GTS Duratek, Phase I Hanford low-level waste melter tests: 100-kg melter offgas report
International Nuclear Information System (INIS)
Eaton, W.C.
1995-11-01
A multiphase program was initiated in 1994 to test commercially available melter technologies for the vitrification of the low-level waste (LLW) stream from defense wastes stored in underground tanks at the Hanford Site in southeastern Washington State. Phase 1 of the melter demonstration tests using simulated LLW was completed during fiscal year 1995. This document is the 100-kg melter offgas report on testing performed by GTS Duratek, Inc., in Columbia, Maryland. GTS Duratek (one of the seven vendors selected) was chosen to demonstrate Joule heated melter technology under WHC subcontract number MMI-SVV-384215. The document contains the complete offgas report on the 100-kg melter as prepared by Parsons Engineering Science, Inc. A summary of this report is also contained in the GTS Duratek, Phase I Hanford Low-Level Waste Melter Tests: Final Report (WHC-SD-WM-VI-027)
GTS Duratek, phase I Hanford low-level waste melter tests: Final report
International Nuclear Information System (INIS)
Eaton, W.C.
1995-01-01
A multiphase program was initiated in 1994 to test commercially available melter technologies for the vitrification of the low-level waste (LLW) stream from defense waste stored in underground tanks at the Hanford Site in southeastern Washington State. Phase 1 of the melter demonstration tests using simulated LLW was completed during fiscal year 1995. This document is the final report on testing performed by GTS Duratek Inc. in Columbia, Maryland. GTS Duratek (one of the seven vendors selected) was chosen to demonstrate Joule heated melter technology under WHC subcontract number MMI-SVV-384215. The report contains description of the tests, observations, test data and some analysis of the data as it pertains to application of this technology for LLW vitrification. The document also contains summaries of the melter offgas reports issued as separate documents for the 100 kg melter (WHC-SD-WM-VI-028) and for the 1000 kg melter (WHC-SD-WM-VI-029)
Test Plan: Phase 1, Hanford LLW melter tests, GTS Duratek, Inc
International Nuclear Information System (INIS)
Eaton, W.C.
1995-01-01
This document provides a test plan for the conduct of vitrification testing by a vendor in support of the Hanford Tank Waste Remediation System (TWRS) Low-Level Waste (LLW) Vitrification Program. The vendor providing this test plan and conducting the work detailed within it [one of seven selected for glass melter testing under Purchase Order MMI-SVV-384215] is GTS Duratek, Inc., Columbia, Maryland. The GTS Duratek project manager for this work is J. Ruller. This test plan is for Phase I activities described in the above Purchase Order. Test conduct includes melting of glass with Hanford LLW Double-Shell Slurry Feed waste simulant in a DuraMelter trademark vitrification system
Wang, Rui; Zhang, Fang; Wang, Liu; Qian, Wenjuan; Qian, Cheng; Wu, Jian; Ying, Yibin
2017-04-18
On-site monitoring the plantation of genetically modified (GM) crops is of critical importance in agriculture industry throughout the world. In this paper, a simple, visual and instrument-free method for instant on-site detection of GTS 40-3-2 soybean has been developed. It is based on body-heat recombinase polymerase amplification (RPA) and followed with naked-eye detection via fluorescent DNA dye. Combining with extremely simplified sample preparation, the whole detection process can be accomplished within 10 min and the fluorescent results can be photographed by an accompanied smart phone. Results demonstrated a 100% detection rate for screening of practical GTS 40-3-2 soybean samples by 20 volunteers under different ambient temperatures. This method is not only suitable for on-site detection of GM crops but also demonstrates great potential to be applied in other fields.
Xu, Zhaojun; Tsurugi, Kunio
2007-03-01
Energy-metabolism oscillation (EMO) in an aerobic chemostat culture of yeast is basically regulated by a feedback loop of redox reactions in energy metabolism and modulated by metabolism of storage carbohydrates. In this study, we investigated the role of Gts1p in the stabilization of EMO, using the GTS1-deleted transformant gts1Delta. We found that fluctuations in the redox state of the NAD co-factor and levels of redox-regulated metabolites in glycolysis, especially of ethanol, are markedly reduced in amplitude during EMO of gts1Delta, while respiration indicated by the oxygen uptake rate (OUR) and energy charge is not so affected throughout EMO in gts1Delta. Further, the transitions of the levels of OUR, NAD(+) : NADH ratio and intracellular pH between the two phases were apparently retarded compared with those in the wild-type, suggesting attenuation of EMO in gts1Delta. Furthermore, the mRNA levels of genes encoding enzymes for the synthesis of trehalose and glycogen are fairly reduced in gts1Delta, consistent with the decreased synthesis of storage carbohydrates. In addition, the level of inorganic phosphate, which is required for the reduction of NAD(+) and mainly supplied from trehalose synthesis, was decreased in the early respiro-fermentative phase in gts1Delta. Thus, we suggested that the deletion of GTS1 as a transcriptional co-activator for these genes inhibited the metabolism of storage carbohydrates, which causes attenuation of the feedback loop of dehydrogenase reactions in glycolysis with the restricted fluctuation of ethanol as a main synchronizing agent for EMO in a cell population.
Prefrontal cortex volume reductions and tic inhibition are unrelated in uncomplicated GTS adults.
Ganos, Christos; Kühn, Simone; Kahl, Ursula; Schunke, Odette; Brandt, Valerie; Bäumer, Tobias; Thomalla, Götz; Haggard, Patrick; Münchau, Alexander
2014-01-01
Tics in Gilles de la Tourette syndrome (GTS) are repetitive patterned movements, resembling spontaneous motor behaviour, but escaping voluntary control. Previous studies hypothesised relations between structural alterations in prefrontal cortex of GTS adults and tic severity using voxel-based morphometry (VBM), but could not demonstrate a significant association. The relation between prefrontal cortex structure and tic inhibition has not been investigated. Here, we used VBM to examine 14 GTS adults without associated comorbidities, and 15 healthy controls. We related structural alterations in GTS to clinical measures of tic severity and tic control. Grey matter volumes in the right inferior frontal gyrus and the left frontal pole were reduced in patients relative to healthy controls. These changes were not related to tic severity and tic inhibition. Prefrontal grey matter volume reductions in GTS adults are not related to state measures of tic phenomenology. © 2013.
NCEP-GTS Marine Observations in BUFR format
National Oceanic and Atmospheric Administration, Department of Commerce — The Global Telecommunications System (GTS) is a major component of transmitting global meteorological data, consisting of both in situ and satellite observations....
NCEP-GTS Marine Observations in IMMA format
National Oceanic and Atmospheric Administration, Department of Commerce — The Global Telecommunications System (GTS) is a major component of transmitting global meteorological data, consisting of both in situ and satellite observations....
Real-Time PCR-Based Quantitation Method for the Genetically Modified Soybean Line GTS 40-3-2.
Kitta, Kazumi; Takabatake, Reona; Mano, Junichi
2016-01-01
This chapter describes a real-time PCR-based method for quantitation of the relative amount of genetically modified (GM) soybean line GTS 40-3-2 [Roundup Ready(®) soybean (RRS)] contained in a batch. The method targets a taxon-specific soybean gene (lectin gene, Le1) and the specific DNA construct junction region between the Petunia hybrida chloroplast transit peptide sequence and the Agrobacterium 5-enolpyruvylshikimate-3-phosphate synthase gene (epsps) sequence present in GTS 40-3-2. The method employs plasmid pMulSL2 as a reference material in order to quantify the relative amount of GTS 40-3-2 in soybean samples using a conversion factor (Cf) equal to the ratio of the RRS-specific DNA to the taxon-specific DNA in representative genuine GTS 40-3-2 seeds.
International Nuclear Information System (INIS)
Kim, Sung Won; Ding Yushin; Alexoff, David; Patel, Vinal; Logan, Jean; Lin, K.-S.; Shea, Colleen; Muench, Lisa; Xu Youwen; Carter, Pauline; King, Payton; Constanzo, Jasmine R.; Ciaccio, James A.; Fowler, Joanna S.
