-Site Forsmark
International Nuclear Information System (INIS)
2008-12-01
The Swedish Nuclear Fuel and Waste Management Co., SKB, has undertaken site characterisation in two different areas, Forsmark and Laxemar-Simpevarp, in order to identify a suitable location for a geological repository of spent nuclear fuel according to the KBS-3 method. The site investigations have been conducted in campaigns, punctuated by data freezes. After each data freeze, the site data have been analysed and modelling has been carried out with the overall purpose to develop a site descriptive model (SDM). The site descriptive model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It is also essential for safety assessment, since the model is the only source for site-specific input. Another important use of the site descriptive model is in the environmental impact assessment. An SDM is an integrated model for geology, thermal properties, rock mechanics, hydrogeology, hydrogeochemistry, bedrock transport properties and a description of the surface system. The site descriptive model compiled in the current report, SDM-Site, presents an integrated understanding of the Forsmark area at the completion of the surface-based investigations, which were conducted at Forsmark during the period 2002 to 2007. It also provides a summary of the abundant underlying data and the discipline-specific models that support the site understanding. The description relies heavily on background reports that address, in particular, details in data analyses and modelling in the different disciplines. The Forsmark area is located in northern Uppland within the municipality of Oesthammar, about 120 km north of Stockholm. The candidate area for site investigation is located along the shoreline of Oeregrundsgrepen, within the north-western part of a major tectonic lens that formed between 1.87 and 1.85 billion years ago during the Svecokarelian orogeny. The candidate area is approximately 6 km long and 2 km wide. The
National Research Council Canada - National Science Library
Sobell, Mark B; Peterson, Alan; Sobell, Linda C; Hunter, Christopher; Hunter, Christine
2008-01-01
.... Participants are randomly assigned to BCAP or to a Self-Guided Program (SGP) where they receive NRT and a pamphlet discussing change strategies for tobacco cessation, minimizing weight gain, and how to plan for and deal with possible relapses...
On-site and off-site activities
International Nuclear Information System (INIS)
Martin, H.D.
1986-01-01
Design principles for NPP training programs. Effects of NPP contracts. Effects of domestic industrial activities. The role of international bodies. Requirements for on-site training. Training abroad, technical, financial and social aspects. Training center on-site, an evaluation. (orig.)
Region 9 NPL Sites (Superfund Sites 2013)
NPL site POINT locations for the US EPA Region 9. NPL (National Priorities List) sites are hazardous waste sites that are eligible for extensive long-term cleanup under the Superfund program. Eligibility is determined by a scoring method called Hazard Ranking System. Sites with high scores are listed on the NPL. The majority of the locations are derived from polygon centroids of digitized site boundaries. The remaining locations were generated from address geocoding and digitizing. Area covered by this data set include Arizona, California, Nevada, Hawaii, Guam, American Samoa, Northern Marianas and Trust Territories. Attributes include NPL status codes, NPL industry type codes and environmental indicators. Related table, NPL_Contaminants contains information about contaminated media types and chemicals. This is a one-to-many relate and can be related to the feature class using the relationship classes under the Feature Data Set ENVIRO_CONTAMINANT.
On-Site or Off-Site Renewable Energy Supply Options?
DEFF Research Database (Denmark)
Marszal, Anna Joanna; Heiselberg, Per; Jensen, Rasmus Lund
2012-01-01
The concept of a Net Zero Energy Building (Net ZEB) encompasses two options of supplying renewable energy, which can offset energy use of a building, in particular on-site or off-site renewable energy supply. Currently, the on-site options are much more popular than the off-site; however, taking...... into consideration the limited area of roof and/or façade, primarily in the dense city areas, the Danish weather conditions, the growing interest and number of wind turbine co-ops, the off-site renewable energy supply options could become a meaningful solution for reaching ‘zero’ energy goal in the Danish context...... five technologies, i.e., two on-site options: (1) photovoltaic, (2) micro combined heat and power, and three off-site options: (1) off-site windmill, (2) share of a windmill farm and (3) purchase of green energy from the 100% renewable utility grid. The results indicate that in case of the on...
International Nuclear Information System (INIS)
Bondarenko, Alexander S.; Stephens, Ifan E.L.; Bech, Lone; Chorkendorff, Ib
2012-01-01
Highlights: ► Impedance spectroscopy of Cu/Pt(1 1 1) near-surface alloy and Pt(1 1 1). ► Presence of oxygen changes little the adsorption dynamics. ► Adsorption dynamics similar on alloy and Pt(1 1 1). ► Electrosorption phenomena on alloy shifted in potential, relative to Pt(1 1 1). - Abstract: The adsorption dynamics of *OH and *O species at Pt(1 1 1) and Cu/Pt(1 1 1) near-surface alloy (NSA) surfaces in oxygen-free and O 2 -saturated 0.1 M HClO 4 was investigated. Subsurface Cu modifies the electronic structure at the Pt(1 1 1) surface resulting in weaker bonding to adsorbates like *OH, *H or *O. This provides a basis for the high oxygen reduction activity of the NSA, as predicted by density functional theory calculations. The shift in *OH adsorption of around 0.16 V towards more positive potentials can be clearly monitored in absence of O 2 and under the oxygen reduction reaction (ORR) conditions for the Cu/Pt(1 1 1) NSA. In both cases, for Pt(1 1 1) and NSA, the *OH(*O) adsorption dynamics is very similar in the absence of oxygen and under ORR conditions. Therefore, theoretical assumptions about the coverage of adsorbates in the absence of oxygen can be reasonably extrapolated to the situation when oxygen reduction takes place at the surface. A ∼5-fold improvement in the ORR activity over the Pt(1 1 1) at 0.9 V (RHE) was measured for the Cu/Pt(1 1 1) near-surface alloy.
Meston, Cindy M; Lorenz, Tierney A
2013-07-01
Physiological responses to sexual stimuli may contribute to the increased rate of sexual problems seen in women with childhood sexual abuse (CSA) histories. We compared two physiological stress responses as predictors of sexual function and satisfaction, sympathetic nervous system (SNS) activation and cortisol in women with (CSA, N = 136) and without CSA histories (NSA, N = 102). In CSA survivors, cortisol response to sexual stimuli did not significantly predict sexual functioning; however, in NSA women, cortisol increases were associated with poorer sexual functioning, and decreases with higher functioning. For women with CSA histories, lower SNS activity was associated with poorer sexual functioning. For CSA survivors with low lifetime trauma, lower SNS activity was associated with higher sexual satisfaction; for women with high lifetime trauma, the reverse was true. Decreased SNS activity during sexual stimuli predicted higher sexual functioning in NSA women with low lifetime exposure to traumatic events, but lower sexual functioning in those with high exposure. Differences between women with and without CSA histories in the association between cortisol and SNS response and sexual functioning and satisfaction suggests that CSA causes disruptions in both short and long-term stress responses to sexual stimuli that perpetuate into adulthood.
DEFF Research Database (Denmark)
Nissen, N; Gravholt, C H; Abrahamsen, B
2007-01-01
with healthy controls. PATIENTS: The study population comprised 58 patients with TS (aged 22-67 years) and 60 age-matched healthy women (aged 21-65 years). MEASUREMENTS: Hip axis length (HAL), neck width (NW), neck shaft angle (NSA), and femoral head-radius (HR) on dual-energy X-ray absorptiometry (DXA) screen...... for differences in height, HAL was not significantly different (9.4 +/- 0.5 vs. 9.5 +/- 0.5 cm; NS) in TS compared with controls while NW was significantly increased (3.5 +/- 0.4 cm vs. 3.3 +/- 0.2 cm, P NSA was similar (129 +/- 4 degrees vs. 130 +/- 4 degrees , NS), and HR was significantly decreased...
BOREAS TGB-5 Biogenic Soil Emissions of NO and N2O
Levine, J. S.; Winstead, E. L.; Parsons, D. A. B.; Scholes, M. C.; Cofer, W. R.; Cahoon, D. R.; Sebacher, D. I.; Scholes, R. J.; Hall, Forrest G. (Editor); Conrad, Sara K. (Editor)
2000-01-01
The BOReal Ecosystem-Atmosphere Study Trace Gas Biogeochemistry (BOREAS TGB)-5 team made several measurements of trace gas concentrations and fluxes at various NSA sites. This data set contains biogenic soil emissions of nitric oxide and nitrous oxide that were measured over a wide range of spatial and temporal site parameters. Since very little is known about biogenic soil emissions of nitric oxide and nitrous oxide from the boreal forest, the goal of the measurements was to characterize the biogenic soil fluxes of nitric oxide and nitrous oxide from black spruce and jack pine areas in the boreal forest. The diurnal variation and monthly variation of the emissions was examined as well as the impact of wetting through natural or artificial means. Temporally, the data cover mid-August 1993, June to August 1994, and mid-July 1995. The data are provided in tabular ASCII files. The data files are available on a CD-ROM (see document number 20010000884).
Nuclear power plant site evaluation using site population-meterology factor
International Nuclear Information System (INIS)
Rho, B.H.; Kang, C.H.
1982-01-01
In this paper, as a site evaluation technique, SPNF(Site Population Neteorology Factor) which is modified from SPF(Site Population Factor) of the USNRC model, is defined from site population and meteorology data in order to consider the radiological impacts to the population at large from the atmospheric dispersion of the radioactive effluents released during routine plant operation as well as accidental conditions. The SPMF model proved its propriety from the comparison of SPMF and SPF for Kori site. The relative suitability of Korean sites to the U.S. sites have been also examined using SPF. (Author)
Superfund and Toxic Release Inventory Sites - MDC_ContaminatedSite
NSGIC Local Govt | GIS Inventory — A point feature class of open DERM Contaminated sites - see phase code for status of site. Contaminated sites identifies properties where environmental contamination...
A convergent blind deconvolution method for post-adaptive-optics astronomical imaging
International Nuclear Information System (INIS)
Prato, M; Camera, A La; Bertero, M; Bonettini, S
2013-01-01
In this paper, we propose a blind deconvolution method which applies to data perturbed by Poisson noise. The objective function is a generalized Kullback–Leibler (KL) divergence, depending on both the unknown object and unknown point spread function (PSF), without the addition of regularization terms; constrained minimization, with suitable convex constraints on both unknowns, is considered. The problem is non-convex and we propose to solve it by means of an inexact alternating minimization method, whose global convergence to stationary points of the objective function has been recently proved in a general setting. The method is iterative and each iteration, also called outer iteration, consists of alternating an update of the object and the PSF by means of a fixed number of iterations, also called inner iterations, of the scaled gradient projection (SGP) method. Therefore, the method is similar to other proposed methods based on the Richardson–Lucy (RL) algorithm, with SGP replacing RL. The use of SGP has two advantages: first, it allows one to prove global convergence of the blind method; secondly, it allows the introduction of different constraints on the object and the PSF. The specific constraint on the PSF, besides non-negativity and normalization, is an upper bound derived from the so-called Strehl ratio (SR), which is the ratio between the peak value of an aberrated versus a perfect wavefront. Therefore, a typical application, but not a unique one, is to the imaging of modern telescopes equipped with adaptive optics systems for the partial correction of the aberrations due to atmospheric turbulence. In the paper, we describe in detail the algorithm and we recall the results leading to its convergence. Moreover, we illustrate its effectiveness by means of numerical experiments whose results indicate that the method, pushed to convergence, is very promising in the reconstruction of non-dense stellar clusters. The case of more complex astronomical targets
Umatilla Satellite and Release Sites Project : Final Siting Report.
Energy Technology Data Exchange (ETDEWEB)
Montgomery, James M.
1992-04-01
This report presents the results of site analysis for the Umatilla Satellite and Release Sites Project. The purpose of this project is to provide engineering services for the siting and conceptual design of satellite and release facilities for the Umatilla Basin hatchery program. The Umatilla Basin hatchery program consists of artificial production facilities for salmon and steelhead to enhance production in the Umatilla River as defined in the Umatilla master plan approved in 1989 by the Northwest Power Planning Council. Facilities identified in the master plan include adult salmon broodstock holding and spawning facilities, facilities for recovery, acclimation, and/or extended rearing of salmon juveniles, and development of river sites for release of hatchery salmon and steelhead. The historic and current distribution of fall chinook, summer chinook, and coho salmon and steelhead trout was summarized for the Umatilla River basin. Current and future production and release objectives were reviewed. Twenty seven sites were evaluated for the potential and development of facilities. Engineering and environmental attributes of the sites were evaluated and compared to facility requirements for water and space. Site screening was conducted to identify the sites with the most potential for facility development. Alternative sites were selected for conceptual design of each facility type. A proposed program for adult holding facilities, final rearing/acclimation, and direct release facilities was developed.
International Nuclear Information System (INIS)
Bicker, A.E.
1981-01-01
Among the several DOE sites that have been radiologically decontaminated under the auspices of the Nevada Operations Office are three whose physical characteristics are unique. These are the Tatum Dome Test Site (TDTS) near Hattiesburg, Mississippi; a location of mountainous terrain (Pahute Mesa) on the Nevada Test Site; and the GNOME site near Carlsbad, New Mexico. In each case the contamination, the terrain, and the climate conditions were different. This presentation includes a brief description of each site, the methods used to perform radiological surveys, the logistics required to support the decontamination (including health physics and sample analysis), and the specific techniques used to reduce or remove the contamination
A Community Format for Electro-Optic Space Situational Awareness (EOSSA) Data Products
2014-09-01
developed and tested for RSO characterization with reduced cost . The file specification document for EOSSA provides a foundation to enable data providers... geocentric velocity aberration). SGP4 and VCMs produce geocentric origin and velocity aberration and subtracting the sensor geocentric position of the
ACME-III and ACME-IV Final Campaign Reports
Energy Technology Data Exchange (ETDEWEB)
Biraud, S. C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2016-01-01
The goals of the Atmospheric Radiation Measurement (ARM) Climate Research Facility’s third and fourth Airborne Carbon Measurements (ACME) field campaigns, ACME-III and ACME-IV, are: 1) to measure and model the exchange of CO2, water vapor, and other greenhouse gases by the natural, agricultural, and industrial ecosystems of the Southern Great Plains (SGP) region; 2) to develop quantitative approaches to relate these local fluxes to the concentration of greenhouse gases measured at the Central Facility tower and in the atmospheric column above the ARM SGP Central Facility, 3) to develop and test bottom-up measurement and modeling approaches to estimate regional scale carbon balances, and 4) to develop and test inverse modeling approaches to estimate regional scale carbon balance and anthropogenic sources over continental regions. Regular soundings of the atmosphere from near the surface into the mid-troposphere are essential for this research.