2007-01-01
Introduction: (3E)-3-[(2,4-dimethoxyphenyl)methylene]-3,4,5,6-tetrahydro-2,3'-bipyridine (GTS-21), a partial α7 nicotinic acetylcholine receptor agonist drug, has recently been shown to improve cognition in schizophrenia and Alzheimer's disease. One of its two major demethylated metabolites, 4-OH-GTS-21, has been suggested to contribute to its therapeutic effects. Methods: We labeled GTS-21 in two different positions with carbon-11 ([2-methoxy- 11 C]GTS-21 and [4- 11 C]GTS-21) along with two corresponding demethylated metabolites ([2-methoxy- 11 C]4-OH-GTS-21 and [4-methoxy- 11 C]2-OH-GTS-21) for pharmacokinetic studies in baboons and mice with positron emission tomography (PET). Results: Both [2- 11 C]GTS-21 and [4-methoxy- 11 C]GTS-21 showed similar initial high rapid uptake in baboon brain, peaking from 1 to 3.5 min (0.027-0.038%ID/cc) followed by rapid clearance (t 1/2 11 C]GTS-21 continued to clear while [4-methoxy- 11 C]GTS-21 plateaued, suggesting the entry of a labeled metabolite into the brain. Comparison of the pharmacokinetics of the two labeled metabolites confirmed expected higher brain uptake and retention of [4-methoxy- 11 C]2-OH-GTS-21 (the labeled metabolite of [4-methoxy- 11 C]GTS-21) relative to [2-methoxy- 11 C]4-OH-GTS-21 (the labeled metabolite of [2-methoxy- 11 C]GTS-21), which had negligible brain uptake. Ex vivo studies in mice showed that GTS-21 is the major chemical form in the mouse brain. Whole-body dynamic PET imaging in baboon and mouse showed that the major route of excretion of C-11 is through the gallbladder. Conclusions: The major findings are as follows: (a) extremely rapid uptake and clearance of [2-methoxy- 11 C]GTS-21 from the brain, which may need to be considered in developing optimal dosing of GTS-21 for patients, and (b) significant brain uptake of 2-OH-GTS-21, suggesting that it might contribute to the therapeutic effects of GTS-21. This study illustrates the value of comparing different label positions and labeled
Energy Technology Data Exchange (ETDEWEB)
Kim, Sung Won [Medical Department, Brookhaven National Laboratory, Upton, NY 11973 (United States) and Department of Chemistry, State University of New York at Stony Brook, Stony Brook, NY 11794-3400 (United States)]. E-mail: swkim@bnl.gov; Ding Yushin [Department of Chemistry, State University of New York at Stony Brook, Stony Brook, NY 11794-3400 (United States); Department of Radiology, Yale University School of Medicine, New Haven, CT 06520-8048 (United States); Alexoff, David [Medical Department, Brookhaven National Laboratory, Upton, NY 11973 (United States); Patel, Vinal [Medical Department, Brookhaven National Laboratory, Upton, NY 11973 (United States); Logan, Jean [Medical Department, Brookhaven National Laboratory, Upton, NY 11973 (United States); Lin, K.-S. [Department of Radiology, University of Pittsburgh, Pittsburgh, PA 15213 (United States); Shea, Colleen [Medical Department, Brookhaven National Laboratory, Upton, NY 11973 (United States); Muench, Lisa [Medical Department, Brookhaven National Laboratory, Upton, NY 11973 (United States); Xu Youwen [Medical Department, Brookhaven National Laboratory, Upton, NY 11973 (United States); Carter, Pauline [Medical Department, Brookhaven National Laboratory, Upton, NY 11973 (United States); King, Payton [Medical Department, Brookhaven National Laboratory, Upton, NY 11973 (United States); Constanzo, Jasmine R. [Department of Chemistry, Fordham University, Bronx, NY 10458 (United States); Ciaccio, James A. [Department of Chemistry, Fordham University, Bronx, NY 10458 (United States); Fowler, Joanna S. [Medical Department, Brookhaven National Laboratory, Upton, NY 11973 (United States); Department of Chemistry, State University of New York at Stony Brook, Stony Brook, NY 11794-3400 (United States); Department of Psychiatry, Mount Sinai School of Medicine, New York, NY 10029 (United States)
2007-07-15
Introduction: (3E)-3-[(2,4-dimethoxyphenyl)methylene]-3,4,5,6-tetrahydro-2,3'-bipyridine (GTS-21), a partial {alpha}7 nicotinic acetylcholine receptor agonist drug, has recently been shown to improve cognition in schizophrenia and Alzheimer's disease. One of its two major demethylated metabolites, 4-OH-GTS-21, has been suggested to contribute to its therapeutic effects. Methods: We labeled GTS-21 in two different positions with carbon-11 ([2-methoxy-{sup 11}C]GTS-21 and [4-{sup 11}C]GTS-21) along with two corresponding demethylated metabolites ([2-methoxy-{sup 11}C]4-OH-GTS-21 and [4-methoxy-{sup 11}C]2-OH-GTS-21) for pharmacokinetic studies in baboons and mice with positron emission tomography (PET). Results: Both [2-{sup 11}C]GTS-21 and [4-methoxy-{sup 11}C]GTS-21 showed similar initial high rapid uptake in baboon brain, peaking from 1 to 3.5 min (0.027-0.038%ID/cc) followed by rapid clearance (t {sub 1/2}<15 min), resulting in low brain retention by 30 min. However, after 30 min, [2-methoxy-{sup 11}C]GTS-21 continued to clear while [4-methoxy-{sup 11}C]GTS-21 plateaued, suggesting the entry of a labeled metabolite into the brain. Comparison of the pharmacokinetics of the two labeled metabolites confirmed expected higher brain uptake and retention of [4-methoxy-{sup 11}C]2-OH-GTS-21 (the labeled metabolite of [4-methoxy-{sup 11}C]GTS-21) relative to [2-methoxy-{sup 11}C]4-OH-GTS-21 (the labeled metabolite of [2-methoxy-{sup 11}C]GTS-21), which had negligible brain uptake. Ex vivo studies in mice showed that GTS-21 is the major chemical form in the mouse brain. Whole-body dynamic PET imaging in baboon and mouse showed that the major route of excretion of C-11 is through the gallbladder. Conclusions: The major findings are as follows: (a) extremely rapid uptake and clearance of [2-methoxy-{sup 11}C]GTS-21 from the brain, which may need to be considered in developing optimal dosing of GTS-21 for patients, and (b) significant brain uptake of 2-OH-GTS-21
GTS-LCS, in-situ experiment 2. Modeling of tracer test 09-03
International Nuclear Information System (INIS)
Manette, M.; Saaltink, M.W.; Soler, J.M.
2015-02-01
Within the framework of the GTS-LCS project (Grimsel Test Site - Long-Term Cement Studies), an in-situ experiment lasting about 5 years was started in 2009 to study water-cement-rock interactions in a fractured granite. Prior to the experiment, a tracer test was performed to characterize the initial flow and transport properties of the rock around the experimental boreholes. This study reports on the model interpretation of tracer test 09-03. The calculations were performed by means of a two-dimensional model (homogeneous fracture plane including 3 boreholes) using the Retraso-CodeBright software package. In the tracer test, Grimsel groundwater containing the tracer (uranine) was circulated in the emplacement borehole during 43 days (zero injection flow rate). Circulation continued without tracer afterwards. Water was extracted at the observation and extraction boreholes. Results from a model sensitivity analysis comparing model results with measured tracer concentrations showed 3 cases where the evolution of tracer concentrations in the 3 different boreholes was satisfactory. In these cases a low-permeability skin affected the emplacement and observation boreholes. No skin appeared to affect the extraction borehole. The background hydraulic gradient seems to have no effect on the results of the tracer test. These results will be applied in the calculation of the initial flow field for the reactive transport phase of in-situ experiment 2 (interaction between pre-hardened cement and fractured granite at Grimsel). (orig.)
The GNSS-based Ground Tracking System (GTS) of GFZ; from GITEWS to PROTECTS and beyond
Falck, Carsten; Merx, Alexander; Ramatschi, Markus
2013-04-01
Introduction An automatic system for the near real-time determination and visualization of ground motions, respectively co-seismic deformations of the Earth's surface, was developed by GFZ (German Research Centre for Geosciences) within the project GITEWS (German Indonesian Tsunami Early Warning System). The system is capable to deliver 3D-displacement vectors for locations with appropriate GPS-equipment in the vicinity of an earthquake's epicenter with a delay of only a few minutes. These vectors can help to assess the earthquake causing tectonic movements, which must be known to make reliable early warning predictions, e.g., concerning the generation of tsunami waves. The GTS (Ground Tracking System) has been integrated into InaTEWS (Indonesian Tsunami Early Warning System) and is in operation at the national warning center in Jakarta since November 2008. After the end of the project GITEWS GFZ continues to support the GTS in Indonesia within the frame of PROTECTS (Project for Training, Education and Consulting for Tsunami Early Warning Systems) and recently some new developments have been introduced. We now aim to make further use of the achievements made, e.g., by developing a license model for the GTS software package. Motivation After the Tsunami of 26th December 2004 the German government initiated the GITEWS project to develop the main components for a tsunami early warning system in Indonesia. The GFZ, as the consortial leader of GITEWS, had several work packages, most of them related to sensor systems. The geodetic branch (Department 1) of GFZ was assigned to develop a GNSS-based component, which since then is known as the GTS (Ground Tracking System). System benefit The ground motion information delivered by the GTS is a valuable source for a fast understanding of an earthquake's mechanism with a high relevance to assess the probability and magnitude of a potentially following tsunami. The system may detect highest displacement vector values, where
Toivanen, V; Bellodi, G; Dimov, V; Küchler, D; Lombardi, A M; Maintrot, M
2016-02-01
Linac3 is the first accelerator in the heavy ion injector chain of the Large Hadron Collider (LHC), providing multiply charged heavy ion beams for the CERN experimental program. The ion beams are produced with GTS-LHC, a 14.5 GHz electron cyclotron resonance ion source, operated in afterglow mode. Improvement of the GTS-LHC beam formation and beam transport along Linac3 is part of the upgrade program of the injector chain in preparation for the future high luminosity LHC. A mismatch between the ion beam properties in the ion source extraction region and the acceptance of the following Low Energy Beam Transport (LEBT) section has been identified as one of the factors limiting the Linac3 performance. The installation of a new focusing element, an einzel lens, into the GTS-LHC extraction region is foreseen as a part of the Linac3 upgrade, as well as a redesign of the first section of the LEBT. Details of the upgrade and results of a beam dynamics study of the extraction region and LEBT modifications will be presented.
International Nuclear Information System (INIS)
1999-01-01
Mercury-contaminated wastes in many forms are present at various U. S. Department of Energy (DOE) sites. At least 26 different DOE sites have this type of mixed low-level waste in their storage facilities, totaling approximately 6,000 m 3 . Mercury contamination in the wastes at DOE sites presents a challenge because it exists in various forms, such as soil, sludges, and debris, as well as in different chemical species of mercury. Stabilization is of interest for radioactively contaminated mercury waste (<260 ppm Hg) because of its success with particular wastes, such as soils, and its promise of applicability to a broad range of wastes. However, stabilization methods must be proven to be adequate to meet treatment standards. They must also be proven feasible in terms of economics, operability, and safety. This report summarizes the findings from a stabilization technology demonstration conducted by GTS Duratek, Inc. Phase I of the study involved receipt and repackaging of the material, followed by preparations for waste tracking. Phase II examined the bench-scale performance of grouting at two different loadings of waste to grouted mass. Phase III demonstrated in-drum mixing and solidification using repackaged drums of sludge. Phase IV initially intended to ship final residues to Envirocare for disposal. The key results of the demonstration are as follows: (1) Solidification tests were performed at low and high waste loading, resulting in stabilization of mercury to meet the Universal Treatment Standard of 0.025 mg/L at the low loading and for two of the three runs at the high loading. The third high-loading run had a Toxicity Characteristic Leaching Procedure (TCLP) of 0.0314 mg/L. (2) Full-drum stabilization using the low loading formula was demonstrated. (3) Organic compound levels were discovered to be higher than originally reported, including the presence of some pesticides. Levels of some radionuclides were much higher than initially reported. (4
International Nuclear Information System (INIS)
Biggin, C.; Alexander, R.; Kickmaier, W.; McKinley, I.G.
2003-01-01
Many designs for the disposal of higher activity radioactive wastes include bentonite clay as part of the engineered barrier system (EBS). Generally, the EBS is characterised by the use of large quantities of rather simple, well-understood materials, leading to increased confidence in the predicted long-term behaviour of the EBS (see, for example, Alexander and McKinley, 1999). Despite this, several open questions remain and some of these are being examined at Nagra's Grimsel Test Site (GTS) in the central Swiss Alps as part of an integrated, international study programme (GTS Phase V: see www.grimsel.com for details). Three specific projects within GTS Phase V are currently investigating the performance assessment (PA) implications of the behaviour of bentonite in the EBS. In the first, demonstration of the overall practicability of the Spanish reference disposal concept (where canisters are placed horizontally in bentonite backfilled tunnels) for high level waste (HLW) is amongst the goals of ENRESA's Full-scale Engineered Barrier EXperiment (FEBEX). In the second, RWMC are examining the potential effects of gas migration through a bentonite-sand mixture surrounding a concrete silo in the Japanese concept for intermediate level waste (ILW) in a large-scale EBS experiment (GMT, Gas Migration Test). Finally, Nagra, in the CRR (Colloid and Radionuclide Retardation) project, is investigating the effects of bentonite colloids on migration of radionuclides at the EBS / geosphere boundary, where bentonite colloids could be produced by erosion of the bentonite backfill. Although all three projects have produced significant advances in the understanding of the behaviour of the clay EBS under in situ conditions, they are based on first generation conceptual designs and so, in the planned Phase VI of the GTS, it is proposed to move on and consider more optimised EBS designs and emplacement techniques. To facilitate integration, the focus of Phase VI will be narrowed to
National Oceanic and Atmospheric Administration, Department of Commerce — The data contained here are surface marine observations from many different sources via the NCDC Global Telecommunication System (GTS) Marine in International...
Shrestha, Bharat; Hossain, Ekram; Camorlinga, Sergio
2011-09-01
In wireless personal area networks, such as wireless body-area sensor networks, stations or devices have different bandwidth requirements and, thus, create heterogeneous traffics. For such networks, the IEEE 802.15.4 medium access control (MAC) can be used in the beacon-enabled mode, which supports guaranteed time slot (GTS) allocation for time-critical data transmissions. This paper presents a general discrete-time Markov chain model for the IEEE 802.15.4-based networks taking into account the slotted carrier sense multiple access with collision avoidance and GTS transmission phenomena together in the heterogeneous traffic scenario and under nonsaturated condition. For this purpose, the standard GTS allocation scheme is modified. For each non-identical device, the Markov model is solved and the average service time and the service utilization factor are analyzed in the non-saturated mode. The analysis is validated by simulations using network simulator version 2.33. Also, the model is enhanced with a wireless propagation model and the performance of the MAC is evaluated in a wheelchair body-area sensor network scenario.
Operation of the GTS-LHC source for the hadron injector at CERN
International Nuclear Information System (INIS)
Dumas, L.; Hill, C.; Hitz, D.; Kuchler, D.; Mastrostefano, C.; O'Neil, M.; Scrivens, R.
2007-01-01
The GTS-LHC ion source, designed and build by CEA Grenoble, was installed and commissioned at CERN in 2005. Since than the source has delivered oxygen and lead ion beams (O4+ and Pb27+ from the source, Pb54+ from the linac) for the commissioning of the Low Energy Ion Ring (LEIR). Results of this operation and attempts to improve the source performance and reliability, and the linac performance will be presented in this paper. (authors)
Operation of the GTS-LHC source for the hadron injector at CERN
Energy Technology Data Exchange (ETDEWEB)
Dumas, L.; Hill, C.; Hitz, D.; Kuchler, D.; Mastrostefano, C.; O' Neil, M.; Scrivens, R. [CERN, AB ABP HSL, CH-1211 Geneva 23, (Switzerland); CEA, DRFMC SBT, F-38054 Grenoble, (France)
2007-07-01
The GTS-LHC ion source, designed and build by CEA Grenoble, was installed and commissioned at CERN in 2005. Since than the source has delivered oxygen and lead ion beams (O4+ and Pb27+ from the source, Pb54+ from the linac) for the commissioning of the Low Energy Ion Ring (LEIR). Results of this operation and attempts to improve the source performance and reliability, and the linac performance will be presented in this paper. (authors)
Operation of the GTS-LHC Source for the Hadron Injector at CERN
Dumas, L; Hitz, D; Küchler, D; Mastrostefano, C; O'Neill, M; Scrivens, R
2007-01-01
The GTS-LHC ion source, designed and build by CEA Grenoble, was installed and commissioned at CERN in 2005. Since than the source has delivered oxygen and lead ion beams (O4+ and Pb27+ from the source, Pb54+ from the linac) for the commissioning of the Low Energy Ion Ring (LEIR). Results of this operation and attempts to improve the source performance and reliability, and the linac performance will be presented in this paper.
Toivanen, V; Küchler, D
2016-02-01
The 14.5 GHz GTS-LHC Electron Cyclotron Resonance Ion Source (ECRIS) provides multiply charged heavy ion beams for the CERN experimental program. The GTS-LHC beam formation has been studied extensively with lead, argon, and xenon beams with varied beam extraction conditions using the ion optical code IBSimu. The simulation model predicts self-consistently the formation of triangular and hollow beam structures which are often associated with ECRIS ion beams, as well as beam loss patterns which match the observed beam induced markings in the extraction region. These studies provide a better understanding of the properties of the extracted beams and a way to diagnose the extraction system performance and limitations, which is otherwise challenging due to the lack of direct diagnostics in this region and the limited availability of the ion source for development work.
Simulation of the CERN GTS-LHC ECR ion source extraction system with lead and argon ion beams
Toivanen, V; Küchler, D; Lombardi, A; Scrivens, R; Stafford-Haworth, J
2014-01-01
A comprehensive study of beam formation and beam transport has been initiated in order to improve the performance of the CERN heavy ion injector, Linac3. As part of this study, the ion beam extraction system of the CERN GTS-LHC 14.5 GHz Electron Cyclotron Resonance Ion Source (ECRIS) has been modelled with the ion optical code IBSimu. The simulations predict self-consistently the triangular and hollow beam structures which are often observed experimentally with ECRIS ion beams. The model is used to investigate the performance of the current extraction system and provides a basis for possible future improvements. In addition, the extraction simulation provides a more realistic representation of the initial beam properties for the beam transport simulations, which aim to identify the performance bottle necks along the Linac3 low energy beam transport. The results of beam extraction simulations with Pb and Ar ion beams from the GTS-LHC will be presented and compared with experimental observations.
Mišić, Jelena; (Sherman) Shen, Xuemin
2009-01-01
We consider interconnection of IEEE 802.15.4 beacon-enabled network cluster with IEEE 802.11b network. This scenario is important in healthcare applications where IEEE 802.15.4 nodes comprise patient's body area network (BAN) and are involved in sensing some health-related data. BAN nodes have very short communication range in order to avoid harming patient's health and save energy. Sensed data needs to be transmitted to an access point in the ward room using wireless technology with higher transmission range and rate such as IEEE 802.11b. We model the interconnected network where IEEE 802.15.4-based BAN operates in guaranteed time slot (GTS) mode, and IEEE 802.11b part of the bridge conveys GTS superframe to the 802.11b access point. We then analyze the network delays. Performance analysis is performed using EKG traffic from continuous telemetry, and we discuss the delays of communication due the increasing number of patients. PMID:19107184
Misić, Jelena; Sherman Shen, Xuemin
2009-01-01
We consider interconnection of IEEE 802.15.4 beacon-enabled network cluster with IEEE 802.11b network. This scenario is important in healthcare applications where IEEE 802.15.4 nodes comprise patient's body area network (BAN) and are involved in sensing some health-related data. BAN nodes have very short communication range in order to avoid harming patient's health and save energy. Sensed data needs to be transmitted to an access point in the ward room using wireless technology with higher transmission range and rate such as IEEE 802.11b. We model the interconnected network where IEEE 802.15.4-based BAN operates in guaranteed time slot (GTS) mode, and IEEE 802.11b part of the bridge conveys GTS superframe to the 802.11b access point. We then analyze the network delays. Performance analysis is performed using EKG traffic from continuous telemetry, and we discuss the delays of communication due the increasing number of patients.
International Nuclear Information System (INIS)
Rueedi, J.; Marschall, P.; Vaissiere, R. de la; Jung, H.; Reinhold, M.; Steiner, P.; Garcia-Sineriz, J.L.