Energy Technology Data Exchange (ETDEWEB)
Fast, J. D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Berg, L. K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Burleyson, C. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Fan, J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Feng, Z. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hagos, S. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Huang, M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Guenther, A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Laskin, A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Ovchinnikov, M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Shilling, J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Shrivastava, M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Xiao, H. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zaveri, R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zelenyuk-Imre, A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Kuang, C. [Brookhaven National Lab. (BNL), Upton, NY (United States); Wang, J. [Brookhaven National Lab. (BNL), Upton, NY (United States); Smith, J. [University of California-Irvine; Turner, D. [National Severe Storms Laboratory; Gentine, P. [Columbia Univ., New York, NY (United States)
2017-05-01
Cumulus convection is an important component in the atmospheric radiation budget and hydrologic cycle over the southern Great Plains and over many regions of the world, particularly during the summertime growing season when intense turbulence induced by surface radiation couples the land surface to clouds. Current convective cloud parameterizations contain uncertainties resulting in part from insufficient coincident data that couples cloud macrophysical and microphysical properties to inhomogeneities in land surface, boundary layer, and aerosol properties. The Holistic Interactions of Shallow Clouds, Aerosols, and Land-Ecosystems (HI-SCALE) campaign was designed to provide a detailed set of measurements that are needed to obtain a more complete understanding of the lifecycle of shallow clouds by coupling cloud macrophysical and microphysical properties to land surface properties, ecosystems, and aerosols. Some of the land-atmosphere-cloud interactions that can be studied using HI-SCALE data are shown in Figure 1. HI-SCALE consisted of two 4-week intensive operation periods (IOPs), one in the spring (April 24-May 21) and the other in the late summer (August 28-September 24) of 2016, to take advantage of different stages of the plant lifecycle, the distribution of “greenness” for various types of vegetation in the vicinity of the U.S. Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility Southern Great Plains (SGP) site, and aerosol properties that vary during the growing season. As expected, satellite measurements indicated that the Normalized Difference Vegetation Index (NDVI) was much “greener” in the vicinity of the SGP site during the spring IOP than the late summer IOP as a result of winter wheat maturing in the spring and being harvested in the early summer. As shown in Figure 2, temperatures were cooler than average and soil moisture was high during the spring IOP, while temperatures were warmer than average and
Bedrock hydrogeology Forsmark. Site descriptive modelling, SDM-Site Forsmark
Energy Technology Data Exchange (ETDEWEB)
Follin, Sven (SF GeoLogic AB, Taeby (Sweden))
2008-12-15
The Swedish Nuclear Fuel and Waste Management Company (SKB) has conducted site investigations at two different locations, the Forsmark and Laxemar-Simpevarp areas, with the objective of siting a final repository for spent nuclear fuel according to the KBS-3 concept. Site characterisation should provide all data required for an integrated evaluation of the suitability of the investigated site and an important component in the characterisation work is the development of a hydrogeological model. The hydrogeological model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It also provides input to the safety assessment. Another important use of the hydrogeological model is in the environmental impact assessment. This report presents the understanding of the hydrogeological conditions of the bedrock at Forsmark reached following the completion of the surface-based investigations and provides a summary of the bedrock hydrogeological model and the underlying data supporting its development. It constitutes the main reference on bedrock hydrogeology for the site descriptive model concluding the surface-based investigations at Forsmark, SDM-site, and is intended to describe the hydraulic properties and hydrogeological conditions of the bedrock at the site and to give the information essential for demonstrating understanding
Media Sites Site Registration Contact Us Search AF.mil: Home > AF Sites > Social Media Sites Social Media Welcome to the Air Force social media directory! The directory is a one-stop shop of official Air Force social media pages across various social media sites. Social media is all about
Nonlinear electric reaction arising in dry bone subjected to 4-point bending
Murasawa, Go; Cho, Hideo; Ogawa, Kazuma
2007-04-01
Bone is a smart, self-adaptive and also partly self-repairing tissue. In recent years, many researchers seek to find how to give the effective mechanical stimulation to bone, because it is the predominant loading that determines the bone shape and macroscopic structure. However, the trial of regeneration of bone is still under way. On the other hand, it has been known that electrical potential generates from bone by mechanical stimulation (Yasuda, 1977; Williams, 1982; Starkebaum, 1979; Cochran, 1968; Lanyon, 1977; Salzstein, 1987a,b; Friedenberg, 1966). This is called "stress-generated potential (SGP)". The process of information transfer between "strain" and "cells" is not still clear. But, there is some possibility that SGP has something to do with the process of information transfer. If the electrical potential is more clear under some mechanical loadings, we will be able to regenerate bone artificially and freely. Therefore, it is important to investigate SGP in detail. The aim of present study is to investigate the electric reaction arising in dry bone subjected to mechanical loadings at high amplitude and low frequency strain. Firstly, specimen is fabricated from femur of cow. Next, the speeds of wave propagation in bone are tried to measure by laser ultra sonic technique and wavelet transform, because these have relationship with bone density. Secondary, 4-point bending test is conducted up to fracture. Then, electric reaction arising in bone is measured during loading. Finally, cyclic 4-point bending tests are conducted to investigate the electric reaction arising in bone at low frequency strain.
International Nuclear Information System (INIS)
House, W.B.; Ebenhack, D.G.
1989-01-01
This chapter is a discussion of the management and operations practices used at the Barnwell Waste Management Facility in Barnwell, SC. The following topics are discussed: (1) Waste receiving and inspection, including manifest and certificates of compliance, radiological surveys, disposition of nonconforming items, and decontamination and disposition of secondary waste streams; (2) Waste disposal, including Title 10 CFR 61 requirements, disposal area evaluations, shipment offloading, container emplacement, and radiation protection; (3) Trench closure, including trench backfilling, trench capping, and permanent markers; (4) Site maintenance and stabilization, including trench maintenance, surface water management, and site closure activities; (5) Site monitoring programs, including operational monitoring, and environmental monitoring program; (6) Personnel training and qualifications, including basic training program, safety training program, special skills training, and physical qualifications; (7) Records management, including waste records, personnel training records, personnel dosimetry records, site monitoring records, trench qualification and construction records, and site drawings and stabilization records; (8) Site security; (9) Emergency response plans; and (10) Quality assurance
Energy Technology Data Exchange (ETDEWEB)
P Kollias; MA Miller; KB Widener; RT Marchand; TP Ackerman
2005-12-30
The United States (U.S.) Department of Energy (DOE) Atmospheric Radiation Measurement (ARM) Climate Research Facility (ACRF) operates millimeter wavelength cloud radars (MMCRs) in several climatological regimes. The MMCRs, are the primary observing tool for quantifying the properties of nearly all radiatively important clouds over the ACRF sites. The first MMCR was installed at the ACRF Southern Great Plains (SGP) site nine years ago and its original design can be traced to the early 90s. Since then, several MMCRs have been deployed at the ACRF sites, while no significant hardware upgrades have been performed. Recently, a two-stage upgrade (first C-40 Digital Signal Processors [DSP]-based, and later the PC-Integrated Radar AcQuisition System [PIRAQ-III] digital receiver) of the MMCR signal-processing units was completed. Our future MMCR related goals are: 1) to have a cloud radar system that continues to have high reliability and uptime and 2) to suggest potential improvements that will address increased sensitivity needs, superior sampling and low cost maintenance of the MMCRs. The Traveling Wave Tube (TWT) technology, the frequency (35-GHz), the radio frequency (RF) layout, antenna, the calibration and radar control procedure and the environmental enclosure of the MMCR remain assets for our ability to detect the profile of hydrometeors at all heights in the troposphere at the ACRF sites.
Diagnostic modeling of the ARM experimental configuration. Final report
Energy Technology Data Exchange (ETDEWEB)
Somerville, R.C.J.
1998-04-01
A major accomplishment of this work was to demonstrate the viability of using in-situ data in both mid-continent North America (SGP CART site) and Tropical Western Pacific (TOGA-COARE) locations to provide the horizontal advective flux convergences which force and constrain the Single-Column Model (SCM) which was the main theoretical tool of this work. The author has used TOGA-COARE as a prototype for the ARM TWP site. Results show that SCMs can produce realistic budgets over the ARM sites without relying on parameterization-dependent operational numerical weather prediction objective analyses. The single-column model is diagnostic rather than prognostic. It is numerically integrated in time as an initial value problem which is forced and constrained by observational data. The input is an observed initial state, plus observationally derived estimates of the time-dependent advection terms in the conservation equations, provided at all model layers. Its output is a complete heat and water budget, including temperature and moisture profiles, clouds and their radiative properties, diabatic heating terms, surface energy balance components, and hydrologic cycle elements, all specified as functions of time. These SCM results should be interpreted in light of the original motivation and purpose of ARM and its goal to improve the treatment of cloud-radiation interactions in climate models.
Long-term Outcomes of Operative and Nonoperative Treatment of Congenital Coxa Vara.
Roberts, David W; Saglam, Yavuz; De La Rocha, Adriana; Frasquillo, Brigid N; Tulchin-Francis, Kirsten; Kim, Harry K W
2018-04-01
Congenital coxa vara (CCV) is a rare hip condition with few long-term studies. The purpose of this study was to assess clinical, radiographic, and functional outcomes after operative and nonoperative treatment of CCV, assess reliability of radiographic parameters, and investigate risk factors for recurrence after surgery. Retrospective review was performed of all CCV patients treated at 1 institution from 1980 to 2010. In addition, patients were recalled for additional follow-up x-rays, modified Harris Hip Score (mHHS), and gait analysis. Radiographic measurements [neck-shaft angle (NSA), head-shaft angle (HSA), Hilgenreiner-epiphyseal angle (HEA), and femoral neck length (FNL)] were assessed for reliability using intraclass correlation coefficients. Multivariate analysis was performed to identify risk factors for recurrence after surgery. Forty-six hips in 32 patients were reviewed. Mean age at presentation was 5.4±4.9 years. Mean follow-up was 11.8±5.8 years. Valgus proximal femoral osteotomy was performed in 27 hips (20 patients). Initial deformity was greater in the operative group (NSA 90±17 degrees, HEA 68±19 degrees) versus nonoperative patients (NSA 122±19 degrees, HEA 34±14 degrees) (PNSA occurred in only 21%. In contrast, 56% of operative hips showed decreased FNL growth rates. Interobserver reliability was excellent for HEA (0.98), NSA (0.90), and FNL (0.89), and good for HSA (0.79). Repeat osteotomy was performed in 6 cases (22%). No significant predictors for recurrence were identified. At long-term follow-up for recalled patients, 72% had significantly abnormal gait, and 50% had fair-poor functional outcomes (mHHSNSA are the most reliable radiographic measurements of proximal femoral deformity in CCV. Recurrence is not uncommon, but no predictors were identified. Many patients have persistent gait abnormalities and functional impairment at long-term follow-up, regardless of prior treatment. Level III-retrospective cohort.
Precipitation in the Southern Great Plains (SGP) is highly variable both spatially and temporally with recurring periods of severe drought. Winter wheat (Triticum aestivum L.) – summer fallow system with conventional tillage is the principal dryland cropping system in this region for both grazing an...
Confidence assessment. Site-descriptive modelling SDM-Site Laxemar
International Nuclear Information System (INIS)
2009-06-01
The objective of this report is to assess the confidence that can be placed in the Laxemar site descriptive model, based on the information available at the conclusion of the surface-based investigations (SDM-Site Laxemar). In this exploration, an overriding question is whether remaining uncertainties are significant for repository engineering design or long-term safety assessment and could successfully be further reduced by more surface-based investigations or more usefully by explorations underground made during construction of the repository. Procedures for this assessment have been progressively refined during the course of the site descriptive modelling, and applied to all previous versions of the Forsmark and Laxemar site descriptive models. They include assessment of whether all relevant data have been considered and understood, identification of the main uncertainties and their causes, possible alternative models and their handling, and consistency between disciplines. The assessment then forms the basis for an overall confidence statement. The confidence in the Laxemar site descriptive model, based on the data available at the conclusion of the surface based site investigations, has been assessed by exploring: - Confidence in the site characterization data base, - remaining issues and their handling, - handling of alternatives, - consistency between disciplines and - main reasons for confidence and lack of confidence in the model. Generally, the site investigation database is of high quality, as assured by the quality procedures applied. It is judged that the Laxemar site descriptive model has an overall high level of confidence. Because of the relatively robust geological model that describes the site, the overall confidence in the Laxemar Site Descriptive model is judged to be high, even though details of the spatial variability remain unknown. The overall reason for this confidence is the wide spatial distribution of the data and the consistency between
Confidence assessment. Site-descriptive modelling SDM-Site Laxemar
Energy Technology Data Exchange (ETDEWEB)
2008-12-15
The objective of this report is to assess the confidence that can be placed in the Laxemar site descriptive model, based on the information available at the conclusion of the surface-based investigations (SDM-Site Laxemar). In this exploration, an overriding question is whether remaining uncertainties are significant for repository engineering design or long-term safety assessment and could successfully be further reduced by more surface-based investigations or more usefully by explorations underground made during construction of the repository. Procedures for this assessment have been progressively refined during the course of the site descriptive modelling, and applied to all previous versions of the Forsmark and Laxemar site descriptive models. They include assessment of whether all relevant data have been considered and understood, identification of the main uncertainties and their causes, possible alternative models and their handling, and consistency between disciplines. The assessment then forms the basis for an overall confidence statement. The confidence in the Laxemar site descriptive model, based on the data available at the conclusion of the surface based site investigations, has been assessed by exploring: - Confidence in the site characterization data base, - remaining issues and their handling, - handling of alternatives, - consistency between disciplines and - main reasons for confidence and lack of confidence in the model. Generally, the site investigation database is of high quality, as assured by the quality procedures applied. It is judged that the Laxemar site descriptive model has an overall high level of confidence. Because of the relatively robust geological model that describes the site, the overall confidence in the Laxemar Site Descriptive model is judged to be high, even though details of the spatial variability remain unknown. The overall reason for this confidence is the wide spatial distribution of the data and the consistency between
Siting guidelines and their role in repository site selection
International Nuclear Information System (INIS)
Hanlon, C.L.
1985-01-01
The first requirement of the Nuclear Waste Policy Act was for the Secretary of Energy to issue general guidelines for siting repositories. The guidelines were to specify detailed geologic considerations that would be the primary criteria for the selection of sites in various host rocks, as well as factors that would qualify or disqualify any site from development as a repository. These guidelines were clearly intended to provide not only the framework for the siting program but also the stimulus for establishing effective communication and consultation among the parties involved in the program. The Act further required that the guidelines be a factor in the development of all future decision documents of the Office of Civilian Radioactive Waste Management, including the environmental assessments that would accompany the nomination of sites for characterization, the site-characterization plans that are to be prepared before the sinking of exploratory shafts at any candidate site, and the environmental impact statement that is to support the recommendation of a site for development as a repository. More than two years after its passage, the intention of the Act for the guidelines has been realized. Concurred in by the Nuclear Regulatory Commission on June 22, 1984, and issued by the Department in November 1984, the guidelines include postclosure technical guidelines that apply to conditions governing the long-term performance of the repository system; preclosure technical guidelines that apply to conditions governing the siting, construction, operation, and closure of the repository; and system guidelines whose objective is to ensure that the regulatory requirements of the Environmental Protection Agency and the Nuclear Regulatory Commission are met
SiteGuide: An example-based approach to web site development assistance
Hollink, V.; de Boer, V.; van Someren, M.; Filipe, J.; Cordeiro, J.
2009-01-01
We present ‘SiteGuide’, a tool that helps web designers to decide which information will be included in a new web site and how the information will be organized. SiteGuide takes as input URLs of web sites from the same domain as the site the user wants to create. It automatically searches the pages
Feedback from performance assessment to site characterisation. The SITE-94 example
International Nuclear Information System (INIS)
Dverstorp, B.; Geier, J.
1999-01-01
Interaction and information exchange between site characterisation and performance assessment are key features of any successful radioactive waste management programme. Some examples are presented of the types of feedback that can be offered from performance assessment to site characterisation, based on SKI's most recent performance assessment project, SITE-94. SITE-94 in Sweden was an assessment of a hypothetical repository for spent nuclear fuel, based on real data gathered in the surface-based investigation of the Aespoe Hard Rock Laboratory site. Examples of feedback are given concerning quality control of data and site investigation procedures, identification of key parameters for the performance assessment, use of models for planning and evaluation of a site investigation, data sampling strategies, and guidance on future priorities for further development of site investigation methods. Because site characterisation serves multiple purposes, including provision of data for repository design and construction, it must account for and compromise among requirements from several lines of analyses in the performance assessment. (author)
CONSTITUTIONALITY AND LEGALITY OF NSA SURVEILLANCE PROGRAM
2013-12-01
Committee Headquarters in what would eventually culminate as the Watergate Scandal . While the far reaching consequences of the Watergate scandal are...the Church Committee that investigated the Watergate Scandal , recommended the FBI be limited to only investigating “conduct rather than ideas or...TSP wiretapping scandal , the Bush Administration instead attempted to codify into law greater surveillance powers for intelligence agencies. When TSP
A case Study of Applying Object-Relational Persistence in Astronomy Data Archiving
Yao, S. S.; Hiriart, R.; Barg, I.; Warner, P.; Gasson, D.
2005-12-01
The NOAO Science Archive (NSA) team is developing a comprehensive domain model to capture the science data in the archive. Java and an object model derived from the domain model weil address the application layer of the archive system. However, since RDBMS is the best proven technology for data management, the challenge is the paradigm mismatch between the object and the relational models. Transparent object-relational mapping (ORM) persistence is a successful solution to this challenge. In the data modeling and persistence implementation of NSA, we are using Hibernate, a well-accepted ORM tool, to bridge the object model in the business tier and the relational model in the database tier. Thus, the database is isolated from the Java application. The application queries directly on objects using a DBMS-independent object-oriented query API, which frees the application developers from the low level JDBC and SQL so that they can focus on the domain logic. We present the detailed design of the NSA R3 (Release 3) data model and object-relational persistence, including mapping, retrieving and caching. Persistence layer optimization and performance tuning will be analyzed. The system is being built on J2EE, so the integration of Hibernate into the EJB container and the transaction management are also explored.
A Critique of the Application of Neighborhood Sustainability Assessment Tools in Urban Regeneration
Directory of Open Access Journals (Sweden)
Luke Boyle
2018-03-01
Full Text Available Neighbourhood Sustainability Assessment Tools (NSA tools are fast becoming the principal framework for urban planners and developers for promoting urban sustainability. The majority of NSA tools promote a specific type of urban development that effectively excludes regeneration projects from the urban sustainability conversation. Given that the world’s megacities are mostly built, it is argued that it is essential that strategies for global sustainability consider that urban development is focussed internally to address existing, under-serviced communities in particular need of meaningful intervention and sustainable redevelopment frameworks. The paper uses existing knowledge on NSA tools to highlight the shortcomings of outcomes-based approaches to urban governance and builds the case that the technocratic “one-size-fits-all” approach adopted by many tools inadequately accounts for underlying institutional, social and economic arrangements that influence urban development, making them inappropriate for application in both planned and existing communities. The paper proposes that urban redevelopment strategies need to be derived from the urban realities of a particular place or context. Such strategies must be grounded in principles of urban governance, participatory action and an understanding of market dynamics. Without these collaborative procedural frameworks, urban regeneration projects will continue to inadequately transition towards more comprehensive sustainability.
International Nuclear Information System (INIS)
1988-01-01
The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in accordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site;to describe the conceptual designs for the repository and the waste package;and to present the plans for obtaining the geologic information necessary to demonstrate the suitability of the site for repository, to design the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and developing a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next;it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing principles, and organization of this site characterization plan are outlined, and compliance with applicable regulations is discussed
Oomen, B.M.; Guijt, J.; Ploeg, M.
2010-01-01
The case of the SGP essentially concerned the question whether the Netherlands should take measures against a Bible-based political party that bars women from its list of candidates. Against the theoretical background of human rights sociology, the rise of rights as a framework for moral discussions
Groenendijk, Nico; Donnelly, Shawn
2012-01-01
After its first thorough revision in 2005, the Stability & Growth Pact (SGP) has recently been transformed into a Fiscal Stability Treaty, which in all likelihood will become operational as from January 1, 2013. Part of this treaty is the incorporation of balanced budget rules into domestic
Directory of Open Access Journals (Sweden)
Evans Paul M
2005-12-01
Full Text Available Abstract Background Site-directed mutagenesis is a widely-used technique for introducing mutations into a particular DNA sequence, often with the goal of creating a point mutation in the corresponding amino acid sequence but otherwise leaving the overall sequence undisturbed. However, this method provides no means for verifying its success other than sequencing the putative mutant construct: This can quickly become an expensive method for screening for successful mutations. An alternative to sequencing is to simultaneously introduce a restriction site near the point mutation in manner such that the restriction site has no effect on the translated amino acid sequence. Thus, the novel restriction site can be used as a marker for successful mutation which can be quickly and easily assessed. However, finding a restriction site that does not disturb the corresponding amino acid sequence is a time-consuming task even for experienced researchers. A fast and easy to use computer program is needed for this task. Results We wrote a computer program, called SiteFind, to help us design a restriction site within the mutation primers without changing the peptide sequence. Because of the redundancy of genetic code, a given peptide can be encoded by many different DNA sequences. Since the list of possible restriction sites for a given DNA sequence is not always obvious, SiteFind automates this task. The number of possible sequences a computer program must search through increases exponentially as the sequence length increases. SiteFind uses a novel "moving window" algorithm to reduce the number of possible sequences to be searched to a manageable level. The user enters a nucleotide sequence, specifies what amino acid residues should be changed in the mutation, and SiteFind generates a list of possible restriction sites and what nucleotides must be changed to introduce that site. As a demonstration of its use, we successfully generated a single point mutation
Energy Technology Data Exchange (ETDEWEB)
L. M. Dittmer
2006-11-17
The 128-B-3 waste site is a former burn and disposal site for the 100-B/C Area, located adjacent to the Columbia River. The 128-B-3 waste site has been remediated to meet the remedial action objectives specified in the Remaining Sites ROD. The results of verification sampling demonstrated that residual contaminant concentrations do not preclude any future uses and allow for unrestricted use of shallow zone soils. The results of sampling at upland areas of the site also showed that residual contaminant concentrations are protective of groundwater and the Columbia River.
Rada, Elena Cristina; Ragazzi, Marco; Torretta, Vincenzo
2013-01-01
This work describes batch anaerobic digestion tests carried out on stillages, the residue of the distillation process on fruit, in order to contribute to the setting of design parameters for a planned plant. The experimental apparatus was characterized by three reactors, each with a useful volume of 5 L. The different phases of the work carried out were: determining the basic components of the chemical oxygen demand (COD) of the stillages; determining the specific production of biogas; and estimating the rapidly biodegradable COD contained in the stillages. In particular, the main goal of the anaerobic digestion tests on stillages was to measure the parameters of specific gas production (SGP) and gas production rate (GPR) in reactors in which stillages were being digested using ASBR (anaerobic sequencing batch reactor) technology. Runs were developed with increasing concentrations of the feed. The optimal loads for obtaining the maximum SGP and GPR values were 8-9 gCOD L(-1) and 0.9 gCOD g(-1) volatile solids.
Directory of Open Access Journals (Sweden)
Gustavo Garza
2006-01-01
Full Text Available El propósito de este artículo es analizar la evolución de la concentración de los servicios públicos en la Zona Metropolitana de la Ciudad de México (zmcm según dos etapas: i entre 1960 y 1982, periodo de activa participación gubernamental; y, ii de 1980 a 1998, de adelgazamiento gubernamental e implantación del neoliberalismo.Las conclusiones de corte estructural del análisis realizado son tres: i la creciente concentración de los servicios públicos en la zmcm entre 1960 y 1982 refuerza la tendencia hacia su especialización terciaria; ii la concentración en la urbe de trabajadores en actividades de los servicios generales de la producción (sgp se reduce ligeramente de 1993 a 1998; iii existe una concentración en la Ciudad de México semejante en los sgp que en las actividades de comercio y servicios de tipo mercantil.
Identification of a carbohydrate-based endothelial ligand for a lymphocyte homing receptor
International Nuclear Information System (INIS)
Imai, Y.; Singer, M.S.; Fennie, C.; Lasky, L.A.; Rosen, S.D.
1991-01-01
Lymphocyte attachment to high endothelial venules within lymph nodes is mediated by the peripheral lymph node homing receptor (pnHR), originally defined on mouse lymphocytes by the MEL-14 mAb. The pnHR is a calcium-dependent lectin-like receptor, a member of the LEC-CAM family of adhesion proteins. Here, using a soluble recombinant form of the homing receptor, we have identified an endothelial ligand for the pnHR as an ∼ 50-kD sulfated, fucosylated, and sialylated glycoprotein, which we designate Sgp50 (sulfated glycoprotein of 50 kD). Recombinant receptor binding to this lymph node-specific glycoprotein requires calcium and is inhibitable by specific carbohydrates and by MEL-14 mAb. Sialylation of the component is required for binding. Additionally, the glycoprotein is precipitated by MECA-79, an adhesion-blocking mAb reactive with lymph node HEV. A related glycoprotein of ∼ 90 kD (designated as Sgp90) is also identified
Energy Technology Data Exchange (ETDEWEB)
Bauer, Susanne [Columbia Univ., New York, NY (United States)
2015-02-09
We participated in a FASTER SCM intercomparison for which we ran our SCM for 3 years at the SGP to analyze statistics of the precipitation field (Song et al., 2013). An important feature of these simulations was the use of relaxation forcing to observed T, q, which decouples the model convection from the forcing and allows precipitation errors to emerge. Because the GISS cumulus parameterization includes a trigger that prevents convection until sufficient lifting is present, and because convection at the SGP is usually triggered by mesoscale motions that are not represented in the forcing when relaxation is applied, the duration of SCM precipitation is shorter than observed (Del Genio and Wolf, 2012) and thus its mean precipitation less than observed. However, its diurnal cycle phase is correct, and it is the only operational cumulus parameterization in the intercomparison that does not produce excessive warm season precipitation under weak large-scale forcing conditions.
International Nuclear Information System (INIS)
1988-01-01
The Yucca Mountain site in Nevada is one of three candidate sites for the first geologic repository for radioactive waste. On May 28, 1986, it was recommended for detailed study in a program of site characterization. This site characterization plan (SCP) has been prepared in acordance with the requirements of the Nuclear Waste Policy Act to summarize the information collected to date about the geologic conditions at the site;to describe the conceptual designs for the repository and the waste package and to present the plans for obtaining the geologic information necessary to demonstrate the suitability of the site for a repository, to design the repository and the waste package, to prepare an environmental impact statement, and to obtain from the US Nuclear Regulatory Commission (NRC) an authorization to construct the repository. This introduction begins with a brief section on the process for siting and eveloping a repository, followed by a discussion of the pertinent legislation and regulations. A description of site characterization is presented next;it describes the facilities to be constructed for the site characterization program and explains the principal activities to be conducted during the program. Finally, the purpose, content, organizing prinicples, and organization of this site characterization plan are outlined, and compliance with applicable regulations is discussed. 880 refs., 130 figs., 25 tabs
On multi-site damage identification using single-site training data
Barthorpe, R. J.; Manson, G.; Worden, K.
2017-11-01
This paper proposes a methodology for developing multi-site damage location systems for engineering structures that can be trained using single-site damaged state data only. The methodology involves training a sequence of binary classifiers based upon single-site damage data and combining the developed classifiers into a robust multi-class damage locator. In this way, the multi-site damage identification problem may be decomposed into a sequence of binary decisions. In this paper Support Vector Classifiers are adopted as the means of making these binary decisions. The proposed methodology represents an advancement on the state of the art in the field of multi-site damage identification which require either: (1) full damaged state data from single- and multi-site damage cases or (2) the development of a physics-based model to make multi-site model predictions. The potential benefit of the proposed methodology is that a significantly reduced number of recorded damage states may be required in order to train a multi-site damage locator without recourse to physics-based model predictions. In this paper it is first demonstrated that Support Vector Classification represents an appropriate approach to the multi-site damage location problem, with methods for combining binary classifiers discussed. Next, the proposed methodology is demonstrated and evaluated through application to a real engineering structure - a Piper Tomahawk trainer aircraft wing - with its performance compared to classifiers trained using the full damaged-state dataset.
Nevada Test Site Environmental Report 2005, Attachment A - Site Description
International Nuclear Information System (INIS)
Cathy A. Wills
2006-01-01
This appendix to the ''Nevada Test Site Environmental Report 2005'', dated October 2006 (DOE/NV/11718--1214; DOE/NV/25946--007) expands on the general description of the Nevada Test Site (NTS) presented in the Introduction. Included are subsections that summarize the site?s geological, hydrological, climatological, and ecological setting. The cultural resources of the NTS are also presented. The subsections are meant to aid the reader in understanding the complex physical and biological environment of the NTS. An adequate knowledge of the site's environment is necessary to assess the environmental impacts of new projects, design and implement environmental monitoring activities for current site operations, and assess the impacts of site operations on the public residing in the vicinity of the NTS. The NTS environment contributes to several key features of the site which afford protection to the inhabitants of adjacent areas from potential exposure to radioactivity or other contaminants resulting from NTS operations. These key features include the general remote location of the NTS, restricted access, extended wind transport times, the great depths to slow-moving groundwater, little or no surface water, and low population density. This appendix complements the annual summary of monitoring program activities and dose assessments presented in the main body of this report
Nevada Test Site Environmental Report 2005, Attachment A - Site Description
Energy Technology Data Exchange (ETDEWEB)
Cathy A. Wills
2006-10-01
This appendix to the ''Nevada Test Site Environmental Report 2005'', dated October 2006 (DOE/NV/11718--1214; DOE/NV/25946--007) expands on the general description of the Nevada Test Site (NTS) presented in the Introduction. Included are subsections that summarize the site?s geological, hydrological, climatological, and ecological setting. The cultural resources of the NTS are also presented. The subsections are meant to aid the reader in understanding the complex physical and biological environment of the NTS. An adequate knowledge of the site's environment is necessary to assess the environmental impacts of new projects, design and implement environmental monitoring activities for current site operations, and assess the impacts of site operations on the public residing in the vicinity of the NTS. The NTS environment contributes to several key features of the site which afford protection to the inhabitants of adjacent areas from potential exposure to radioactivity or other contaminants resulting from NTS operations. These key features include the general remote location of the NTS, restricted access, extended wind transport times, the great depths to slow-moving groundwater, little or no surface water, and low population density. This appendix complements the annual summary of monitoring program activities and dose assessments presented in the main body of this report.
Siting Practices and Site Licensing Process for New Reactors in Canada
International Nuclear Information System (INIS)
Vos, Marcel de
2011-01-01
'Siting' in Canada is composed of Site Evaluation and Site Selection. As outlined in CNSC Regulatory Document RD-346 Site Evaluation for New Nuclear Power Plants (based on IAEA NS-R-3), prior to the triggering of the Environmental Assessment (EA) and licensing processes, the proponent is expected to use a robust process to characterize proposed sites over the full life cycle of the facility, and then develop a fully documented defense of the site selection case. This case forms the backbone for submissions in support of the EA and the application for a License to Prepare Site which will be reviewed by the CNSC and other applicable federal authorities. The Environmental Assessment process and License to Prepare Site in Canada do not require a proponent to select a specific design; however, CNSC does not accept a 'black box' approach to siting. CNSC balances the level of design information required with the extent of safety assurance desired for any designs being contemplated for the proposed site. Nevertheless, the design information submitted must be sufficient to justify the site as suitable for all future licensing stages. The depth of plant design information contributes significantly to the credibility of the applicant's case for both the EA and application for License to Prepare Site. The review process utilizes an assessment plan with defined review stages and timelines. The outcome of these reviews is a series of recommendations to a federal government appointed Joint Review Panel (which also serves as a panel of the 'Commission') which, following public hearings, renders a decision regarding the EA, and subsequently, the application for a License to Prepare Site. (author)
SITE-94. Site specific base data for the performance assessment
International Nuclear Information System (INIS)
Geier, J.; Tiren, S.; Dverstorp, B.; Glynn, P.
1996-06-01
This report documents the site specific base data that were available, and the utilization of these data within SITE-94. A brief summary is given of SKB's preliminary site investigations for the Aespoe Hard Rock Laboratory (HRL), which were the main source of site-specific data for SITE-94, and an overview is given of the field methods and instrumentation for the preliminary investigations. A compilation is given of comments concerning the availability and quality of the data for Aespoe, and specific recommendations are given for future site investigations. It was found that the HRL pre-investigations produced a large quantity of data which were, for the most part, of sufficient quality to be valuable for a performance assessment. However, some problems were encountered regarding documentation, procedural consistency, positional information, and storage of the data from the measurements. 77 refs, 4 tabs
Quantifying siting difficulty: a case study of US transmission line siting
Energy Technology Data Exchange (ETDEWEB)
Vajjhala, S.P. [Resources for the Future, Washington DC (United States); Fischbeck, P.S. [Carnegie Mellon University, Pittsburgh, PA (United States). Departments of Social and Decision Sciences and Engineering and Public Policy
2007-01-15
The worldwide demand for new energy infrastructures has been paralleled in recent years by the increasing difficulty of siting major facilities. Siting difficulty is the subject of widespread discussion, but because of the complexity of the problem, potential solutions are not obvious or well understood. This paper presents a two-step policy-level framework that first develops an empirical measure of siting difficulty and then qualitatively assesses its major causes. The approach is based on the creation and aggregation of four siting indicators that are independent of the common causes and localized effects of siting problems. The proposed framework is demonstrated for the case of US transmission line siting. Results of the analyses reveal significant variations in state siting difficulty and industry experts' perceptions of its dominant causes, with implications for the long-term success of Regional Transmission Organizations (RTOs) and knowledge transfer among siting professionals in the deregulated industry. (author)
SITE-2, Power Plant Siting, Cost, Environment, Seismic and Meteorological Effects
International Nuclear Information System (INIS)
Frigerio, N.A.; Habegger, L.J.; King, R.F.; Hoover, L.J.; Clark, N.A.; Cobian, J.M.