2012-01-01
experiments on the real scale are needed for benchmarking the performance of the two-phase flow models. The Gas-Permeable Seal Test (GAST) was initiated in 2010 as a GTS partner project with Andra and KRMC as project partners. The experiment was emplaced at Grimsel Test Site (GTS) in 2011/2012. The S/B seal with a length of 8 m and a diameter of 3m was emplaced to demonstrate the effective functioning of gas permeable seals at realistic scales and under realistic hydraulic boundary conditions ('proof of concept'). The latter condition required the experiment to be emplaced in an existing TBM (tunnel boring machine) drilled tunnel at GTS where the surrounding granite has shown to provide a negligible excavation damaged zone (EDZ) and the stiff rock enables water injection at pressures similar to those expected for a L/ILW repository seal, i.e. 3-5 MPa corresponding to the hydrostatic pressure at 300-500 m depth. The S/B body was compacted manually in horizontal sheets of about 10 cm thickness with a target dry density of 1.7 g/cm 3 . The remaining head space as well as all S/B interfaces (i.e. towards granite and concrete plug) were sealed with granular bentonite and/or with bentonite blocks. The experiment is planned to be saturated until 2014 followed by gas injection from the far end of the tunnel in 2015. The experiment aims at validating and, if necessary, improving current conceptual models for the re-saturation and gas invasion processes into S/B seals and the determination of up-scaled gas / water permeabilities of S/B seals (i.e. two-phase flow parameters for large-scale models). For this reason material saturation, water pressures and earth pressures are monitored continuously by more than 150 sensors distributed among 15 instrumentation cross sections, comprising of piezometers for pore pressure, relative humidity sensors, psychrometers and TDRs for water saturation, total pressure cells for stress state and piezo-crystals for seismic tomography. All instruments and
Rubrofusarin from Aspergillus niger GTS01-4 and its biological activity
Megawati, Dewi, Rizna Triana; Mulyani, Hanny; Maryani, Faiza; Lotullung, Puspa Dewi N.; Minarti
2017-01-01
During the research for bioactive secondary metabolites from microorganisms, the terestrial fungi Aspergillus niger GTS01-4 has been investigated for the evaluation of antimicrobial and cytotoxic activities using brine shrimp (Artemia salina) lethality test and MCF-7 cell line. Further chromatographic separation and purification of myselium extract resulted in the isolation identified as rubrofusarin (1). The structure elucidation of isolated compound was performed using 1D-NMR, and LCMS. Furthermore, the cytotoxicity of rubrofusarin (1) was evaluated and resulted with IC50 of 11.51 µg/mL against MCF-7 and LC50 of 368.11 µg/mL against brine shrimp, respectively. However, rubrofusarin (1) showed moderate activity against E. coli, S. aureus, and B. subtilis compared to standard antibiotic, streptomycin. The average zone of inhibition was ranged from 6 to 8 mm at a concentration of 100 µg/disc. These results suggest that rubrofusarin could be a potential candidate in the field of anticancer drug discovery from terrestrial fungi.
TWRS Privatization Phase 1 Master Site Plan
International Nuclear Information System (INIS)
PARAZIN, R.J.
1999-01-01
The U.S. Department of Energy (DOE) has chosen to accomplish the Tank Waste Remediation System disposal mission via privatization. The disposal mission has been divided into two privatization phases. Phase I, a 'proof of concept' phase, will establish and demonstrate the technical, commercial, and procurement capabilities necessary far privatization to proceed. Once established, privatization will be expanded in the form of a second phase (Phase II) to dispose of the remainder of the tank waste. In conjunction with preparation of the Tank Waste Remediation System (TWRS) Privatization Request for Proposals (RFP)(RL, 1996), a location was selected for the Phase I demonstration facilities (Shord, 1996). The location selected was the area previously developed and characterized for the Grout Disposal Site, adjoining the 200 East Area. The site is of sufficient size for a Private Contractor (PC) to carry out pretreatment, immobilization, and vitrification operations and possesses the required characteristics (e.g., close to feed tanks) to best facilitate the Phase I operations. This overall long-range Master Site Plan (MSP) has been developed to establish a ''baseline'' for the (TWRS) Privatization Phase I (TPPI) PC Site. The MSP depicts the planned layout for the PC Site along with various interfaces between the site and other Hanford utilities and functions. The complete integration of TPPl MSP with overall Hanford Site planning process will assist in establishing the PC site and the necessary priorities to meet the Hanford cleanup mission. The MSP has been developed systematically into a comprehensive, safe, flexible, logical and cost-effective plan. The general philosophy behind the preparation of a MSP for the TPPl program is that it will serve as a single source documentation of the planning for the development of the TPPl complex. The effort will plan temporary and permanent land use, utilities, and traffic flow for the overall program. It will identify needs
Screen-level non-GTS data assimilation in a limited-area mesoscale model
Directory of Open Access Journals (Sweden)
M. Milelli
2010-06-01
Full Text Available The forecast in areas of very complex topography, as for instance the Alpine region, is still a challenge even for the new generation of numerical weather prediction models which aim at reaching the km-scale. The problem is enhanced by a general lack of standard observations, which is even more evident over the southern side of the Alps. For this reason, it would be useful to increase the performance of the mathematical models by locally assimilating non-conventional data. Since in ARPA Piemonte there is the availability of a great number of non-GTS stations, it has been decided to assimilate the 2 m temperature, coming from this dataset, in the very-high resolution version of the COSMO model, which has a horizontal resolution of about 3 km, more similar to the average resolution of the thermometers. Four different weather situations have been considered, ranging from spring to winter, from cloudy to clear sky. The aim of the work is to investigate the effects of the assimilation of non-GTS data in order to create an operational very high-resolution analysis, but also to test the option of running in the future a very short-range forecast starting from these analyses (RUC or Rapid Update Cycle. The results, in terms of Root Mean Square Error, Mean Error and diurnal cycle of some surface variables such as 2 m temperature, 2 m relative humidity and 10 m wind intensity show a positive impact during the assimilation cycle which tends to dissipate a few hours after the end of it. Moreover, the 2 m temperature assimilation has a slightly positive or neutral impact on the vertical profiles of temperature, eventhough some calibration is needed for the precipitation field which is too much perturbed during the assimilation cycle, while it is unaffected in the forecast period. So the stability of the planetary boundary layer, on the one hand, has not been particularly improved by the new-data assimilation, but, on the other hand, it has not been destroyed
Radionuclide retardation project at GTS - An overview of lessons learned and ongoing experiments
International Nuclear Information System (INIS)
Moeri, A.
2001-01-01
The joint Nagra/JNC Radionuclide Migration Programme has now been ongoing for more than 15 years in Nagra's Grimsel Test Site (GTS). The main aim of the programme has been the direct testing of radionuclide transport models in as realistic a manner as possible. The understanding and modelling of both the processes and the structures influencing radionuclide transport/retardation in fractured granitic host rocks have matured as has the experimental technology, which has contributed to develop confidence in the applicability of the underlying research models in a repository performance assessment. In this paper, three in situ experiments which were carried out in a discrete granitic shear zone are briefly presented: The Migration Experiment (MI), the Excavation Experiment (EP) and the ongoing Colloid and Radionuclide Retardation Experiment (CRR). Each project expanded on the experimental experience and research results from the preceding experiment. MI provided a sound data base of in situ tracer breakthrough curves which was used to derive relevant transport parameters by inverse modelling in order to enhance the capability for predictive modelling of tracer transport in a granitic shear zone. The Excavation Project (EP) then focussed on the excavation of the dipole flow field in order to describe the flow paths within the shear zone dipole and the retardation behaviour of sorbing radionuclides that are relevant to post-closure safety. The ongoing CRR experiment actually investigates the influence of bentonite colloids on the radionuclide transport behaviour through a fractured granitic host rock. Again, the experience in planning and handling of complex tracer field experiments gained in the proceeding experiments will be availed. The methodology adopted for the geological and hydrological characterisation of water-conducting features and the simplification of this characterisation for modelling purposes proved to be indeed effective on the modelling of
Site occupancies in ternary C15 ordered Laves phases
International Nuclear Information System (INIS)
Kotula, P.G.; Chu, F.; Thoma, D.J.; Mitchell, T.E.; Anderson, I.M.; Bentley, J.
1996-01-01
Site occupancies in three C15-structured AB 2 (X) Laves phases have been determined by Atom Location by CHanneling Enhanced MIcroanalysis (ALCHEMI). In NbCr 2 (V), the results were consistent with exclusive site occupancies of Nb for the A sublattice and Cr and V for the B sublattice. The B-site occupancy of V is not expected from atom size effects alone. In NbCr 2 (Ti), the results were consistent with Ti partitioning mostly to the A sites with some anti-site defects likely. In HfV 2 (Nb), the results were consistent with Nb partitioning between the A and B sites. The results of the ALCHEMI analyses of these ternary C15 Laves phase materials will be discussed with respect to previously determined phase diagrams and first-principles total energy and electronic structure calculations
TWRS phase I privatization site environmental baseline and characterization plan
International Nuclear Information System (INIS)
Shade, J.W.
1997-01-01
This document provides a plan to characterize and develop an environmental baseline for the TWRS Phase I Privatization Site before construction begins. A site evaluation study selected the former Grout Disposal Area of the Grout Treatment Facility in the 200 East Area as the TWRS Phase I Demonstration Site. The site is generally clean and has not been used for previous activities other than the GTF. A DQO process was used to develop a Sampling and Analysis Plan that would allow comparison of site conditions during operations and after Phase I ends to the presently existing conditions and provide data for the development of a preoperational monitoring plan
Activities on the site during construction phase
International Nuclear Information System (INIS)
Fickel, O.F.