1977-01-01
1 - Description of problem or function: SITE2 is designed to (1) screen candidate energy facility sites or areas within an electric utility region, based on the region's physical and socioeconomic attributes, the planned facility's characteristics, and impact assessments, and (2) evaluate the cumulative regional impacts associated with alternate energy supply options and inter-regional energy import/export practices, specifically, comparison of different energy technologies and their regional distribution in clustered or dispersed patterns. 2 - Method of solution: The SITE2 methodology is based on the quantification of three major site-related vectors. A cost vector is determined which identifies site-specific costs, such as transmission costs, cooling costs as related to water availability, and costs of specific controls needed to protect the surrounding environment. An impact vector is also computed for each potential site, using models of health and environmental impacts incurred in areas adjacent to the site. Finally, a site attribute vector is developed which reflects such characteristics as population, seismic conditions, meteorology, land use, and local ecological systems. This vector can be used to eliminate certain sites because of their inability to satisfy specific constraints. These three vectors can be displayed as density maps and combined in a simple overlay approach, similar to that developed by I. L. McHarg in reference 2, to identify candidate sites. Alternatively, the vector elements can be computationally combined into a weighted sum to obtain quantitative indicators of site suitability
SITE-2, Power Plant Siting, Cost, Environment, Seismic and Meteorological Effects
Energy Technology Data Exchange (ETDEWEB)
Frigerio, N A [Environmental Impact Studies, Argonne National Laboratory 9700 South Cass Avenue, Argonne, Illinois 60439 (United States); Habegger, L J; King, R F; Hoover, L J [Energy and Environmental Systems Division, Argonne National Laboratory 9700 South Cass Avenue, Argonne, Illinois 60439 (United States); Clark, N A [Applied Mathematics Division, Argonne National Laboratory, 9700 South Cass Avenue, Argonne, Illinois 60439 (United States); Cobian, J M [Northwestern University, Evanston, Illinois 60201 (United States)
1977-08-01
1 - Description of problem or function: SITE2 is designed to (1) screen candidate energy facility sites or areas within an electric utility region, based on the region's physical and socioeconomic attributes, the planned facility's characteristics, and impact assessments, and (2) evaluate the cumulative regional impacts associated with alternate energy supply options and inter-regional energy import/export practices, specifically, comparison of different energy technologies and their regional distribution in clustered or dispersed patterns. 2 - Method of solution: The SITE2 methodology is based on the quantification of three major site-related vectors. A cost vector is determined which identifies site-specific costs, such as transmission costs, cooling costs as related to water availability, and costs of specific controls needed to protect the surrounding environment. An impact vector is also computed for each potential site, using models of health and environmental impacts incurred in areas adjacent to the site. Finally, a site attribute vector is developed which reflects such characteristics as population, seismic conditions, meteorology, land use, and local ecological systems. This vector can be used to eliminate certain sites because of their inability to satisfy specific constraints. These three vectors can be displayed as density maps and combined in a simple overlay approach, similar to that developed by I. L. McHarg in reference 2, to identify candidate sites. Alternatively, the vector elements can be computationally combined into a weighted sum to obtain quantitative indicators of site suitability.
Energy Technology Data Exchange (ETDEWEB)
Younker, J.L.; Andrews, W.B.; Fasano, G.A.; Herrington, C.C.; Mattson, S.R.; Murray, R.C. [Science Applications International Corp., Las Vegas, NV (United States); Ballou, L.B.; Revelli, M.A. [Lawrence Livermore National Lab., CA (United States); Ducharme, A.R.; Shephard, L.E. [Sandia National Labs., Albuquerque, NM (United States); Dudley, W.W.; Hoxie, D.T. [Geological Survey, Denver, CO (United States); Herbst, R.J.; Patera, E.A. [Los Alamos National Lab., NM (United States); Judd, B.R. [Decision Analysis Co., Portola Valley, CA (United States); Docka, J.A.; Rickertsen, L.D. [Weston Technical Associates, Washington, DC (United States)
1992-01-01
This study evaluated the technical suitability of Yucca Mountain, Nevada, as a potential site for a mined geologic repository for the permanent disposal of radioactive waste. The evaluation was conducted primarily to determine early in the site characterization program if there are any features or conditions at the site that indicate it is unsuitable for repository development. A secondary purpose was to determine the status of knowledge in the major technical areas that affect the suitability of the site. This early site suitability evaluation (ESSE) was conducted by a team of technical personnel at the request of the Associate Director of the US Department of Energy (DOE) Office of Geologic Disposal, a unit within the DOE`s Office of Civilian Radioactive Waste Management. The Yucca Mountain site has been the subject of such evaluations for over a decade. In 1983, the site was evaluated as part of a screening process to identify potentially acceptable sites. The site was evaluated in greater detail and found suitable for site characterization as part of the Environmental Assessment (EA) (DOE, 1986) required by the Nuclear Waste Policy Act of 1982 (NWPA). Additional site data were compiled during the preparation of the Site Characterization Plan (SCP) (DOE, 1988a). This early site suitability evaluation has considered information that was used in preparing both-documents, along with recent information obtained since the EA and SCP were published. This body of information is referred to in this report as ``current information`` or ``available evidence.``
One-site versus two-site phacotrabeculectomy: a prospective randomized study
Directory of Open Access Journals (Sweden)
Moschos MM
2015-08-01
Full Text Available Marilita M Moschos,1 Irini P Chatziralli,2 Michael Tsatsos3 1First Department of Ophthalmology, University of Athens, 2Second Department of Ophthalmology, Ophthalmiatrion Athinon, Athens, Greece; 3Department of Ophthalmology, Cambridge University Hospital NHS, Cambridge, UK Purpose: The purpose of this study is to compare the efficacy and safety of one-site and two-site combined phacotrabeculectomy with foldable posterior chamber intraocular lens implantation.Methods: Thirty-four patients (41 eyes with glaucoma and cataract were randomly assigned to undergo either a one-site (22 eyes or a two-site (19 eyes combined procedure. One-site approach consisted of a standard superior phacotrabeculectomy with a limbus-based conjunctival flap, while two-site approach consisted of a clear cornea phacoemulsification and a separate superior trabeculectomy with a limbus-based conjunctival flap.Results: Mean follow-up period was 54 months (standard deviation [SD] 2.3. Mean preoperative intraocular pressure (IOP in the one-site group was 21.3 mmHg (SD 2.8 and in the two-site group was 21.8 mmHg (SD 3.0 (P>0.1. Mean postoperative IOP significantly decreased in both groups compared to the preoperative level and was 15.6 mmHg (SD 3.5 in the one-site group and 14.9 mmHg (SD 2.7 in the two-site group. Three months later, the difference between the two groups was not statistically significant (P=0.058. The one-site group required significantly more medications than the two-site group (P=0.03. Best-corrected visual acuity (BCVA improved similarly in both groups, but there was less postoperative (induced astigmatism in the two-site group in a marginal statistical level (P=0.058. Intra- and postoperative complications were comparable in the two groups.Conclusion: Both techniques yielded similar results concerning final BCVA and IOP reduction. However, the two-site group had less induced astigmatism and a better postoperative IOP control with less required
Remediation management of complex sites using an adaptive site management approach.
Price, John; Spreng, Carl; Hawley, Elisabeth L; Deeb, Rula
2017-12-15
Complex sites require a disproportionate amount of resources for environmental remediation and long timeframes to achieve remediation objectives, due to their complex geologic conditions, hydrogeologic conditions, geochemical conditions, contaminant-related conditions, large scale of contamination, and/or non-technical challenges. A recent team of state and federal environmental regulators, federal agency representatives, industry experts, community stakeholders, and academia worked together as an Interstate Technology & Regulatory Council (ITRC) team to compile resources and create new guidance on the remediation management of complex sites. This article summarizes the ITRC team's recommended process for addressing complex sites through an adaptive site management approach. The team provided guidance for site managers and other stakeholders to evaluate site complexities and determine site remediation potential, i.e., whether an adaptive site management approach is warranted. Adaptive site management was described as a comprehensive, flexible approach to iteratively evaluate and adjust the remedial strategy in response to remedy performance. Key aspects of adaptive site management were described, including tools for revising and updating the conceptual site model (CSM), the importance of setting interim objectives to define short-term milestones on the journey to achieving site objectives, establishing a performance model and metrics to evaluate progress towards meeting interim objectives, and comparing actual with predicted progress during scheduled periodic evaluations, and establishing decision criteria for when and how to adapt/modify/revise the remedial strategy in response to remedy performance. Key findings will be published in an ITRC Technical and Regulatory guidance document in 2017 and free training webinars will be conducted. More information is available at www.itrc-web.org. Copyright © 2017 Elsevier Ltd. All rights reserved.
Nuclear installations sites safety
International Nuclear Information System (INIS)
Barber, P.; Candes, P.; Duclos, P.; Doumenc, A.; Faure, J.; Hugon, J.; Mohammadioun, B.
1988-11-01
This report is divided into ten parts bearing: 1 Safety analysis procedures for Basis Nuclear Installations sites (BNI) in France 2 Site safety for BNI in France 3 Industrial and transport activities risks for BNI in France 4 Demographic characteristics near BNI sites in France 5 Meteorologic characteristics of BNI sites in France 6 Geological aspects near the BNI sites in France 7 Seismic studies for BNI sites in France 8 Hydrogeological aspects near BNI sites in France 9 Hydrological aspects near BNI sites in France 10 Ecological and radioecological studies of BNI sites in France [fr
Site locality identification study: Hanford Site. Volume II. Data cataloging
International Nuclear Information System (INIS)
1980-07-01
Data compilation and cataloging for the candidate site locality identification study were conducted in order to provide a retrievable data cataloging system for the present siting study and future site evaluation and licensng processes. This task occurred concurrently with and also independently of other tasks of the candidate site locality identification study. Work in this task provided the data utilized primarily in the development and application of screening and ranking processes to identify candidate site localities on the Hanford Site. The overall approach included two steps: (1) data acquisition and screening; and (2) data compilation and cataloging. Data acquisition and screening formed the basis for preliminary review of data sources with respect to their probable utilization in the candidate site locality identification study and review with respect to the level of completeness and detail of the data. The important working assumption was that the data to be used in the study be based on existing and available published and unpublished literature. The data compilation and cataloging provided the basic product of the Task; a retrievable data cataloging system in the form of an annotated reference list and key word index and an index of compiled data. The annotated reference list and key word index are cross referenced and can be used to trace and retrieve the data sources utilized in the candidate site locality identification study
NASA's Next Generation Space Geodesy Network
Desai, S. D.; Gross, R. S.; Hilliard, L.; Lemoine, F. G.; Long, J. L.; Ma, C.; McGarry, J. F.; Merkowitz, S. M.; Murphy, D.; Noll, C. E.;
2012-01-01
NASA's Space Geodesy Project (SGP) is developing a prototype core site for a next generation Space Geodetic Network (SGN). Each of the sites in this planned network co-locate current state-of-the-art stations from all four space geodetic observing systems, GNSS, SLR, VLBI, and DORIS, with the goal of achieving modern requirements for the International Terrestrial Reference Frame (ITRF). In particular, the driving ITRF requirements for this network are 1.0 mm in accuracy and 0.1 mm/yr in stability, a factor of 10-20 beyond current capabilities. Development of the prototype core site, located at NASA's Geophysical and Astronomical Observatory at the Goddard Space Flight Center, started in 2011 and will be completed by the end of 2013. In January 2012, two operational GNSS stations, GODS and GOON, were established at the prototype site within 100 m of each other. Both stations are being proposed for inclusion into the IGS network. In addition, work is underway for the inclusion of next generation SLR and VLBI stations along with a modern DORIS station. An automated survey system is being developed to measure inter-technique vectorties, and network design studies are being performed to define the appropriate number and distribution of these next generation space geodetic core sites that are required to achieve the driving ITRF requirements. We present the status of this prototype next generation space geodetic core site, results from the analysis of data from the established geodetic stations, and results from the ongoing network design studies.
Cysteine-rich secretory protein 3 is a ligand of alpha1B-glycoprotein in human plasma
DEFF Research Database (Denmark)
Udby, Lene; Sørensen, Ole E; Pass, Jesper
2004-01-01
Human cysteine-rich secretory protein 3 (CRISP-3; also known as SGP28) belongs to a family of closely related proteins found in mammals and reptiles. Some mammalian CRISPs are known to be involved in the process of reproduction, whereas some of the CRISPs from reptiles are neurotoxin...
Effects of starch synthase IIa gene dosage on grain, protein and starch in endosperm of wheat.
Konik-Rose, Christine; Thistleton, Jenny; Chanvrier, Helene; Tan, Ihwa; Halley, Peter; Gidley, Michael; Kosar-Hashemi, Behjat; Wang, Hong; Larroque, Oscar; Ikea, Joseph; McMaugh, Steve; Regina, Ahmed; Rahman, Sadequr; Morell, Matthew; Li, Zhongyi
2007-11-01
Starch synthases (SS) are responsible for elongating the alpha-1,4 glucan chains of starch. A doubled haploid population was generated by crossing a line of wheat, which lacks functional ssIIa genes on each genome (abd), and an Australian wheat cultivar, Sunco, with wild type ssIIa alleles on each genome (ABD). Evidence has been presented previously indicating that the SGP-1 (starch granule protein-1) proteins present in the starch granule in wheat are products of the ssIIa genes. Analysis of 100 progeny lines demonstrated co-segregation of the ssIIa alleles from the three genomes with the SGP-1 proteins, providing further evidence that the SGP-1 proteins are the products of the ssIIa genes. From the progeny lines, 40 doubled haploid lines representing the eight possible genotypes for SSIIa (ABD, aBD, AbD, ABd, abD, aBd, Abd, abd) were characterized for their grain weight, protein content, total starch content and starch properties. For some properties (chain length distribution, pasting properties, swelling power, and gelatinization properties), a progressive change was observed across the four classes of genotypes (wild type, single nulls, double nulls and triple nulls). However, for other grain properties (seed weight and protein content) and starch properties (total starch content, granule morphology and crystallinity, granule size distribution, amylose content, amylose-lipid dissociation properties), a statistically significant change only occurred for the triple nulls, indicating that all three genes had to be missing or inactive for a change to occur. These results illustrate the importance of SSIIa in controlling grain and starch properties and the importance of amylopectin fine structure in controlling starch granule properties in wheat.
Coker, Robert H; Williams, Rick H; Yeo, Sophie E; Kortebein, Patrick M; Bodenner, Don L; Kern, Philip A; Evans, William J
2009-11-01
It has been difficult to distinguish the independent effects of caloric restriction versus exercise training on insulin resistance. Utilizing metabolic feeding and supervised exercise training, we examined the influence of caloric restriction vs. exercise training with and without weight loss on hepatic and peripheral insulin resistance. Thirty-four obese, older subjects were randomized to: caloric restriction with weight loss (CR), exercise training with weight loss (EWL), exercise training without weight loss (EX), or controls. Based on an equivalent caloric deficit in EWL and CR, we induced matched weight loss. Subjects in the EX group received caloric compensation. Combined with [6,6(2)H(2)]glucose, an octreotide, glucagon, multistage insulin infusion was performed to determine suppression of glucose production (SGP) and insulin-stimulated glucose disposal (ISGD). Computed tomography scans were performed to assess changes in fat distribution. Body weight decreased similarly in EWL and CR, and did not change in EX and controls. The reduction in visceral fat was significantly greater in EWL (-71 +/- 15 cm(2)) compared to CR and EX. The increase in SGP was also almost 3-fold greater (27 +/- 2%) in EWL. EWL and CR promoted similar improvements in ISGD [+2.5 +/- 0.4 and 2.4 +/- 0.9 mg x kg fat-free mass (FFM)(-1) x min(-1)], respectively. EWL promoted the most significant reduction in visceral fat and the greatest improvement in SGP. Equivalent increases in ISGD were noted in EWL and CR, whereas EX provided a modest improvement. Based on our results, EWL promoted the optimal intervention-based changes in body fat distribution and systemic insulin resistance.
Site locality identification study: Hanford Site. Volume I. Methodology, guidelines, and screening
International Nuclear Information System (INIS)
1980-07-01
Presented in this report are the results of the site locality identification study for the Hanford Site using a screening process. To enable evaluation of the entire Hanford Site, the screening process was applied to a somewhat larger area; i.e., the Pasco Basin. The study consisted of a series of screening steps that progressively focused on smaller areas which are within the Hanford Site and which had a higher potential for containing suitable repository sites for nuclear waste than the areas not included for further study. Five site localities, designated H-1, H-2, H-3, H-4, H-5 (Figure A), varying in size from approximately 10 to 50 square miles, were identified on the Hanford Site. It is anticipated that each site locality may contain one or more candidate sites suitable for a nuclear waste repository. The site locality identification study began with definition of objectives and the development of guidelines for screening. Three objectives were defined: (1) maximize public health and safety; (2) minimize adverse environmental and socioeconomic impacts; and (3) minimize system costs. The screening guidelines have numerical values that provided the basis for the successive reduction of the area under study and to focus on smaller areas that had a higher likelihood of containing suitable sites
U.S. Environmental Protection Agency — This dataset consists of various site features from multiple Superfund sites in U.S. EPA Region 8. These data were acquired from multiple sources at different times...
Nevada Test Site Environmental Report 2007 Attachment A: Site Description
Energy Technology Data Exchange (ETDEWEB)
Cathy Wills
2008-09-01
This appendix expands on the general description of the Nevada Test Site (NTS) presented in the Introduction to the Nevada Test Site Environmental Report 2007 (U.S. Department of Energy [DOE], 2008). Included are subsections that summarize the site's geological, hydrological, climatological, and ecological setting. The cultural resources of the NTS are also presented. The subsections are meant to aid the reader in understanding the complex physical and biological environment of the NTS. An adequate knowledge of the site's environment is necessary to assess the environmental impacts of new projects, design and implement environmental monitoring activities for current site operations, and assess the impacts of site operations on the public residing in the vicinity of the NTS. The NTS environment contributes to several key features of the site which afford protection to the inhabitants of adjacent areas from potential exposure to radioactivity or other contaminants resulting from NTS operations. These key features include the general remote location of the NTS, restricted access, extended wind transport times, the great depths to slow-moving groundwater, little or no surface water, and low population density. This attachment complements the annual summary of monitoring program activities and dose assessments presented in the main body of this report.
International Nuclear Information System (INIS)
Rinne, C.A.; Curry, R.H.; Hagan, J.W.; Seiler, S.W.; Sommer, D.J.; Yancey, E.F.
1990-01-01
The Hanford Site Development Plan (Site Development Plan) is intended to guide the short- and long-range development and use of the Hanford Site. All acquisition, development, and permanent facility use at the Hanford Site will conform to the approved plan. The Site Development Plan also serves as the base document for all subsequent studies that involve use of facilities at the Site. This revision is an update of a previous plan. The executive summary presents the highlights of the five major topics covered in the Site Development Plan: general site information, existing conditions, planning analysis, Master Plan, and Five-Year Plan. 56 refs., 67 figs., 31 tabs
Energy Technology Data Exchange (ETDEWEB)
Rinne, C.A.; Curry, R.H.; Hagan, J.W.; Seiler, S.W.; Sommer, D.J. (Westinghouse Hanford Co., Richland, WA (USA)); Yancey, E.F. (Pacific Northwest Lab., Richland, WA (USA))
1990-01-01
The Hanford Site Development Plan (Site Development Plan) is intended to guide the short- and long-range development and use of the Hanford Site. All acquisition, development, and permanent facility use at the Hanford Site will conform to the approved plan. The Site Development Plan also serves as the base document for all subsequent studies that involve use of facilities at the Site. This revision is an update of a previous plan. The executive summary presents the highlights of the five major topics covered in the Site Development Plan: general site information, existing conditions, planning analysis, Master Plan, and Five-Year Plan. 56 refs., 67 figs., 31 tabs.
Energy Technology Data Exchange (ETDEWEB)
Heffner, J.D. [ed.] [Exploration Resources, Inc., Athens, GA (United States)
1991-11-01
This report provides information regarding the status of and groundwater quality at the waste sites at the Department of Energy`s (DOE) Savannah River Site (SRS). Specific information provided for each waste site at SRS includes its location, size, inventory (when known), and history. Many waste sites at SRS are considered to be of little environmental concern because they contain nontoxic or inert material such as construction rubble and debris. Other waste sites, however, either are known to have had an effect on groundwater quality or are suspected of having the potential to affect groundwater. Monitoring wells have been installed at most of these sites; monitoring wells are scheduled for installation at the remaining sites. Results of the groundwater analyses from these monitoring wells, presented in the appendices, are used in the report to help identify potential contaminants of concern, if any, at each waste site. The list of actions proposed for each waste site in Christensen and Gordon`s 1983 report are summarized, and an update is provided for each site. Planned actions for the future are also outlined.
Analyzing Security-Enhanced Linux Policy Specifications
National Research Council Canada - National Science Library
Archer, Myla
2003-01-01
NSA's Security-Enhanced (SE) Linux enhances Linux by providing a specification language for security policies and a Flask-like architecture with a security server for enforcing policies defined in the language...
Two-dimensional Topology of the Two-Degree Field Galaxy Redshift Survey
Hoyle, Fiona; Vogeley, Michael S.; Gott, J. Richard, III
2002-05-01
We study the topology of the publicly available data released by the Two Degree Field Galaxy Redshift Survey team (2dF GRS). The 2dF GRS data contain over 100,000 galaxy redshifts with a magnitude limit of bJ=19.45 and is the largest such survey to date. The data lie over a wide range of right ascension (75° strips) but only within a narrow range of declination (10° and 15° strips). This allows measurements of the two-dimensional genus to be made. We find that the genus curves of the north Galactic pole (NGP) and south Galactic pole (SGP) are slightly different. The NGP displays a slight meatball shift topology, whereas the SGP displays a bubble-like topology. The current SGP data also have a slightly higher genus amplitude. In both cases, a slight excess of overdense regions is found over underdense regions. We assess the significance of these features using mock catalogs drawn from the Virgo Consortium's Hubble volume ΛCDM z=0 simulation. We find that differences between the NGP and SGP genus curves are only significant at the 1 σ level. The average genus curve of the 2dF GRS agrees well with that extracted from the ΛCDM mock catalogs. We also use the simulations to assess how the current incompleteness of the survey (the strips are not completely filled in) affects the measurement of the genus and find that we are not sensitive to the geometry; there are enough data in the current sample to trace the isolated high- and low-density regions. We compare the amplitude of the 2dF GRS genus curve to the amplitude of the genus curve of a Gaussian random field that we construct to have the same power spectrum as the 2dF GRS. In previous three-dimensional analyses, it was found that the genus curve of observed samples was lower than the Gaussian random field curve, presumably because of high-order correlations present in the data. However, we find that the 2dF GRS genus curve has an amplitude that is slightly higher than that of the power-spectrum-matched Gaussian
New Reactor Siting in Finland, Hanhikivi Site in Pyhaejoki - STUK preliminary safety assessment
International Nuclear Information System (INIS)
Nevalainen, Janne
2013-01-01
STUK has performed a preliminary assessment of the Decision-in-Principle on the Fennovoima application. A variety of factors must be considered in the selection of a site, including effects of the site on the plant design and the effects of the plant on the site environment. These include external hazards, both natural and human-induced. Since this is a new site, an extensive siting process is followed, that can include an EIA. A site survey is performed to identify candidate sites, after investigating a large region and rejecting unsuitable sites. The remaining sites are then screened and compared on the basis of safety and other considerations to select one or more preferred sites. Natural hazards include geology, seismology, hydrology and meteorology. Offshore ice will be a particular hazard for this plant, since the site is on average only 1.5 m above sea level. The design basis earthquake corresponds to a return frequency of 100,000 years, with 50 % confidence. The existing sites in southern Finland used a design peak ground acceleration of 0.1 g with the ground response spectrum maximum at 10 Hz. The candidate sites in northern Finland will require a peak ground acceleration of 0.2 g with the ground response spectrum maximum at 25 Hz
Hydrogeological Site Descriptive Model - a strategy for its development during Site Investigations
Energy Technology Data Exchange (ETDEWEB)
Rhen, Ingvar [SWECO VIAK AB, Goeteborg (Sweden); Follin, Sven [SF GeoLogic AB, Stockholm (Sweden); Hermanson, Jan [Golder Associates, Stockholm (Sweden)
2003-04-01
The report is to present a strategy for the development of the Site Descriptive Hydrogeological Model within the SKB Site Investigation Programme. The report, and similar reports from the Geology, Rock Mechanics, Thermal properties, Hydrogeochemistry, Transport Properties and Surface Ecosystem disciplines are intended to guide SKB Site Descriptive Modelling but also to provide the authorities with an overview of how the modelling should be performed. Thus the objectives of this report are to: provide guidelines for the modelling of different sites resulting in consistent handling of modelling issues during the Site Investigations, provide a structure for the modelling sequence that is suitable for the establishment of a Site Descriptive model and provide some necessary details that should be considered in a Site Descriptive model.
Hydrogeological Site Descriptive Model - a strategy for its development during Site Investigations
International Nuclear Information System (INIS)
Rhen, Ingvar; Follin, Sven; Hermanson, Jan
2003-04-01
The report is to present a strategy for the development of the Site Descriptive Hydrogeological Model within the SKB Site Investigation Programme. The report, and similar reports from the Geology, Rock Mechanics, Thermal properties, Hydrogeochemistry, Transport Properties and Surface Ecosystem disciplines are intended to guide SKB Site Descriptive Modelling but also to provide the authorities with an overview of how the modelling should be performed. Thus the objectives of this report are to: provide guidelines for the modelling of different sites resulting in consistent handling of modelling issues during the Site Investigations, provide a structure for the modelling sequence that is suitable for the establishment of a Site Descriptive model and provide some necessary details that should be considered in a Site Descriptive model
Computer aided site management. Site use management by digital mapping
International Nuclear Information System (INIS)
Chupin, J.C.
1990-01-01
The logistics program developed for assisting the Hague site management is presented. A digital site mapping representation and geographical data bases are used. The digital site map and its integration into a data base are described. The program can be applied to urban and rural land management aid. Technical administrative and economic evaluations of the program are summarized [fr
The ligand-binding domain of the cell surface receptor for urokinase-type plasminogen activator
DEFF Research Database (Denmark)
Behrendt, N; Ploug, M; Patthy, L
1991-01-01
with the internal repeats of u-PAR constitute the extracellular part of Ly-6 antigens and of the squid glycoprotein Sgp-2. Like u-PAR, these proteins are attached to the membrane by a glycosyl-phosphatidylinositol anchor. The hydrophilic, ligand-binding u-PAR domain identified in the present study has potential...
Site characterization quality assurance for the California LLRW Disposal Site Project
International Nuclear Information System (INIS)
Hanrahan, T.P.; Ench, J.E.; Serlin, C.L.; Bennett, C.B.
1988-01-01
In December of 1985 US Ecology was chosen as the license designee for the State of California's low-level radioactive waste disposal facility. In early 1987, three candidate sites were selected for characterization studies in preparation for identifying the preferred site. The geotechnical characterization activities along with studies of the ecological and archaeological attributes, as well as assessments of the socio-economic impacts and cultural resources all provide input towards selection of the proposed site. These technical studies in conjunction with comments from local citizen committees and other interested parties are used as a basis for determining the proposed site for which full site characterization as required by California licensing requirements are undertaken. The purpose of this paper is to present an overview of the program for Quality Assurance and Quality Control for the site characterization activities on the California LLRW Disposal Site Project. The focus is on three major perspectives: The composite QA Program and two of the primary characterization activities, the geotechnical and the meteorological investigations
International Nuclear Information System (INIS)
Olsen, C.W.
1983-07-01
The conditions and criteria for selecting a site for a nuclear weapons test at the Nevada Test Site are summarized. Factors considered are: (1) scheduling of drill rigs, (2) scheduling of site preparation (dirt work, auger hole, surface casing, cementing), (3) schedule of event (when are drill hole data needed), (4) depth range of proposed W.P., (5) geologic structure (faults, Pz contact, etc.), (6) stratigraphy (alluvium, location of Grouse Canyon Tuff, etc.), (7) material properties (particularly montmorillonite and CO 2 content), (8) water table depth, (9) potential drilling problems (caving), (10) adjacent collapse craters and chimneys, (11) adjacent expended but uncollapsed sites, (12) adjacent post-shot or other small diameter holes, (13) adjacent stockpile emplacement holes, (14) adjacent planned events (including LANL), (15) projected needs of Test Program for various DOB's and operational separations, and (16) optimal use of NTS real estate
Site-Specific Atmospheric Dispersion Characteristics of Korean Nuclear Power Plant Sites
International Nuclear Information System (INIS)
Han, M. H.; Kim, E. H.; Suh, K. S.; Hwang, W. T.; Choi, Y. G.
2001-01-01
Site-specific atmospheric dispersion characteristics have been analyzed. The northwest and the southwest wind prevail on nuclear sites of Korea. The annual isobaric surface averaged for twenty years around Korean peninsula shows that west wind prevails. The prevailing west wind is profitable in the viewpoint of radiation protection because three of four nuclear sites are located in the east side. Large scale field tracer experiments over nuclear sites have been conducted for the purpose of analyzing the atmospheric dispersion characteristics and validating a real-time atmospheric dispersion and dose assessment system FADAS. To analyze the site-specific atmospheric dispersion characteristics is essential for making effective countermeasures against a nuclear emergency
Indian Academy of Sciences (India)
First page Back Continue Last page Graphics. Science of Guessing Passwords. Joseph Bonneau. Ph.D. Thesis,. Univ. of Cambridge, 2012. Advisor: Ross Anderson, FRS. NSA AWARD FOR THE BEST SCIENTIFIC CYBERSECURITY PAPER.
29 CFR 1926.752 - Site layout, site-specific erection plan and construction sequence.
2010-07-01
... 29 Labor 8 2010-07-01 2010-07-01 false Site layout, site-specific erection plan and construction... Steel Erection § 1926.752 Site layout, site-specific erection plan and construction sequence. (a... strength or sufficient strength to support the loads imposed during steel erection. (c) Site layout. The...
Iowa State University GIS Support and Research Facility — Sites contaminated by hazardous materials or wastes. These sites are those administered by the Contaminated Sites Section of Iowa DNR. Many are sites which are...
International Nuclear Information System (INIS)
Hathaway, H.B.; Daly, K.S.; Rinne, C.A.; Seiler, S.W.
1993-05-01
The Hanford Site Development Plan (HSDP) provides an overview of land use, infrastructure, and facility requirements to support US Department of Energy (DOE) programs at the Hanford Site. The HSDP's primary purpose is to inform senior managers and interested parties of development activities and issues that require a commitment of resources to support the Hanford Site. The HSDP provides an existing and future land use plan for the Hanford Site. The HSDP is updated annually in accordance with DOE Order 4320.1B, Site Development Planning, to reflect the mission and overall site development process. Further details about Hanford Site development are defined in individual area development plans
INIS: new world-wide nuclear information system
International Nuclear Information System (INIS)
Ohmori, Eiichi; Furuya, Minoru
1976-01-01
A new search system utilizing Atomindex is expounded. The nuclear information system of United States of America will be shifted to the larger scale system, Atomindex, at the moment of discontinuing the publication of Nuclear Science Abstract (NSA). This shifting exerts large or small influence upon the information systems of the other countries. The Atomindex is a publication of the International Nuclear Information System (INIS), and it includes most market unavailable reports. It is delivered through the clearing house to the users. Main differences between INIS and NSA are illustrated. Each piece of literature is listed under one or more descriptor pairs. Each pair is composed of the main heading and its qualifier, both of which are descriptors. Atomindex employs four working languages, namely English, French, Russian and Spanish. However, a version in the original language, even when this is not a working language can be recorded on magnetic tapes. Many special characters (suffixes, Greek, etc.) as well as alphabet are used, and italic type or boldface can be designated, so that the quality of Atomindex is better than that of NSA. The tapes for SDI and RS will be utilized as on-line real time systems. The second generation that utilizes the computer seems to be superseding the first generation that turns over the abstracts page by page. (Iwakiri, K.)
Directory of Open Access Journals (Sweden)
Monika Gupta
2016-01-01
Full Text Available Background: Hip fracture is a severe health burden in the elderly population. In order to prevent, it is to evaluate the bone strength by establishing the relation between bone mineral density (BMD, neck strength, and geometry. Materials and Methods: The subjects under study were 100 postmenopausal women who visited bone clinic of Bharat Scan Centre. After recording general profile such as age, body mass index (BMI, geometric measures such as hip axis length (HAL, neck shaft angle (NSA, and neck width (NW were measured from digital X-ray. For the same individuals, BMD was measured using dual energy X-ray absorptiometry (DXA scan. From the DXA print out neck strength was calculated using the formula = sectional modulus/HAL. Results: The correlation test was analyzed among BMD, neck strength, anthropometric, and geometric factors using Statistical packages for social services (SPSS software. BMD is inversely related with age and positively correlated with height, weight, and BMI. HAL, NSA, and NW had a weaker association with BMD. Age, BMD, and NSA had a negative relation with neck strength. HAL and NW had a positive relation with neck strength. Conclusion: Noninvasive means of associating neck strength with BMD and geometry will provide improved estimates for fracture risk beyond any other invasive method of assessing bone mineral properties.
DEFF Research Database (Denmark)
Yordanova, Ginka; Vesth, Allan
The report describes site calibration measurements carried out on a site in Denmark. The measurements are carried out in accordance to Ref. [1]. The site calibration is carried out before a power performance measurement on a given turbine to clarify the influence from the terrain on the ratio...