1977-01-01
A survey is given of the work done on the site from site-opening till turn over of the plant to the client. After a short introduction to time schedules, manpower on site, site facilities and civil work and constructions, the commissioning and trial operation phase is discussed in detail. This phase begins with finishing the assembly of individual systems and components and ends with the trial operation and the acceptance measurement. During this period the subsystems are started-up in a useful sequence, first from cold, then from hot conditions and are finally operated as a total with nuclear energy. The single steps are: a) commissioning of indivudal systems; b) hot functional test 1 (without fuels) c) baseline inspection at the reactor pressure vessel; d) hot functional test 2 (with fuels); e) preparation for first criticality; f) postcriticality test program; g) trial operation: h) acceptance measurement. (HP) [de
Main phases of siting for nuclear power plants with review of required investigations
International Nuclear Information System (INIS)
Malbasa, N.
1984-01-01
The purpose of the article is a short description of the main phases in the process of siting for nuclear power plants as interpreted and applied by the Institut za elektroprivredu, Zagreb in the screening, comparison and evaluation of the sites for NPPs in the SR of Croatia. The scope and purpose, as well as review of required data and investigations for each particular phase are given. Common used methods for the comparison of sites are described and example of rejection criteria applicable for early phases of the siting is proposed. It is given a list of the most important activities which detailed analysis id indispensable for ending of the evaluation and getting a site permit from the regulatory body. A legal and regulatory basis for carrying out the siting process is also described. (author)
Energy Technology Data Exchange (ETDEWEB)
Guo, Liqiu; Yang, Binjie; Qin, Sixiao [University of Science and Technology Beijing (China). Corrosion and Protection Center
2016-02-15
This paper demonstrates the hydrogen-induced phase transformation and the associated pitting nucleation sites of 2507 duplex stainless steel using scanning Kelvin probe force microscopy and magnetic force microscopy. The low potential sites in Volta potential images, which are considered as the pitting nucleation sites, are strongly dependent on the hydrogen-induced phase transformation. They firstly initiate on the magnetic martensite laths in the austenite phase or at the ferrite/austenite boundaries, and then appear near the needle-shaped microtwins in the ferrite phase, because of the difference in physicochemical properties of hydrogen-induced phase transformation microstructures.
Directory of Open Access Journals (Sweden)
Hugo R. Arias
2006-04-01
Full Text Available Abstract: Nemertines are a phylum of carnivorous marine worms that possess a variety of alkaloidal, peptidic or proteinaceous toxins that serve as chemical defenses against potential predators. The hoplonemertines additionally envenomate their prey with a mixture of proboscis alkaloids delivered with the help of a calcareous stylet that punctures the skin of the victim. Anabaseine, the first of these alkaloids to be identified, stimulates a wide variety of animal nicotinic acetylcholine receptors (AChRs, especially the neuromuscular [e.g., α12β1γδ (embryogenic or α12β1γε (adult] and α7 AChRs that are inhibited by the snake peptide α-bungarotoxin. A synthetic derivative, 3-(2,4-Dimethoxybenzylidene-Anabaseine (DMXBA; also called GTS-21, improves memory in experimental animals and humans and is currently in clinical trials to determine whether it can ameliorate cognitive problems associated with schizophrenia. Here we summarize present knowledge concerning the chemistry and mechanisms of action of these two substances (anabaseine and DMXBA on AChRs, especially those found in the mammalian brain.
Site- and phase-selective x-ray absorption spectroscopy based on phase-retrieval calculation
International Nuclear Information System (INIS)
Kawaguchi, Tomoya; Fukuda, Katsutoshi; Matsubara, Eiichiro
2017-01-01
Understanding the chemical state of a particular element with multiple crystallographic sites and/or phases is essential to unlocking the origin of material properties. To this end, resonant x-ray diffraction spectroscopy (RXDS) achieved through a combination of x-ray diffraction (XRD) and x-ray absorption spectroscopy (XAS) techniques can allow for the measurement of diffraction anomalous fine structure (DAFS). This is expected to provide a peerless tool for electronic/local structural analyses of materials with complicated structures thanks to its capability to extract spectroscopic information about a given element at each crystallographic site and/or phase. At present, one of the major challenges for the practical application of RXDS is the rigorous determination of resonant terms from observed DAFS, as this requires somehow determining the phase change in the elastic scattering around the absorption edge from the scattering intensity. This is widely known in the field of XRD as the phase problem. The present review describes the basics of this problem, including the relevant background and theory for DAFS and a guide to a newly-developed phase-retrieval method based on the logarithmic dispersion relation that makes it possible to analyze DAFS without suffering from the intrinsic ambiguities of conventional iterative-fitting. Several matters relating to data collection and correction of RXDS are also covered, with a final emphasis on the great potential of powder-sample-based RXDS (P-RXDS) to be used in various applications relevant to practical materials, including antisite-defect-type electrode materials for lithium-ion batteries. (topical review)
Integrated account of method, site selection and programme prior to the site investigation phase
International Nuclear Information System (INIS)
2000-12-01
In order to dispose of the spent nuclear fuel in a safe manner, SKB plans to site a deep repository and an encapsulation plant with associated canister fabrication and transportation system. After an integrated evaluation of feasibility studies and other material, SKB will proceed with investigations of the rock and studies regarding establishment of the deep disposal system in the municipality of Oskarshamn or in Northern Uppland. The plans also include further study of the prospects for a deep repository in the municipality of Nykoeping. In the municipality of Oskarshamn, SKB plans further studies of a siting of the deep repository at Simpevarp. There SKB wants to initiate site investigations with test drilling. For the encapsulation plant, SKB wants to continue studying a siting at CLAB. In Northern Uppland, SKB plans to study two siting alternatives for the deep repository. One is Forsmark in the municipality of Oesthammar, where SKB wants to initiate a site investigation with test drilling. The other is Tierp north of Skutskaer, where SKB intends to start test drilling in an area north of Tierp. First, however, a suitable drilling area with possible transport solutions needs to be defined. This alternative requires the participation of the municipalities of both Tierp and Aelvkarleby. A siting of the encapsulation plant in Northern Uppland will also be studied. For the municipality of Nykoeping, SKB plans to conduct a new safety assessment for the Fjaellveden area, based on data from previous investigations as well as additional studies of how a deep repository could be arranged. SKB will thereby gather data from yet another geographic and geological region beyond those that are prioritized. No test drilling is planned in Nykoeping. The goal of the site investigation phase is to obtain all permits needed to build the planned facilities. It will take an estimated 7 - 8 years to assemble the requisite supporting material, carry out consultations, compile siting
International Nuclear Information System (INIS)
Gillow, J.B.; Dunn, M.; Francis, A.J.; Lucero, D.A.; Papenguth, H.W.
2000-01-01
Microorganisms may affect the long-term stability and mobility of radionuclides disposed of in deep geological formations. Of particular concern is the association of radionuclides with subterranean microbial cells and their subsequent transport as biocolloids. We characterized the total microbial populations in two groundwater samples: one from the Culebra dolomite member of the Rustler formation at the waste isolation pilot plant (WIPP), NM, and the other from the granitic formation at the Grimsel test site (GTS), Switzerland. Culebra groundwater (ionic strength 2.8 M, pH 7) contained 1.51 ± 1.08 x 10 5 cells ml -1 , with a mean cell length of 0.75 ± 0.04 μm and width of 0.58 ± 0.02 μm. In contrast, low ionic-strength GTS groundwater (0.001 M, pH 10) contained 3.97 ± 0.37 x 10 3 cells ml -1 , with a mean cell length of 1.50 ± 0.14 μm and width of 0.37 ± 0.01 μm. Adding appropriate electron donors and acceptors to the groundwaters facilitated the growth of aerobic, denitrifying, fermentative, and acetogenic microorganisms. Uranium biosorption was studied in two isolates from these groundwaters, as well as several pure cultures from saline and non-saline environments. Halophilic and non-halophilic bacteria exhibited differences in the amount of U associated with the cells. Plutonium uptake by Acetobacterium sp. isolated from GTS varied from 30-145 pg of Pu mg -1 dry weight of cells. (orig.)
National radioactive waste repository site selection study. Phase 2. A report on public comment
International Nuclear Information System (INIS)
1995-11-01
Agreement was reached in principle between State/Territory and the Commonwealth of Australia Governments that a suitable site for a radioactive wastes repository must be found. The discussion papers resulting from the Phase 1 and Phase 2 of the site selection study were released for public comment. The national repository will be for disposal of low level and short-lived intermediate level radioactive wastes streaming from the medical, research and industrial use of radioisotopes in Australia. The purpose of this report is to summarise and respond in general terms to comment received on the discussion paper -Phase 2 of the study. Forty five submissions were received. Of these: 18 supported the Phase 2 study approach and the concept of a national repository; 13 did not state a clear position but either requested more information or provided constructive comment on the siting process; 7 supported the site selection approach and the repository concept but suggested that the repository should not be sited in a particular area; 3 opposed the siting of the repository in their vicinity but not necessarily the repository concept and site selection approach; 4 opposed the concept of a national repository. This compares with 124 submissions on Phase 1 of the study, of which 57 opposed the national repository concept (52 of these were from letters elicited by Greenpeace) and 48 supported the establishment of a national repository and the site selection approach proposed. 3 figs
Preferential site occupancy of alloying elements in TiAl-based phases
Energy Technology Data Exchange (ETDEWEB)
Holec, David, E-mail: david.holec@unileoben.ac.at; Reddy, Rajeev K.; Klein, Thomas; Clemens, Helmut [Department of Physical Metallurgy and Materials Testing, Montanuniversität Leoben, Franz-Josef-Strasse 18, A-8700 Leoben (Austria)
2016-05-28
First principles calculations are used to study the preferential occupation of ternary alloying additions into the binary Ti-Al phases, namely, γ-TiAl, α{sub 2}-Ti{sub 3}Al, β{sub o}-TiAl, and B19-TiAl. While the early transition metals (TMs, group IVB, VB, and VIB elements) prefer to substitute for Ti atoms in the γ-, α{sub 2}-, and B19-phases, they preferentially occupy Al sites in the β{sub o}-TiAl. Si is, in this context, an anomaly, as it prefers to sit on the Al sublattice for all four phases. B and C are shown to prefer octahedral Ti-rich interstitial positions instead of substitutional incorporation. The site preference energy is linked with the alloying-induced changes of energy of formation, hence alloying-related (de)stabilisation of the phases. We further show that the phase-stabilisation effect of early TMs on β{sub o}-phase has a different origin depending on their valency. Finally, an extensive comparison of our predictions with available theoretical and experimental data (which is, however, limited mostly to the γ-phase) shows a consistent picture.