Jurka, Jerzy W.
1997-01-01
Enhanced homologous recombination is obtained by employing a consensus sequence which has been found to be associated with integration of repeat sequences, such as Alu and ID. The consensus sequence or sequence having a single transition mutation determines one site of a double break which allows for high efficiency of integration at the site. By introducing single or double stranded DNA having the consensus sequence flanking region joined to a sequence of interest, one can reproducibly direct integration of the sequence of interest at one or a limited number of sites. In this way, specific sites can be identified and homologous recombination achieved at the site by employing a second flanking sequence associated with a sequence proximal to the 3'-nick.
Nevada National Security Site Environmental Report 2011 Attachment A: Site Description
International Nuclear Information System (INIS)
Wills, Cathy
2012-01-01
This attachment expands on the general description of the Nevada National Security Site (NNSS) presented in the Introduction to the Nevada National Security Site Environmental Report 2011. Included are subsections that summarize the site's geological, hydrological, climatological, and ecological setting and the cultural resources of the NNSS. The subsections are meant to aid the reader in understanding the complex physical and biological environment of the NNSS. An adequate knowledge of the site's environment is necessary to assess the environmental impacts of new projects, design and implement environmental monitoring activities for current site operations, and assess the impacts of site operations on the public residing in the vicinity of the NNSS. The NNSS environment contributes to several key features of the site that afford protection to the inhabitants of adjacent areas from potential exposure to radioactivity or other contaminants resulting from NNSS operations. These key features include the general remote location of the NNSS, restricted access, extended wind transport times, the great depths to slow-moving groundwater, little or no surface water, and low population density. This attachment complements the annual summary of monitoring program activities and dose assessments presented in the main body of this report.
Hanford Site Infrastructure Plan
International Nuclear Information System (INIS)
1990-01-01
The Hanford Site Infrastructure Plan (HIP) has been prepared as an overview of the facilities, utilities, systems, and services that support all activities on the Hanford Site. Its purpose is three-fold: to examine in detail the existing condition of the Hanford Site's aging utility systems, transportation systems, Site services and general-purpose facilities; to evaluate the ability of these systems to meet present and forecasted Site missions; to identify maintenance and upgrade projects necessary to ensure continued safe and cost-effective support to Hanford Site programs well into the twenty-first century. The HIP is intended to be a dynamic document that will be updated accordingly as Site activities, conditions, and requirements change. 35 figs., 25 tabs
Gyoda, Koichi; Shinozuka, Takashi
1995-06-01
An open-field test site with measurement equipment, a turn table, antenna positioners, and measurement auxiliary equipment was remodelled at the CRL north-site. This paper introduces the configuration, specifications and characteristics of this new open-field test site. Measured 3-m and 10-m site attenuations are in good agreement with theoretical values, and this means that this site is suitable for using 3-m and 10-m method EMI/EMC measurements. The site is expected to be effective for antenna measurement, antenna calibration, and studies on EMI/EMC measurement methods.
International Nuclear Information System (INIS)
Caries, J.C.; Hugon, J.; Grauby, A.
1980-01-01
This methodology consists in an essentially dynamic, estimated and follow-up analysis of the impact of discharges on all the environment compartments, whether natural or not, that play a part in the protection of man and his environment. It applies at two levels, to wit: the choice of site, or the detailed study of the site selected. Two examples of its application will be developed, namely: at the choice of site level in the case of marine sites, and of the detailed study level of the chosen site in that of a riverside site [fr
SITE: a methodology for assessment of energy facility siting patterns. Regional studies program
International Nuclear Information System (INIS)
Frigerio, N.A.; Habegger, L.J.; King, R.F.; Hoover, L.J.; Clark, N.A.; Cobian, J.M.
1975-08-01
The timely development of the nation's energy production capacity in a manner that minimizes potential adverse local and regional impacts associated with energy facilities requires the use of sophisticated techniques for evaluation of siting alternatives and fuel cycle options. This report is a documentation of the computerized SITE methodology that has been developed for evaluating health, environmental, and socioeconomic impacts related to utilization of alternate sites for energy production within a region of interest. The cost, impact, and attribute vectors, which are generated and displayed on density maps, can be used in a multiparameter overlay process to identify preferable siting areas. The assessment of clustered facilities in energy centers is also possible within the SITE analysis framework. An application of the SITE methodology to Northern Illinois is presented. Also included is a description of the ongoing extension of SITE for the accumulative evaluation of alternative regional energy siting patterns and fuel cycle options. An appendix provides documentation and user information for the SITE computer program
Site Characterization Work Plan for Gnome-Coach Site, New Mexico
Energy Technology Data Exchange (ETDEWEB)
DOE/NV
2001-02-13
Project Gnome was the first nuclear experiment conducted under the U.S. Atomic Energy Commission (AEC), predecessor to the U.S. Department of Energy (DOE), Plowshare Program. Gnome was part of a joint government-industry experiment focused on developing nuclear devices exclusively for peaceful purposes. The intent of the Gnome experiment was to evaluate the effects of a nuclear detonation in a salt medium. Historically, Project Gnome consisted of a single detonation of a nuclear device on December 10, 1961. Since the Gnome detonation, the AEC/DOE has conducted surface restoration, site reconnaissance, and decontamination and decommissioning activities at the site. In addition, annual groundwater sampling is performed under a long-term hydrological monitoring program begun in 1980. Coach, an experiment to be located near the Gnome project, was initially scheduled for 1963. Although construction and rehabilitation were completed for Coach, the experiment was canceled and never executed. Known collectively as Project Gnome-Coach, the site is situated within the Salado Formation approximately 25 miles east of Carlsbad, New Mexico, in Eddy County, and is comprised of nearly 680 acres, of which 60 acres are disturbed from the combined AEC/DOE operations. The scope of this work plan is to document the environmental objectives and the proposed technical site investigation strategies that will be utilized for the site characterization of the project. The subsurface at the Gnome-Coach site has two contaminant sources that are fundamentally different in terms of both their stratigraphic location and release mechanism. The goal of this characterization is to collect data of sufficient quantity and quality to establish current site conditions and to use the data to identify and evaluate if further action is required to protect human health and the environment and achieve permanent closure of the site. The results of these activities will be presented in a subsequent corrective
Energy Technology Data Exchange (ETDEWEB)
Dudhia, J.; Parsons, D.B. [National Center for Atmospheric Research, Boulder, CO (United States)
1996-04-01
An Intensive Observation Period (IOP) of the Atmospheric Radiation Measurement (ARM) Program took place at the Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site from June 16-26, 1993. The National Center for Atmospheric Research (NCAR)/Penn State Mesoscale Model (MM5) has been used to simulate this period on a 60-km domain with 20- and 6.67-km nests centered on Lamont, Oklahoma. Simulations are being run with data assimilation by the nudging technique to incorporate upper-air and surface data from a variety of platforms. The model maintains dynamical consistency between the fields, while the data correct for model biases that may occur during long-term simulations and provide boundary conditions. For the work reported here the Mesoscale Atmospheric Prediction System (MAPS) of the National Ocean and Atmospheric Administration (NOAA) 3-hourly analyses were used to drive the 60-km domain while the inner domains were unforced. A continuous 10-day period was simulated.
Rotating shadowband radiometer development and analysis of spectral shortwave data
Energy Technology Data Exchange (ETDEWEB)
Michalsky, J.; Harrison, L.; Min, Q. [State Univ. of New York, Albany, NY (United States)] [and others
1996-04-01
Our goals in the Atmospheric Radiation Measurement (ARM) Program are improved measurements of spectral shortwave radiation and improved techniques for the retrieval of climatologically sensitive parameters. The multifilter rotating shadowband radiometer (MFRSR) that was developed during the first years of the ARM program has become a workhorse at the Southern Great Plains (SGP) Cloud and Radiation Testbed (CART) site, and it is widely deployed in other climate programs. We have spent most of our effort this year developing techniques to retrieve column aerosol, water vapor, and ozone from direct beam spectral measurements of the MFRSR. Additionally, we have had some success in calculating shortwave surface diffuse spectral irradiance. Using the surface albedo and the global irradiance, we have calculated cloud optical depths. From cloud optical depth and liquid water measured with the microwave radiometer, we have calculated effective liquid cloud particle radii. The rest of the text will provide some detail regarding each of these efforts.
Energy Technology Data Exchange (ETDEWEB)
Revercomb, H.E.; Knuteson, R.O.; Best, F.A.; Dirkx, T.P. [Univ. of Wisconsin, Madison, WI (United States)] [and others
1996-04-01
High spectral resolution observations of downwelling emission from 3 to 19 microns have been made by the Atmospheric Emitted Radiance Interferometer (AERI) Prototype at the Southern Great Plains (SGP) Cloud and Radiative Testbed (CART) site for over two years. The spectral data set from AERI provides a basis for improving clear sky radiative transfer; determining the radiative impact of clouds, including the derivation of cloud radiative properties; defining the influences of aerosols in the window regions; and retrieving boundary layer state properties, including temperature, water vapor, and other trace gases. The data stream of radiometrically and spectrally calibrated radiances is routinely provided by Pacific Northwest Laboratory (PNL) to those science teams requesting it, and further information on the instrument and data characteristics is available in the ARM Science Team proceedings for 1993 and 1994 and in several conference publications. This paper describes the AERI status, calibration, field experiment wit a new AERI-01 and schedule, window region emissions, and future AERI plans.
Balloon-Borne Full-Column Greenhouse Gas Profiling Field Campaign Report
Energy Technology Data Exchange (ETDEWEB)
Fischer, Marc L [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)
2017-03-01
The vertical distributions of CO2, CH4, and other gases provide important constraints for the determination of terrestrial and ocean sources and sinks of carbon and other biogeochemical processes in the Earth system. The DOE Biological and Environmental Research Program (DOE-BER) and the NOAA Earth System Research Laboratory (NOAA-ESRL) collaborate to quantify the vertically resolved distribution of atmospheric carbon-cycle gases (CO2, and CH4) within approximately 99% of the atmospheric column at the DOE ARM Southern Great Plains Facility in Oklahoma. In 2015, flights were delayed while research at NOAA focused on evaluating sources of systematic errors in the gas collection and analysis system and modifying the sampling system to provide duplicate air samples in a single flight package. In 2017, we look forward to proposing additional sampling and analysis at ARM-SGP (and other sites) that characterize the vertical distribution of CO2 and CH4 over time and space.
Kadiyala, Suneetha; Prost, Audrey; Harris-Fry, Helen; O'Hearn, Meghan; Pradhan, Ronali; Pradhan, Shibananth; Mishra, Naba Kishore; Rath, Suchitra; Nair, Nirmala; Rath, Shibanand; Tripathy, Prasantha; Krishnan, Sneha; Koniz-Booher, Peggy; Danton, Heather; Elbourne, Diana; Sturgess, Joanna; Beaumont, Emma; Haghparast-Bidgoli, Hassan; Skordis-Worrall, Jolene; Mohanty, Satyanarayan; Upadhay, Avinash; Allen, Elizabeth
2018-03-09
Maternal and child undernutrition have adverse consequences for pregnancy outcomes and child morbidity and mortality, and they are associated with low educational attainment, economic productivity as an adult, and human wellbeing. 'Nutrition-sensitive' agriculture programs could tackle the underlying causes of undernutrition. This study is a four-arm cluster randomised controlled trial in Odisha, India. Interventions are as follows: (1) an agricultural extension platform of women's groups viewing and discussing videos on nutrition-sensitive agriculture (NSA) practices, and follow-up visits to women at home to encourage the adoption of new practices shown in the videos; (2) women's groups viewing and discussing videos on NSA and nutrition-specific practices, with follow-up visits; and (3) women's groups viewing and discussing videos on NSA and nutrition-specific practices combined with a cycle of Participatory Learning and Action meetings, with follow-up visits. All arms, including the control, receive basic nutrition training from government community frontline workers. Primary outcomes, assessed at baseline and 32 months after the start of the interventions, are (1) percentage of children aged 6-23 months consuming ≥ 4 out of 7 food groups per day and (2) mean body mass index (BMI) (kg/m 2 ) of non-pregnant, non-postpartum (gave birth > 42 days ago) mothers or female primary caregivers of children aged 0-23 months. Secondary outcomes are percentage of mothers consuming ≥ 5 out of 10 food groups per day and percentage of children's weight-for-height z-score 70%) proportion of Scheduled Tribe or Scheduled Caste (disadvantaged) households. A process evaluation will assess the quality of implementation and mechanisms behind the intervention effects. A cost-consequence analysis will compare incremental costs and outcomes of the interventions. This trial will contribute evidence on the impacts of NSA extension through participatory, low-cost, video
International Nuclear Information System (INIS)
Hathaway, H.B.; Daly, K.S.; Rinne, C.A.; Seiler, S.W.
1992-05-01
The Hanford Site Development Plan (HSDP) provides an overview of land use, infrastructure, and facility requirements to support US Department of Energy (DOE) programs at the Hanford Site. The HSDP's primary purpose is to inform senior managers and interested parties of development activities and issues that require a commitment of resources to support the Hanford Site. The HSDP provides a land use plan for the Hanford Site and presents a picture of what is currently known and anticipated in accordance with DOE Order 4320.1B. Site Development Planning. The HSDP wig be updated annually as future decisions further shape the mission and overall site development process. Further details about Hanford Site development are defined in individual area development plans
Examination of objective analysis precision using wind profiler and radiosonde network data
Energy Technology Data Exchange (ETDEWEB)
Mace, G.G.; Ackerman, T.P. [Penn State Univ., University Park, PA (United States)
1996-04-01
One of the principal research strategies that has emerged from the science team of the Atmospheric Radiation Measurement (ARM) Program is the use of a single column model (SCM). The basic assumption behind the SCM approach is that a cloud and radiation parameterization embedded in a general circulation model can be effectively tested and improved by extracting that column parameterization from the general circulation model and then driving this single column at the lateral boundaries of the column with diagnosed large-scale atmospheric forcing. A second and related assumption is that the large-scale atmospheric state, and hence the associated forcing, can be characterized directly from observations. One of the primary reasons that the Southern Great Plains (SGP) site is located in Lamont, Oklahoma, is because Lamont is at the approximate center of the NOM Wind Profiler Demonstration Array (WPDA). The assumption was that hourly average wind profiles provided by the 7 wind profilers (one Lamont and six surrounding it in a hexagon) coupled with radiosonde launches every three hours at 5 sites (Lamont plus four of the six profiler locations forming the hexagon) would be sufficient to characterize accurately the large-scale forcing at the site and thereby provide the required forcing for the SCM. The goal of this study was to examine these three assumptions.
The disposal of Canada's nuclear fuel waste: site screening and site evaluation technology
International Nuclear Information System (INIS)
Davison, C.C.; Brown, A.; Everitt, R.A.; Gascoyne, M.; Kozak, E.T.; Lodha, G.S.; Martin, C.D.; Soonawala, N.M.; Stevenson, D.R.; Thorne, G.A.; Whitaker, S.H.
1994-06-01
The concept for the disposal of Canada's nuclear fuel waste is to dispose of the waste in an underground vault, nominally at 500 m to 1000 m depth, at a suitable site in plutonic rock of the Canadian Shield. The feasibility of this concept and assessments of its impact on the environment and human health, will be documented by AECL in an Environmental Impact Statement (EIS). This report is one of nine primary references for the EIS. It describes the approach and methods that would be used during the siting stage of the disposal project to identify a preferred candidate disposal site and to confirm its suitability for constructing a disposal facility. The siting stage is divided into two distinct but closely related substages, site screening and site evaluation. Site screening would mainly involve reconnaissance investigations of siting regions of the Shield to identify potential candidate areas where suitable vault locations are likely to exist. Site screening would identify a small number of candidate areas where further detailed investigations were warranted. Site evaluation would involve progressively more detailed surface and subsurface investigations of the candidate areas to first identify potentially suitable vault locations within the candidate areas, and then characterize these potential disposal sites to identify the preferred candidate location for constructing the disposal vault. Site evaluation would conclude with the construction of exploratory shafts and tunnels at the preferred vault location, and underground characterization would be done to confirm the suitability of the preferred candidate site. An integrated program of geological, geophysical, hydrogeological, geochemical and geomechanical investigations would be implemented to obtain the geoscience information needed to assess the suitability of the candidate siting areas and candidate sites for locating a disposal vault. The candidate siting areas and candidate disposal vault sites would be
Site observational work plan for the UMTRA Project site at Spook, Wyoming
International Nuclear Information System (INIS)
1995-05-01
The Spook, Wyoming, site observational work plan proposes site-specific activities to achieve compliance with Subpart B of 40 CFR Part 192 (1994) of the final US Environmental Protection Agency (EPA) ground water protection standards 60 FR 2854 (1995) at this Uranium Mill Tailing Remedial Action (UMTRA) Project site. This draft SOWP presents a comprehensive summary of existing site characterization data, a conceptual site model of the nature and extent of ground water contamination, exposure pathways, and potential impact to human health and the environment. Section 2.0 describes the requirements for meeting ground water standards at UMTRA Project sites. Section 3.0 defines past and current conditions, describes potential environmental and human health risks, and provides site-specific data that supports the selection of a proposed ground water compliance strategy. Section 4.0 provides the justification for selecting the proposed ground water compliance strategy based on the framework defined in the ground water programmatic environmental impact statement (PEIS)
Modeling Security-Enhanced Linux Policy Specifications for Analysis (Preprint)
National Research Council Canada - National Science Library
Archer, Myla; Leonard, Elizabeth; Pradella, Matteo
2003-01-01
Security-Enhanced (SE) Linux is a modification of Linux initially released by NSA in January 2001 that provides a language for specifying Linux security policies and, as in the Flask architecture, a security server...
Hanford Site Composite Analysis Technical Approach Description: Hanford Site Disposition Baseline.
Energy Technology Data Exchange (ETDEWEB)
Cobb, M. A. [CH2M HILL Plateau Remediation Company, Richland, WA (United States); Dockter, R. E. [CH2M HILL Plateau Remediation Company, Richland, WA (United States)
2017-10-02
The permeability of ground surfaces within the U.S. Department of Energy’s (DOE) Hanford Site strongly influences boundary conditions when simulating the movement of groundwater using the Subsurface Transport Over Multiple Phases model. To conduct site-wide modeling of cumulative impacts to groundwater from past, current, and future waste management activities, a site-wide assessment of the permeability of surface conditions is needed. The surface condition of the vast majority of the Hanford Site has been and continues to be native soils vegetated with dryland grasses and shrubs.
Thioredoxin binding site of phosphoribulokinase overlaps the catalytic site
International Nuclear Information System (INIS)
Porter, M.A.; Hartman, F.C.
1986-01-01
The ATP-regulatory binding site of phosphoribulokinase was studied using bromoacetylethanolamine phosphate (BrAcNHEtOP). BrAcNHEtOP binds to the active-regulatory binding site of the protein. Following trypsin degradation of the labeled protein, fragments were separated by HPLC and sequenced. (DT)
Web sites that work secrets from winning web sites
Smith, Jon
2012-01-01
Leading web site entrepreneur Jon Smith has condensed the secrets of his success into 52 inspiring ideas that even the most hopeless technophobe can implement. The brilliant tips and practical advice in Web sites that work will uplift and transform any website, from the simplest to the most complicated. It deals with everything from fundamentals such as how to assess the effectiveness of a website and how to get a site listed on the most popular search engines to more sophisticated challenges like creating a community and dealing with legal requirements. Straight-talking, practical and humorou
Nevada National Security Site Environmental Report 2011 Attachment A: Site Description
Energy Technology Data Exchange (ETDEWEB)
Cathy Wills, ed.
2012-09-12
This attachment expands on the general description of the Nevada National Security Site (NNSS) presented in the Introduction to the Nevada National Security Site Environmental Report 2011. Included are subsections that summarize the site's geological, hydrological, climatological, and ecological setting and the cultural resources of the NNSS. The subsections are meant to aid the reader in understanding the complex physical and biological environment of the NNSS. An adequate knowledge of the site's environment is necessary to assess the environmental impacts of new projects, design and implement environmental monitoring activities for current site operations, and assess the impacts of site operations on the public residing in the vicinity of the NNSS. The NNSS environment contributes to several key features of the site that afford protection to the inhabitants of adjacent areas from potential exposure to radioactivity or other contaminants resulting from NNSS operations. These key features include the general remote location of the NNSS, restricted access, extended wind transport times, the great depths to slow-moving groundwater, little or no surface water, and low population density. This attachment complements the annual summary of monitoring program activities and dose assessments presented in the main body of this report.
Re-editing and Censoring of Detectors in Negative Selection Algorithm
Directory of Open Access Journals (Sweden)
X.Z. Gao
2009-12-01
Full Text Available The Negative Selection Algorithm (NSA is a kind of novelty detection method inspired by the biological self/nonself discrimination principles. In this paper, we propose two new schemes for the detectors re-editing and censoring in the NSA. The detectors that fail to pass the negative selection phase are re-edited and updated to become qualified using the Differential Evolution (DE method. In the detectors censoring, the qualification of all the detectors is evaluated, and only those appropriate ones are retained. Prior knowledge of the anomalous data is utilized to discriminate the detectors so that their anomaly detection performances can be improved. The effectiveness of our detectors re-editing and censoring approaches is examined with both artificial signals and a practical bearings fault detection problem.
Effects of Dirac Sea on Giant Resonance States
International Nuclear Information System (INIS)
Kurasawa, H.; Suzuki, T.
2004-01-01
There are two approximations in relativistic models which keep the continuity equation of the baryon current without renormalization of the divergence. One is the no-free-term approximation (NFA) which neglects the divergent terms, but keeps the Pauli blocking terms coming from nucleon-antinucleon excitations in the RPA correlation functions. The other is the no-sea approximation (NSA) where antiparticle states are assumed to be empty with negative energies. It is shown that both approximations formally satisfy the Ikeda sum rule and the RPA theorem for the β - and β + transition strengths also, but that the NFA requires negative strengths in the positive excitation energy region, while the NSA requires positive strengths in the negative excitation energy region, as a price of neglecting the renormalization of the divergence
2010-01-06
... engaged in activities related to the production of integrated circuits. The company reports that on-site... Corporation Arlington Manufacturing Site Including On-Site Leased Workers From GCA, CMPA (Silverleaf), Custom..., applicable to workers of National Semiconductor Corporation, Arlington Manufacturing Site, including on-site...
1994 Site environmental report
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-07-01
The Fernald site is a Department of Energy (DOE)-owned facility that produced high-quality uranium metals for military defense for nearly 40 years. DOE suspended production at the site in 1989 and formally ended production in 1991. Although production activities have ceased, the site continues to examine the air and liquid pathways as possible routes through which pollutants from past operations and current remedial activities may leave the site. The Site Environmental Report (SER) is prepared annually in accordance with DOE Order 5400.1, General Environmental Protection Program. This 1994 SER provides the general public as well as scientists and engineers with the results from the site`s ongoing Environmental Monitoring Program. Also included in this report is information concerning the site`s progress toward achieving full compliance with requirements set forth by DOE, U.S. Environmental Protection Agency (USEPA), and Ohio EPA (OEPA). For some readers, the highlights provided in this Executive Summary may provide sufficient information. Many readers, however, may wish to read more detailed descriptions of the information than those which are presented here. All information presented in this summary is discussed more fully in the main body of this report.
Site Specific Ground Response Analysis for Quantifying Site Amplification at A Regolith Site
Directory of Open Access Journals (Sweden)
Bambang Setiawan
2017-08-01
Full Text Available DOI: 10.17014/ijog.4.3.159-167A numerical model has demonstrated that it can simulate reasonably well earthquake motions at the ground level during a seismic event. The most widely used model is an equivalent linear approach. The equivalent linear model was used to compute the free-field response of Adelaide regolith during the 1997 Burra earthquake. The aim of this study is to quantify the amplification at the investigated site. The model computed the ground response of horizontally layered soil deposits subjected to transient and vertically propagating shear waves through a one-dimensional-soil column. Each soil layer was assumed to be homogeneous, visco-elastic, and infinite in the horizontal extent. The results of this study were compared to other studies and forward computation of the geotechnical dynamic parameters of the investigated site. The amplification triggered by the 1997 Burra seismic event was deduced. This study reveals the amplification factor up to 3.6 at the studied site.
Energy Technology Data Exchange (ETDEWEB)
NONE
2008-07-01
As the nuclear industry moves into a new development phase, many facilities built in the fifties and sixties are reaching the end of their service life. Dismantling them and rehabilitating the sites on which they stand is a major industrial challenge which will give rise to a number of new projects. AREVA has more than 20 years' experience in these highly technical fields. As more and more sites reach the end of their service life, AREVA considers nuclear site value development as a fully-fledged industrial activity. The group's competencies in this field have been grouped together to form a dedicated entity: the Nuclear Site Value Development Business Unit, created in 2008. Several billion euros are invested in site value development projects which are far-reaching and complex, and often last for several decades. Long before work actually begins, lengthy studies and preparations are required to schedule operations, select the techniques to be used and optimize costs and deadlines. The Nuclear Site Value Development BU is currently working on four major projects involving its own facilities and those of the CEA: - La Hague: dismantling of the first generation of used fuel recycling facilities. Between 1966 and 1998, almost 5,000 tons of used fuel from graphite-moderated gas-cooled reactors, 4,500 tons of light water reactor fuel, as well as fuel from fast reactors and research reactors, were treated at UP2 400, the very first industrial recycling plant on the La Hague site. - Marcoule: first-time dismantling of a recycling plant. 1,000 rooms to be cleaned up, 30,000 tons of waste to be treated, 30 years of work. - Cadarache: first-time dismantling of a Mox fuel fabrication plant. The Cadarache plant was commissioned in 1962 to fabricate fuel for fast reactors; this was followed by MOX fuel for light water reactors, an activity which continued until the plant was shut down in 2003. - Annecy and Veurey: giving a new lease of life to former industrial sites
Implementing Site-based Budgeting.
Sielke, Catherine C.
2001-01-01
Discusses five questions that must be answered before implementing site-based budgeting: Why are we doing this? What budgeting decisions will be devolved to the school site? How do dollars flow from the central office to the site? Who will be involved at the site? How will accountability be achieved? (Author/PKP)
U.S. Environmental Protection Agency — EPA True NO2 ground site measurements – multiple sites - http://www-air.larc.nasa.gov/cgi-bin/ArcView/discover-aq.tx-2013; TCEQ ground site measurements of...
National Air Toxics Assessment - 2005, EPA Region 2 (EPA.AIR.NATA99_R2)
U.S. Environmental Protection Agency — This data layer is based on the model results of the 1999 National-Scale Assessment (N-SA), a part of the National Air Toxics Assessment (NATA), conducted by EPA's...
National Air Toxics Assessment - 2002, EPA Region 2 (EPA.AIR.NATA99_R2)
U.S. Environmental Protection Agency — This data layer is based on the model results of the 1999 National-Scale Assessment (N-SA), a part of the National Air Toxics Assessment (NATA), conducted by EPA's...
National Air Toxics Assessment - 1999, EPA Region 2 (EPA.AIR.NATA99_R2)
U.S. Environmental Protection Agency — This data layer is based on the model results of the 1999 National-Scale Assessment (N-SA), a part of the National Air Toxics Assessment (NATA), conducted by EPA's...
PAPR reduction in FBMC using an ACE-based linear programming optimization
van der Neut, Nuan; Maharaj, Bodhaswar TJ; de Lange, Frederick; González, Gustavo J.; Gregorio, Fernando; Cousseau, Juan
2014-12-01
This paper presents four novel techniques for peak-to-average power ratio (PAPR) reduction in filter bank multicarrier (FBMC) modulation systems. The approach extends on current PAPR reduction active constellation extension (ACE) methods, as used in orthogonal frequency division multiplexing (OFDM), to an FBMC implementation as the main contribution. The four techniques introduced can be split up into two: linear programming optimization ACE-based techniques and smart gradient-project (SGP) ACE techniques. The linear programming (LP)-based techniques compensate for the symbol overlaps by utilizing a frame-based approach and provide a theoretical upper bound on achievable performance for the overlapping ACE techniques. The overlapping ACE techniques on the other hand can handle symbol by symbol processing. Furthermore, as a result of FBMC properties, the proposed techniques do not require side information transmission. The PAPR performance of the techniques is shown to match, or in some cases improve, on current PAPR techniques for FBMC. Initial analysis of the computational complexity of the SGP techniques indicates that the complexity issues with PAPR reduction in FBMC implementations can be addressed. The out-of-band interference introduced by the techniques is investigated. As a result, it is shown that the interference can be compensated for, whilst still maintaining decent PAPR performance. Additional results are also provided by means of a study of the PAPR reduction of the proposed techniques at a fixed clipping probability. The bit error rate (BER) degradation is investigated to ensure that the trade-off in terms of BER degradation is not too severe. As illustrated by exhaustive simulations, the SGP ACE-based technique proposed are ideal candidates for practical implementation in systems employing the low-complexity polyphase implementation of FBMC modulators. The methods are shown to offer significant PAPR reduction and increase the feasibility of FBMC as
New Site Coefficients and Site Classification System Used in Recent Building Seismic Code Provisions
Dobry, R.; Borcherdt, R.D.; Crouse, C.B.; Idriss, I.M.; Joyner, W.B.; Martin, G.R.; Power, M.S.; Rinne, E.E.; Seed, R.B.
2000-01-01
Recent code provisions for buildings and other structures (1994 and 1997 NEHRP Provisions, 1997 UBC) have adopted new site amplification factors and a new procedure for site classification. Two amplitude-dependent site amplification factors are specified: Fa for short periods and Fv for longer periods. Previous codes included only a long period factor S and did not provide for a short period amplification factor. The new site classification system is based on definitions of five site classes in terms of a representative average shear wave velocity to a depth of 30 m (V?? s). This definition permits sites to be classified unambiguously. When the shear wave velocity is not available, other soil properties such as standard penetration resistance or undrained shear strength can be used. The new site classes denoted by letters A - E, replace site classes in previous codes denoted by S1 - S4. Site classes A and B correspond to hard rock and rock, Site Class C corresponds to soft rock and very stiff / very dense soil, and Site Classes D and E correspond to stiff soil and soft soil. A sixth site class, F, is defined for soils requiring site-specific evaluations. Both Fa and Fv are functions of the site class, and also of the level of seismic hazard on rock, defined by parameters such as Aa and Av (1994 NEHRP Provisions), Ss and S1 (1997 NEHRP Provisions) or Z (1997 UBC). The values of Fa and Fv decrease as the seismic hazard on rock increases due to soil nonlinearity. The greatest impact of the new factors Fa and Fv as compared with the old S factors occurs in areas of low-to-medium seismic hazard. This paper summarizes the new site provisions, explains the basis for them, and discusses ongoing studies of site amplification in recent earthquakes that may influence future code developments.
Lisi Pei; Nathan Moore; Shiyuan Zhong; Lifeng Luo; David W. Hyndman; Warren E. Heilman; Zhiqiu. Gao
2014-01-01
Extreme weather and climate events, especially short-term excessive drought and wet periods over agricultural areas, have received increased attention. The Southern Great Plains (SGP) is one of the largest agricultural regions in North America and features the underlying Ogallala-High Plains Aquifer system worth great economic value in large part due to production...
International Nuclear Information System (INIS)
Kittel, J.H.
1989-01-01
One of the most arduous tasks associated with the management of radioactive wastes is the siting of new disposal facilities. Experience has shown that the performance of the disposal facility during and after disposal operations is critically dependent on the characteristics of the site itself. The site selection process consists of defining needs and objectives, identifying geographic regions of interest, screening and selecting candidate sites, collecting data on the candidate sites, and finally selecting the preferred site. Before the site selection procedures can be implemented, however, a formal legal system must be in place that defines broad objectives and, most importantly, clearly establishes responsibilities and accompanying authorities for the decision-making steps in the procedure. Site selection authorities should make every effort to develop trust and credibility with the public, local officials, and the news media. The responsibilities of supporting agencies must also be spelled out. Finally, a stable funding arrangement must be established so that activities such as data collection can proceed without interruption. Several examples, both international and within the US, are given
Energy Technology Data Exchange (ETDEWEB)
Schmidt, J.W.; Hanf, R.W.
1995-06-01
This section of the 1994 Hanford Site Environmental Report summarizes the site environmental programs. Effluent monitoring and environmental surveillance programs monitor for impacts from operations in several areas. The first area consists of the point of possible release into the environment. The second area consists of possible contamination adjacent to DOE facilities, and the third area is the general environment both on and off the site.
International Nuclear Information System (INIS)
Schmidt, J.W.; Hanf, R.W.