Final Phase II report : QuickSite(R) investigation, Everest, Kansas.
Energy Technology Data Exchange (ETDEWEB)
LaFreniere, L. M. (Environmental Research)
2003-11-01
this reason, the CCC/USDA is conducting an environmental site investigation to determine the source(s) and extent of the carbon tetrachloride contamination at Everest and to assess whether the contamination requires remedial action. The investigation at Everest is being performed by the Environmental Research Division of Argonne National Laboratory. Argonne is a nonprofit, multidisciplinary research center operated by the University of Chicago for the U.S. Department of Energy (DOE). The CCC/USDA has entered into an interagency agreement with DOE, under which Argonne provides technical assistance to the CCC/USDA with environmental site characterization and remediation at its former grain storage facilities. At these facilities, Argonne is applying its QuickSite{reg_sign} environmental site characterization methodology. This methodology has been applied successfully at a number of former CCC/USDA facilities in Kansas and Nebraska and has been adopted by the American Society for Testing and Materials (ASTM 1998) as standard practice for environmental site characterization. Phase I of the QuickSite{reg_sign} investigation examined the key geologic, hydrogeologic, and hydrogeochemical relationships that define potential contaminant migration pathways at Everest (Argonne 2001). Phase II of the QuickSite{reg_sign} investigation at Everest was undertaken with the primary goal of delineating and improving understanding of the distribution of carbon tetrachloride contamination in groundwater at this site and the potential source area(s) that might have contributed to this contamination. To address this goal, four specific technical objectives were developed to guide the Phase II field studies. Sampling of near-surface soils at the former Everest CCC/USDA facility that was originally planned for Phase I had to be postponed until October 2000 because of access restrictions. Viable vegetation was not available for sampling then. This period is termed the first session of Phase II
Phase I Source Investigation, Heckathorn Superfund Site, Richmond, California
Energy Technology Data Exchange (ETDEWEB)
Kohn, Nancy P; Evans, Nathan R
2002-12-18
This report represents Phase I of a multi-phase approach to a source investigation of DDT at the Heckathorn Superfund Site, Richmond, California, the former site of a pesticide packaging plant, and the adjacent waterway, the Lauritzen Channel. Potential identified sources of contamination were from sloughed material from undredged areas (such as side banks) and from outfall pipes. Objectives of Phase I included the (1) evaluation of pesticide concentrations associated with discharge from outfalls, (2) identification of additional outfalls in the area, (3) identification of type, quantity, and distribution of sediment under the Levin pier, (4) quantification of pesticide concentrations in sediment under the pier, and (5) evaluation of sediment structure and slope stability under the pier. Field operations included the collection of sediment directly from inside the mouths of outfall pipes, when possible, or the deployment of specially designed particle traps where direct sampling was problematic. Passive water samplers were placed at the end of known outfall pipes and analyzed for DDT and other pesticides of concern. Underwater dive surveys were conducted beneath the Levin pier to document type, slope, and thickness of sediment. Samples were collected at locations of interest and analyzed for contaminants. Also sampled was soil from bank areas, which were suspected of potentially contributing to continued DDT contamination of the Lauritzen Channel through erosion and groundwater leaching. The Phase I Source Investigation was successful in identifying significant sources of DDT contamination to Lauritzen Channel sediment. Undredged sediment beneath the Levin pier that has been redistributed to the channel is a likely source. Two outfalls tested bear further investigation. Not as well-defined are the contributions of bank erosional material and groundwater leaching. Subsequent investigations will be based on the results of this first phase.
International Nuclear Information System (INIS)
Yang, T.; Gao, Y.; Wang, D.; Shi, R.P.; Chen, Z.; Nie, J.F.; Li, J.; Wang, Y.
2017-01-01
Migration of phase boundaries in crystalline solids eliminates one set of lattice sites and establishes another. Using a combination of phase field crystal modeling and crystallographic analysis, we present here a complete atomistic description of the migration mechanism of a high-index planar interface during a diffusional hexagon to square phase transformation. In particular we show that a terrace-step interface advances macroscopically in the form of growth ledges, while microscopically its migration occurs by opposite shearing on the terraces and a one-to-two splitting of lattice sites, giving a new class of lattice site correspondence and superabundant vacancies. In addition, a new approach capable of finding a critical nucleus with atomic resolution is developed by combining the phase field crystal energetics with the free-end nudged elastic band algorithm.
Gravitationally compact objects as nucleation sites for first-order vacuum phase transitions
International Nuclear Information System (INIS)
Samuel, D.A.; Hiscock, W.A.
1992-01-01
A characteristic of first-order phase transitions is their ability to be initiated by nucleation sites. In this paper we consider the role that gravitationally compact objects may play as nucleation sites for first-order phase transitions within quantum fields. As the presence of nucleation sites may prevent the onset of supercooling, the existence of nucleation sites for phase transitions within quantum fields may play an important role in some inflationary models of the Universe, in which the Universe is required to exist in a supercooled state for a period of time. In this paper we calculate the Euclidean action for an O(3) bubble nucleating about a gravitationally compact object, taken to be a boson star for simplicity. The gravitational field of the boson star is taken to be a small perturbation on flat space, and the O(3) action is calculated to linear order as a perturbation on the O(4) action. The Euclidean bubble profile is found by solving the (Higgs) scalar field equation numerically; the thin-wall approximation is not used. The gravitationally compact objects are found to have the effect of reducing the Euclidean action of the nucleating bubble, as compared to the Euclidean action for the bubble in flat spacetime. The effect is strongest when the size of the gravitationally compact object is comparable to the size of the nucleating bubble. Further, the size of the decrease in action increases as the nucleating ''star'' is made more gravitationally compact. Thus, gravitationally compact objects may play the role of nucleation sites. However, their importance to the process of false-vacuum decay is strongly dependent upon their number density within the Universe
Sub-nanosecond clock synchronization and trigger management in the nuclear physics experiment AGATA
International Nuclear Information System (INIS)
Bellato, M; Isocrate, R; Rampazzo, G; Bazzacco, D; Bortolato, D; Triossi, A; Chavas, J; Mengoni, D; Recchia, F
2013-01-01
The new-generation spectrometer AGATA, the Advanced GAmma Tracking Array, requires sub-nanosecond clock synchronization among readout and front-end electronics modules that may lie hundred meters apart. We call GTS (Global Trigger and Synchronization System) the infrastructure responsible for precise clock synchronization and for the trigger management of AGATA. It is made of a central trigger processor and nodes, connected in a tree structure by means of optical fibers operated at 2Gb/s. The GTS tree handles the synchronization and the trigger data flow, whereas the trigger processor analyses and eventually validates the trigger primitives centrally. Sub-nanosecond synchronization is achieved by measuring two different types of round-trip times and by automatically correcting for phase-shift differences. For a tree of depth two, the peak-to-peak clock jitter at each leaf is 70 ps; the mean phase difference is 180 ps, while the standard deviation over such phase difference, namely the phase equalization repeatability, is 20 ps. The GTS system has run flawlessly for the two-year long AGATA campaign, held at the INFN Legnaro National Laboratories, Italy, where five triple clusters of the AGATA sub-array were coupled with a variety of ancillary detectors
Sub-nanosecond clock synchronization and trigger management in the nuclear physics experiment AGATA
Bellato, M.; Bortolato, D.; Chavas, J.; Isocrate, R.; Rampazzo, G.; Triossi, A.; Bazzacco, D.; Mengoni, D.; Recchia, F.
2013-07-01
The new-generation spectrometer AGATA, the Advanced GAmma Tracking Array, requires sub-nanosecond clock synchronization among readout and front-end electronics modules that may lie hundred meters apart. We call GTS (Global Trigger and Synchronization System) the infrastructure responsible for precise clock synchronization and for the trigger management of AGATA. It is made of a central trigger processor and nodes, connected in a tree structure by means of optical fibers operated at 2Gb/s. The GTS tree handles the synchronization and the trigger data flow, whereas the trigger processor analyses and eventually validates the trigger primitives centrally. Sub-nanosecond synchronization is achieved by measuring two different types of round-trip times and by automatically correcting for phase-shift differences. For a tree of depth two, the peak-to-peak clock jitter at each leaf is 70 ps; the mean phase difference is 180 ps, while the standard deviation over such phase difference, namely the phase equalization repeatability, is 20 ps. The GTS system has run flawlessly for the two-year long AGATA campaign, held at the INFN Legnaro National Laboratories, Italy, where five triple clusters of the AGATA sub-array were coupled with a variety of ancillary detectors.
Topological phases in the Haldane model with spin–spin on-site interactions
Rubio-García, A.; García-Ripoll, J. J.
2018-04-01
Ultracold atom experiments allow the study of topological insulators, such as the non-interacting Haldane model. In this work we study a generalization of the Haldane model with spin–spin on-site interactions that can be implemented on such experiments. We focus on measuring the winding number, a topological invariant, of the ground state, which we compute using a mean-field calculation that effectively captures long-range correlations and a matrix product state computation in a lattice with 64 sites. Our main result is that we show how the topological phases present in the non-interacting model survive until the interactions are comparable to the kinetic energy. We also demonstrate the accuracy of our mean-field approach in efficiently capturing long-range correlations. Based on state-of-the-art ultracold atom experiments, we propose an implementation of our model that can give information about the topological phases.