1995-01-01
This section of the 1994 Hanford Site Environmental Report summarizes the site environmental programs. Effluent monitoring and environmental surveillance programs monitor for impacts from operations in several areas. The first area consists of the point of possible release into the environment. The second area consists of possible contamination adjacent to DOE facilities, and the third area is the general environment both on and off the site
LLNL Experimental Test Site (Site 300) Potable Water System Operations Plan
Energy Technology Data Exchange (ETDEWEB)
Ocampo, R. P. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States); Bellah, W. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)
2015-09-14
The existing Lawrence Livermore National Laboratory (LLNL) Site 300 drinking water system operation schematic is shown in Figures 1 and 2 below. The sources of water are from two Site 300 wells (Well #18 and Well #20) and San Francisco Public Utilities Commission (SFPUC) Hetch-Hetchy water through the Thomas shaft pumping station. Currently, Well #20 with 300 gallons per minute (gpm) pump capacity is the primary source of well water used during the months of September through July, while Well #18 with 225 gpm pump capacity is the source of well water for the month of August. The well water is chlorinated using sodium hypochlorite to provide required residual chlorine throughout Site 300. Well water chlorination is covered in the Lawrence Livermore National Laboratory Experimental Test Site (Site 300) Chlorination Plan (“the Chlorination Plan”; LLNL-TR-642903; current version dated August 2013). The third source of water is the SFPUC Hetch-Hetchy Water System through the Thomas shaft facility with a 150 gpm pump capacity. At the Thomas shaft station the pumped water is treated through SFPUC-owned and operated ultraviolet (UV) reactor disinfection units on its way to Site 300. The Thomas Shaft Hetch- Hetchy water line is connected to the Site 300 water system through the line common to Well pumps #18 and #20 at valve box #1.
Energy Technology Data Exchange (ETDEWEB)
Stamnes, K.; Leontieva, E. [Univ. of Alaska, Fairbanks (United States)
1996-04-01
The multi-filter rotating shadowband radiometer (MFRSR) and precision infrared radiometer (PIR) have been employed at the Geophysical Institute in Fairbanks to check their performance under arctic conditions. Drawing on the experience of the previous measurements in the Arctic, the PIR was equipped with a ventilator to prevent frost and moisture build-up. We adopted the Solar Infrared Observing Sytem (SIROS) concept from the Southern Great Plains Cloud and Radiation Testbed (CART) to allow implementation of the same data processing software for a set of radiation and meteorological instruments. To validate the level of performance of the whole SIROS prior to its incorporation into the North Slope of Alaska (NSA) Cloud and Radiation Testbed Site instrumental suite for flux radiatin measurements, the comparison between measurements and model predictions will be undertaken to assess the MFRSR-PIR Arctic data quality.
Near-surface alloys for hydrogen fuel cell applications
DEFF Research Database (Denmark)
Greeley, Jeffrey Philip; Mavrikakis, Manos
2006-01-01
of CO with relatively facile H-2 activation is nearly ideal for this application. We suggest that. as nanoscale materials synthesis techniques improve, it will become feasible to reproducibly prepare NSAs with highly specified surface structures, resulting in the design and manufacture of a wide variety...... facile H-2 activation. These NSAs could, potentially, facilitate highly selective hydrogenation reactions at low temperatures. In the present work, the suitability of NSAs for use as hydrogen fuel cell anodes has been evaluated: the combination of properties, possessed by selected NSAs, of weak binding...... of such materials for use in fuel cells and in an ever. increasing range of catalytic applications. Furthermore, we introduce a new concept for NSA-defect sites, which could be responsible for the promotional catalytic effects of a second metal added. even in minute quantities, to a host metal catalyst....
Inter-Site Consistency at a Multi-Site Psychiatry Clerkship
Shultes von Schlageter, Margo; Park, EunMi; Tucker, Phebe
2006-01-01
Objective: This study examines the effects of clinical site assignment within a multiple-site psychiatry clerkship program on the convergent outcome of the National Board of Medical Examiners (NBME) subject examination. Method: NBME scores, controlled for baseline pre-clerkship knowledge base as measured by second year human behavior scores, were…
International Nuclear Information System (INIS)
1989-08-01
This Site Characterization Analysis (SCA) documents the NRC staff's concerns resulting from its review of the US Department of Energy's (DOE's) Site Characterization Plan (SCP) for the Yucca Mountain site in southern Nevada, which is the candidate site selected for characterization as the nation's first geologic repository for high-level radioactive waste. DOE's SCP explains how DOE plans to obtain the information necessary to determine the suitability of the Yucca Mountain site for a repository. NRC's specific objections related to the SCP, and major comments and recommendations on the various parts of DOE's program, are presented in SCA Section 2, Director's Comments and Recommendations. Section 3 contains summaries of the NRC staff's concerns for each specific program, and Section 4 contains NRC staff point papers which set forth in greater detail particular staff concerns regarding DOE's program. Appendix A presents NRC staff evaluations of those NRC staff Consultation Draft SCP concerns that NRC considers resolved on the basis of the SCP. This SCA fulfills NRC's responsibilities with respect to DOE's SCP as specified by the Nuclear Waste Policy Act (NWPA) and 10 CFR 60.18. 192 refs., 2 tabs
Monosaccharides and Ethanol Production from Superfine Ground Sugarcane Bagasse Using Enzyme Cocktail
Directory of Open Access Journals (Sweden)
Jingbo Li
2014-03-01
Full Text Available In this work, the effect of particle size on the enzymatic hydrolysis of milled and sieved sugarcane bagasse (SCB was studied. The enzymatic hydrolysis and fermentability of superfine ground SCB (SGP400 using an enzyme cocktail strategy were also explored. Particle size reduction improved the enzymatic hydrolysis. The highest glucose yield was 44.75%, which was obtained from SGP400. The enzyme cocktail strategy greatly enhanced the glucose and xylose yield. The maximum glucose and xylose yield was from the enzyme cocktail of cellulase, xylanase, and pectinase. Synergistic action between xylanase and pectinase as well as cellulase and pectinase was quite noticeable. Hydrolysis times affected the degree of synergism. Ethanol production was carried out by employing simultaneous saccharification and fermentation (SSF and semi-SSF using enzymes and their cocktails. Semi-SSF was found to be the better one compared with SSF. Xylanase and pectinase aided the ethanol production in both fermentation modes. Ethanol yield was 7.81 and 7.30 g/L for semi-SSF and SSF, respectively by using an enzyme cocktail of cellulase, β-glucosidase, pectinase, and xylanase.
Rubio, Marcela da Silva; Penha Filho, Rafael Antonio Casarin; Almeida, Adriana Maria de; Berchieri, Angelo
2017-12-01
Currently there are 2659 Salmonella serovars. The host-specific biovars Salmonella Pullorum and Salmonella Gallinarum cause systemic infections in food-producing and wild birds. Fast diagnosis is crucial to control the dissemination in avian environments. The present work describes the development of a multiplex qPCR in real time using a low-cost DNA dye (SYBr Green) to identify and quantify these biovars. Primers were chosen based on genomic regions of difference (RoD) and optimized to control dimers. Primers pSGP detect both host-specific biovars but not other serovars and pSG and pSP differentiate biovars. Three amplicons showed different melting temperatures (Tm), allowing differentiation. The pSGP amplicon (97 bp) showed Tm of 78°C for both biovars. The pSG amplicon (273 bp) showed a Tm of 86.2°C for S. Gallinarum and pSP amplicon (260 bp) dissociated at 84.8°C for S. Pullorum identification. The multiplex qPCR in real time showed high sensitivity and was capable of quantifying 10 8 -10 1 CFU of these biovars.
Superfund Site Information - Site Sampling Data
U.S. Environmental Protection Agency — This asset includes Superfund site-specific sampling information including location of samples, types of samples, and analytical chemistry characteristics of...
DEFF Research Database (Denmark)
Davies, Richard; Harty, Chris
2013-01-01
Numerous Building Information Modelling (BIM) tools are well established and potentially beneficial in certain uses. However, issues of adoption and implementation persist, particularly for on-site use of BIM tools in the construction phase. We describe an empirical case-study of the implementation...... of an innovative ‘Site BIM’ system on a major hospital construction project. The main contractor on the project developed BIM-enabled tools to allow site workers using mobile tablet personal computers to access design information and to capture work quality and progress data on-site. Accounts show that ‘Site BIM...
Olkiluoto site description 2011
International Nuclear Information System (INIS)
2012-12-01
This fourth version of the Olkiluoto Site Report, produced by the OMTF (Olkiluoto Modelling Task Force), updates the Olkiluoto Site Report 2008 with the data and knowledge obtained up to December 2010. A descriptive model of the site (the Site Descriptive Model, SDM), i.e. a model describing the geological and hydrogeological structure of the site, properties of the bedrock and the groundwater and its flow, and the associated interacting processes and mechanisms. The SDM is divided into six parts: surface system, geology, rock mechanics, hydrogeology, hydrogeochemistry and transport properties
Olkiluoto site description 2011
Energy Technology Data Exchange (ETDEWEB)
NONE
2012-12-15
This fourth version of the Olkiluoto Site Report, produced by the OMTF (Olkiluoto Modelling Task Force), updates the Olkiluoto Site Report 2008 with the data and knowledge obtained up to December 2010. A descriptive model of the site (the Site Descriptive Model, SDM), i.e. a model describing the geological and hydrogeological structure of the site, properties of the bedrock and the groundwater and its flow, and the associated interacting processes and mechanisms. The SDM is divided into six parts: surface system, geology, rock mechanics, hydrogeology, hydrogeochemistry and transport properties.
EPIC Calibration/Validation Experiment Field Campaign Report
Energy Technology Data Exchange (ETDEWEB)
Koch, Steven E [National Severe Storm Laboratory/NOAA; Chilson, Phillip [University of Oklahoma; Argrow, Brian [University of Colorado
2017-03-15
A field exercise involving several different kinds of Unmanned Aerial Systems (UAS) and supporting instrumentation systems provided by DOE/ARM and NOAA/NSSL was conducted at the ARM SGP site in Lamont, Oklahoma on 29-30 October 2016. This campaign was part of a larger National Oceanic and Atmospheric Administration (NOAA) UAS Program Office program awarded to the National Severe Storms Laboratory (NSSL). named Environmental Profiling and Initiation of Convection (EPIC). The EPIC Field Campaign (Test and Calibration/Validation) proposed to ARM was a test or “dry-run” for a follow-up campaign to be requested for spring/summer 2017. The EPIC project addresses NOAA’s objective to “evaluate options for UAS profiling of the lower atmosphere with applications for severe weather.” The project goal is to demonstrate that fixed-wing and rotary-wing small UAS have the combined potential to provide a unique observing system capable of providing detailed profiles of temperature, moisture, and winds within the atmospheric boundary layer (ABL) to help determine the potential for severe weather development. Specific project objectives are: 1) to develop small UAS capable of acquiring needed wind and thermodynamic profiles and transects of the ABL using one fixed-wing UAS operating in tandem with two different fixed rotary-wing UAS pairs; 2) adapt and test miniaturized, high-precision, and fast-response atmospheric sensors with high accuracy in strong winds characteristic of the pre-convective ABL in Oklahoma; 3) conduct targeted short-duration experiments at the ARM Southern Great Plains site in northern Oklahoma concurrently with a second site to be chosen in “real-time” from the Oklahoma Mesonet in coordination with the (National Weather Service (NWS)-Norman Forecast Office; and 4) gain valuable experience in pursuit of NOAA’s goals for determining the value of airborne, mobile observing systems for monitoring rapidly evolving high-impact severe weather
Site Selection for Surplus Plutonium Disposition Facilities at the Savannah River Site
International Nuclear Information System (INIS)
Wike, L.D.
2000-01-01
A site selection study was conducted to evaluate locations for the proposed Surplus Plutonium Disposition Facilities. Facilities to be located include the Mixed Oxide (MOX) Fuel Fabrication Facility, the Pit Disassembly and Conversion Facility (PDCF), and the Plutonium Immobilization Project (PIP) facility. Objectives of the study include: (1) Confirm that the Department of Energy (DOE) selected locations for the MOX and PDCF were suitable based on selected siting criteria, (2) Recommend a site in the vicinity of F Area that is suitable for the PIP, and (3) Identify alternative suitable sites for one or more of these facilities in the event that further geotechnical characterization or other considerations result in disqualification of a currently proposed site
Methods for estimating on-site ambient air concentrations at disposal sites
International Nuclear Information System (INIS)
Hwang, S.T.
1987-01-01
Currently, Gaussian type dispersion modeling and point source approximation are combined to estimate the ambient air concentrations of pollutants dispersed downwind of an areawide emission source, using the approach of virtual point source approximation. This Gaussian dispersion modeling becomes less accurate as the receptor comes closer to the source, and becomes inapplicable for the estimation of on-site ambient air concentrations at disposal sites. Partial differential equations are solved with appropriate boundary conditions for use in estimating the on-site concentrations in the ambient air impacted by emissions from an area source such as land disposal sites. Two variations of solution techniques are presented, and their predictions are compared
Site Rehabilitation Completion Report with No Further Action Proposal for the Northeast Site
Energy Technology Data Exchange (ETDEWEB)
Daniel, Joe [Stoller Newport News Technology, Inc., Grand Junction, CO (United States); Tabor, Charles [Stoller Newport News Technology, Inc., Grand Junction, CO (United States); Survochak, Scott [U.S. Department of Energy, Office of Legacy Management, Grand Junction, CO (United States)
2013-05-01
The purpose of this Site Rehabilitation Completion Report is to present the post-active-remediation monitoring results for the Northeast Site and to propose No Further Action with Controls. This document includes information required by Chapter 62-780.750(4)(d), 62-780.750(6), and 62-780.600(8)(a)27 Florida Administrative Code (F.A.C.). The Closure Monitoring Plan for the Northeast Site and 4.5 Acre Site (DOE 2009a) describes the approach for post-active-remediation monitoring. The Young - Rainey Science, Technology, and Research Center (STAR Center) is a former U.S. Department of Energy (DOE) facility constructed in the mid-1950s. The 99-acre STAR Center is located in Largo, Florida. The Northeast Site is located in the northeast corner of the STAR Center. The Northeast Site meets all the requirements for an RMO II closure—No Further Action with Controls. DOE is nearing completion of a restrictive covenant for the Northeast Site. DOE has completed post-active-remediation monitoring at the Northeast Site as of September 2012. No additional monitoring will be conducted.
International Nuclear Information System (INIS)
Burton, J.C.; Walker, J.L.; Jennings, T.V.; Aggarwal, P.K.; Hastings, B.; Meyer, W.T.; Rose, C.M.; Rosignolo, C.L.
1993-01-01
Argonne National Laboratory has developed a unique, cost- and time-effective, technically innovative process for preremedial site characterization, referred to as Expedited Site Characterization (ESC). The cost of the ESC field sampling process ranges from 1/10 to 1/5 of the cost of traditional site characterization. The time required for this ESC field activity is approximately 1/30 of that for current methods. Argonne's preremedial site investigations based on this approach have been accepted by the appropriate regulatory agencies. The ESC process is flexible and neither site nor contaminant dependent. The process has been successfully tested and applied in site investigations of multiple contaminated landfills in New Mexico (for the US Department of the Interior's Bureau of Land Management [BLM]) and at former grain storage facilities in Nebraska and Kansas, contaminated with carbon tetrachloride (for the Department of Agriculture's Commodity Credit Corporation [CCC/USDA]). A working demonstration of this process was sponsored by the US Department of Energy (DOE) Office of Technology Development as a model of the methodology needed to accelerate site characterizations at DOE facilities. This report describes the application of the process in New Mexico, Nebraska and Kansas
Site observational work plan for the UMTRA project site at Grand Junction, Colorado
International Nuclear Information System (INIS)
1996-01-01
This site observational work plan (SOWP) is one of the first Uranium Mill Tailings Remedial Action (UMTRA) Ground Water Project documents developed to select a compliance strategy that meets the UMTRA ground water standards for the Grand Junction site. This SOWP applies information about the Grand Junction site to the compliance strategy selection framework developed in the UMTRA Ground Water Project draft programmatic environmental impact statement. This risk-based, decision-making framework identifies the decision logic for selecting compliance strategies that could be used to meet the ground water standards. The US Department of Energy (DOE) goal is to implement a cost-effective site strategy that complies with the ground water standards and protects human health and the environment. Based on an evaluation of the site characterization and risk assessment data available for the preparation of this SOWP, DOE proposes that the most likely compliance strategy for the Grand Junction site is no remediation with the application of supplemental standards. This proposed strategy is based on a conceptual site model that indicates site-related contamination is confined to a limited-use aquifer as defined in the ground water standards. The conceptual model demonstrates that the uranium processing-related contamination at the site has affected the unconfined alluvial aquifer, but not the deeper confined aquifer