Grimsel test site. Excavation disturbed zone experiment (EDZ)
International Nuclear Information System (INIS)
Frieg, B.; Blaser, P. C.; Adams, J.; Dollinger, H.; Kuhlmann, U.; Lanyon, G. W.
2012-07-01
The ‘Excavation Disturbed Zone (EDZ) Experiment’ was conducted at the Grimsel Test Site (GTS) in the framework of safety analysis of deep geological repositories for radioactive wastes. It concentrated on investigating the hydraulic regime of the near-field of drilled tunnel sections under fully saturated conditions, with the aim of contributing to the development of methods for measuring and modelling axial water flow along tunnels and caverns. The studies focused on the mechanical and hydraulic properties of the rock mass in the direct vicinity of the tunnel wall. The EDZ is defined as the zone around the tunnel where excavation has altered the rock properties. The selected test location was a tunnel section where mechanical stressing of the rock and some breakouts had been observed. In-situ stress measurements were performed in order to record the actual stress redistribution in the tunnel near-field induced by excavation of the tunnel. A small stress increase and microfissures could be identified in the tunnel near-field. The stress measurements and the results of the geological mapping formed the basis for the rock mechanical modelling of the EDZ. Two different models of the development and geometry of the EDZ were used: (a) the regional 3D stress field modelling indicated that the topography has a significant influence on the primary stress field; a good agreement between the measured and calculated stresses in the GTS was achieved by applying an additional far-field tectonic stress component; (b) with the local 2D numerical disturbed zone modelling of the tunnel section itself, stress redistributions, possible plastifications and joint behaviour were investigated; all displacements of the rock matrix and the shear displacements of the discontinuities seem to be the result of the tunnel excavation; maximum shear deformations of 2 - 5 mm occur at the tunnel wall. Prior to the hydraulic test phase, the test location was decoupled from the normal GTS tunnel
International Nuclear Information System (INIS)
Gao, Zhiyong; Chen, Baishu; Meng, Xianglong; Cai, Wei
2013-01-01
Highlights: •Site preference and phase stability of NiMnGaTi are studied by first-principles. •The Ti atoms prefer to occupy the Ga sites in the Ni 2 MnGa austenitic phase. •The phase stability becomes worse when Ga is replaced by Ti. •The phase stability is discussed based on the densities of states. -- Abstract: The effects of Ti content on martensitic transformation and phase stability of Ni 50 Mn 25 Ga 25−x Ti x shape memory alloys were investigated from first-principles calculations based on density functional theory. The formation energy results indicate that the added Ti preferentially occupies the Ga sites in Ni 2 MnGa alloy due to the lowest formation energy. The total energy difference between austenite and martensite increases with Ti alloying, being relevant to the experimentally reported changes in martensitic transformation temperature. The phase stability of Ni 50 Mn 25 Ga 25−x Ti x austenite decreases with increasing Ti content, which results from the reduced Ni 3d–Mn 3d hybridization when Ga is replaced by Ti
International Nuclear Information System (INIS)
Nakajima, K.; Bunko, H.; Tada, A.; Tonami, N.; Taki, J.; Nanbu, I.; Hisada, K.; Misaki, T.; Iwa, T.
1984-01-01
Phase analysis has been applied to Wolff-Parkinson-White syndrome (WPW) to detect the site of accessory conduction pathway (ACP); however, there was a limitation to estimate the precise location of ACP by planar phase analysis. In this study, the authors applied phase analysis to gated blood pool tomography. Twelve patients with WPW who underwent epicardial mapping and surgical division of ACP were studied by both of gated emission computed tomography (GECT) and routine gated blood pool study (GBPS). The GBPS was performed with Tc-99m red blood cells in multiple projections; modified left anterior oblique, right anterior oblique and/or left lateral views. In GECT, short axial, horizontal and vertical long axial blood pool images were reconstructed. Phase analysis was performed using fundamental frequency of the Fourier transform in both GECT and GBPS images, and abnormal initial contractions on both the planar and tomographic phase analysis were compared with the location of surgically confirmed ACPs. In planar phase analysis, abnormal initial phase was identified in 7 out of 12 (58%) patients, while in tomographic phase analysis, the localization of ACP was predicted in 11 out of 12 (92%) patients. Tomographic phase analysis is superior to planar phase images in 8 out of 12 patients to estimate the location of ACP. Phase analysis by GECT can avoid overlap of blood pool in cardiac chambers and has advantage to identify the propagation of phase three-dimensionally. Tomographic phase analysis is a good adjunctive method for patients with WPW to estimate the site of ACP
Energy Technology Data Exchange (ETDEWEB)
Nakajima, K.; Bunko, H.; Tada, A.; Tonami, N.; Taki, J.; Nanbu, I.; Hisada, K.; Misaki, T.; Iwa, T.
1984-01-01
Phase analysis has been applied to Wolff-Parkinson-White syndrome (WPW) to detect the site of accessory conduction pathway (ACP); however, there was a limitation to estimate the precise location of ACP by planar phase analysis. In this study, the authors applied phase analysis to gated blood pool tomography. Twelve patients with WPW who underwent epicardial mapping and surgical division of ACP were studied by both of gated emission computed tomography (GECT) and routine gated blood pool study (GBPS). The GBPS was performed with Tc-99m red blood cells in multiple projections; modified left anterior oblique, right anterior oblique and/or left lateral views. In GECT, short axial, horizontal and vertical long axial blood pool images were reconstructed. Phase analysis was performed using fundamental frequency of the Fourier transform in both GECT and GBPS images, and abnormal initial contractions on both the planar and tomographic phase analysis were compared with the location of surgically confirmed ACPs. In planar phase analysis, abnormal initial phase was identified in 7 out of 12 (58%) patients, while in tomographic phase analysis, the localization of ACP was predicted in 11 out of 12 (92%) patients. Tomographic phase analysis is superior to planar phase images in 8 out of 12 patients to estimate the location of ACP. Phase analysis by GECT can avoid overlap of blood pool in cardiac chambers and has advantage to identify the propagation of phase three-dimensionally. Tomographic phase analysis is a good adjunctive method for patients with WPW to estimate the site of ACP.
International Nuclear Information System (INIS)
Ahmad Hasnulhadi Che Kamaruddin; Faizal Azrin Abdul Razalim; Mohd Abdul Wahab Yusof; Nik Marzukee Nik Ibrahim; Nazran Harun; Muhammad Fathi Sujan; Karuppiah, T.; Surip, N.; Malik, N.N.A.; Che Musa, R.
2010-01-01
The main purpose in this paper is to create the Geographic Information System (GIS) based analysis on the potential site area for near-surface radioactive waste repository in the state of Negeri Sembilan. There are several parameters should be considered related to the safety assessment in selecting the potential site. These parameters such as land-use, urban area, soil, rainfall, lithology, lineament, geomorphology, landslide potential, slope, elevation, hydrogeology and protected land need to be considered before choosing the site. In this phase, we only consider ten parameters for determining the potential suitable site. (author)
Phase I remedial action of properties associated with the former Middlesex Sampling Plant Site
International Nuclear Information System (INIS)
1982-04-01
The Phase I Remedial Action Work on properties associated with the Middlesex Sampling Plant Site in Middlesex, New Jersey was completed during 1980. In addition to the two properties included in the original scope of work, three other properties were decontaminated. In the playground across the street from the Rectory, contaminated soil was discovered and subsequently removed. Later, at the request of the DOE, the Kays and Rosamilia properties were decontaminated. Decontamination of the properties included in Phase I has, in the judgment of NLO, been successfully achieved, as evidenced by the data presented in this and in the referenced Eberline Instrument Corporation reports. Final certification of the sites for unrestricted use will be by ASEP/OOS based upon all available data, of which this report is a part. Work completed at Middlesex, together with the lessons learned during the execution of the entire project, is indicative that future decontamination assignments can be accomplished with mutual benefits for the DOE, as well as the local citizens. Restoration of the Rectory and the William Street property exemplifies the excellence of work performed by the Remedial Action Subcontractors and is further evidence of the success of the Phase I work. A summary of the Phase I costs are tabulated
Site Closure Strategy Model for Creosote Site
International Nuclear Information System (INIS)
Coll, F.R.; Gray, D.R.
2009-01-01
In conjunction with RCRA site corrective action at an active wood preserving facility, a risk-based site closure strategy was developed and incorporated the performance of a dense non-aqueous phase liquid (DNAPL) source recovery remedy, a monitored natural attenuation (MNA) remedy for dissolved phase groundwater, and institutional controls. Innovative creosote DNAPL source recovery has been undertaken at the Site since 1998. Pooled creosote DNAPL is present 90 feet below ground within a transmissive sand and gravel aquifer with a saturated thickness of approximately 80 feet. The creosote DNAPL source is situated on the property boundary of the site and has generated a 1/2 mile off-site dissolved phase plume, creating significant NAPL management and remedial technology verification issues. To date, over 120,000 gallons of creosote DNAPL have been recovered from the subsurface utilizing a modified circulation well technology. A mass discharge flux protocol was developed to serve as a major performance metrics for the continuation of source removal efforts and to support the application of monitored natural attenuation as an associated remedial technology for groundwater. The mass removal success has supported the MNA remedy for dissolved phase groundwater and the associated development of institutional controls. The enacted site management strategy outlines the current and future risk management activities for the Site and represents an appropriate site closure strategy for the Site. (authors)
Al-Amoodi, Asma S.
2017-01-01
Recruitment of circulating cells towards target sites is primarily dependent on E-selectin receptor/ligand adhesive interactions. Glycosyltransferase (GTs) are involved in the creation of E-selectin ligands. A sialofucosylated terminal
Phase I decontamination of the J.C. Haynes site, Newark, Ohio. Final report
International Nuclear Information System (INIS)
Emswiler, T.R.
1985-11-01
Phase I consisted of the primary decontamination, packaging, and shipment of all 241 Am-contaminated gloveboxes, vent system, and miscellaneous waste items located in the laboratory restricted area in the J.C. Haynes house. The primary goals of Phase I were to locate and account for a major quantity of 241 Am which was unaccounted for and to remove all radioactive materials and contamination posing an imminent hazard to public health and safety. All Phase I operations were conducted under a Quality Assurance (QA) Program Plan and QA procedures written specifically for this program. In addition, certain generic Battelle QA procedures were used for routine tasks. All operations were conducted under strict health physics supervision and procedures. Cognizant ORAU and US Nuclear Regulatory Commission (NRC) personnel were on site during the entire Phase I operation and provided support and approval in the daily operations. All staff members had participated in previous decontamination and decommissioning programs involving transuranic waste and completed Phase I in a well controlled, timely, and safe manner
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-12-01
In order to dispose of the spent nuclear fuel in a safe manner, SKB plans to site a deep repository and an encapsulation plant with associated canister fabrication and transportation system. After an integrated evaluation of feasibility studies and other material, SKB will proceed with investigations of the rock and studies regarding establishment of the deep disposal system in the municipality of Oskarshamn or in Northern Uppland. The plans also include further study of the prospects for a deep repository in the municipality of Nykoeping. In the municipality of Oskarshamn, SKB plans further studies of a siting of the deep repository at Simpevarp. There SKB wants to initiate site investigations with test drilling. For the encapsulation plant, SKB wants to continue studying a siting at CLAB. In Northern Uppland, SKB plans to study two siting alternatives for the deep repository. One is Forsmark in the municipality of Oesthammar, where SKB wants to initiate a site investigation with test drilling. The other is Tierp north of Skutskaer, where SKB intends to start test drilling in an area north of Tierp. First, however, a suitable drilling area with possible transport solutions needs to be defined. This alternative requires the participation of the municipalities of both Tierp and Aelvkarleby. A siting of the encapsulation plant in Northern Uppland will also be studied. For the municipality of Nykoeping, SKB plans to conduct a new safety assessment for the Fjaellveden area, based on data from previous investigations as well as additional studies of how a deep repository could be arranged. SKB will thereby gather data from yet another geographic and geological region beyond those that are prioritized. No test drilling is planned in Nykoeping. The goal of the site investigation phase is to obtain all permits needed to build the planned facilities. It will take an estimated 7 - 8 years to assemble the requisite supporting material, carry out consultations, compile siting
International Nuclear Information System (INIS)
Turaev, N.Yu.; Turaev, E.Yu.; Khuzhakulov, E.S.; Seregin, P.P.
2006-01-01
Results of electron density change calculations for sites of the one-dimensional Kronig-Penny lattice at the superconducting phase transition have been presented. The transition from normal state to super conducting one is accompanied by the rise of the electron density at the unit cell centre. It is agreement with Moessbauer spectroscopy data. (author)
Groundwater quality assessment plan for the 1324-N/NA Site: Phase 1 (first determination)
International Nuclear Information System (INIS)
Hartman, M.J.
1998-05-01
The 1324-N Surface Impoundment and 1324-NA Percolation Pond (1324-N/NA Site) are treatment/storage/disposal sites regulated under the Resource Conservation and Recovery Act of 1976 (RCRA). They are located in the 100-N Area of the Hanford Site, and were used to treat and dispose of corrosive waste from a water treatment plant. Groundwater monitoring under an interim-status detection program compared indicator parameters from downgradient wells to background values established from an upgradient well. One of the indicator parameters, total organic carbon (TOC), exceeded its background value in one downgradient well, triggering an upgrade from a detection program to an assessment program. This plan presents the first phase of the assessment program
International Nuclear Information System (INIS)
Chuang, T.Y.
1981-07-01
Project I of Phase I of the Seismic Safety Margins Research Program (SSMRP) comprised two parts: the selection of a representative nuclear power plant/site for study in Phase I and the collection of data needed by the other SSMRP projects. Unit 1 of the Zion Nuclear Power Plant in Zion, Illinois, was selected for the SSMRP Phase I studies. Unit 1 of the Zion plant has been validated as a good choice for the Phase I study plant. Although no single nuclear power plant can represent all such plants equally well, selection criteria were developed to maximize the generic implications of Phase I of the SSMRP. On the basis of the selection criteria, the Zion plant and its site were found to be reasonably representative of operating and future plants with regard to its nuclear steam supply system; the type of containment structure (prestressed concrete); its electrical capacity (1100 MWe); its location (the Midwest); the peak seismic acceleration used for design (0.17g); and the properties of the underlying soil (the low-strain shear-wave velocity is 1650 ft/s in a 50- to 100-ft-thick layer of soil overlying sedimentary bedrock). (author)
Energy Technology Data Exchange (ETDEWEB)
Wang, Longlu; Duan, Xidong; Liu, Chengbin; Zhang, Shuqu; Zeng, Yunxiong [State Key Laboratory of Chemo/Biosensing and Chemometrics, Hunan University, Changsha (China); Liu, Xia; Pei, Yong [Key Laboratory of Environmentally Friendly Chemistry and Applications of Ministry of Education, Xiangtan University (China); Luo, Jinming; Crittenden, John [Brook Byers Institute for Sustainable Systems and School of Civil and Environmental Engineering, Georgia Institute of Technology, Atlanta, GA (United States); Duan, Xiangfeng [Department of Chemistry and Biochemistry, University of California, Los Angeles, CA (United States)
2017-06-19
The metallic 1T-MoS{sub 2} has attracted considerable attention as an effective catalyst for hydrogen evolution reactions (HERs). However, the fundamental mechanism about the catalytic activity of 1T-MoS{sub 2} and the associated phase evolution remain elusive and controversial. Herein, we prepared the most stable 1T-MoS{sub 2} by hydrothermal exfoliation of MoS{sub 2} nanosheets vertically rooted into rigid one-dimensional TiO{sub 2} nanofibers. The 1T-MoS{sub 2} can keep highly stable over one year, presenting an ideal model system for investigating the HER catalytic activities as a function of the phase evolution. Both experimental studies and theoretical calculations suggest that 1T phase can be irreversibly transformed into a more active 1T' phase as true active sites in photocatalytic HERs, resulting in a ''catalytic site self-optimization''. Hydrogen atom adsorption is the major driving force for this phase transition. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
Site description of Forsmark at completion of the site investigation phase. SDM-Site Forsmark
Energy Technology Data Exchange (ETDEWEB)
2008-12-15
The Swedish Nuclear Fuel and Waste Management Co., SKB, has undertaken site characterisation in two different areas, Forsmark and Laxemar-Simpevarp, in order to identify a suitable location for a geological repository of spent nuclear fuel according to the KBS-3 method. The site investigations have been conducted in campaigns, punctuated by data freezes. After each data freeze, the site data have been analysed and modelling has been carried out with the overall purpose to develop a site descriptive model (SDM). The site descriptive model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It is also essential for safety assessment, since the model is the only source for site-specific input. Another important use of the site descriptive model is in the environmental impact assessment. An SDM is an integrated model for geology, thermal properties, rock mechanics, hydrogeology, hydrogeochemistry, bedrock transport properties and a description of the surface system. The site descriptive model compiled in the current report, SDM-Site, presents an integrated understanding of the Forsmark area at the completion of the surface-based investigations, which were conducted at Forsmark during the period 2002 to 2007. It also provides a summary of the abundant underlying data and the discipline-specific models that support the site understanding. The description relies heavily on background reports that address, in particular, details in data analyses and modelling in the different disciplines. The Forsmark area is located in northern Uppland within the municipality of Oesthammar, about 120 km north of Stockholm. The candidate area for site investigation is located along the shoreline of Oeregrundsgrepen, within the north-western part of a major tectonic lens that formed between 1.87 and 1.85 billion years ago during the Svecokarelian orogeny. The candidate area is approximately 6 km long and 2 km wide. The
Site description of Laxemar at completion of the site investigation phase. SDM-Site Laxemar
Energy Technology Data Exchange (ETDEWEB)
2009-12-15
The Swedish Nuclear Fuel and Waste Management Company (SKB) has undertaken site characterisation in two different areas, Forsmark and Laxemar-Simpevarp, in order to identify a suitable location for a geological repository of spent nuclear fuel according to the KBS-3 method. The site investigations have been conducted in campaigns, punctuated by data freezes. After each data freeze, the site data have been analysed and modelling has been carried out with the overall purpose to develop a site descriptive model (SDM). The site descriptive model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It is also essential for safety assessment, since the SDM is the only source for site-specific input. Another important use of the site descriptive model is in the environmental impact assessment. An SDM is an integrated model of geology, thermal properties, rock mechanics, hydrogeology, hydrogeochemistry, bedrock transport properties and a description of the surface system. The site descriptive model compiled in the current report, SDM-Site Laxemar, presents an integrated understanding of the Laxemar-Simpevarp area (with special emphasis on the Laxemar subarea) at the completion of the surface-based investigations, which were conducted during the period 2002 to 2007. A summary is also provided of the abundant underlying data and the discipline specific models that support the site understanding. The description relies heavily on background reports that address, in particular, details of the data analyses and modelling of the different disciplines. The Laxemar-Simpevarp area is located in the province of Smaaland within the municipality of Oskarshamn, about 230 km south of Stockholm. The candidate area for site investigation is located along the shoreline of the strait of Kalmarsund, within a 1.8 billion year old suite of well preserved bedrock belonging to the Transscandinavian Igneous Belt formed during
Site description of Laxemar at completion of the site investigation phase. SDM-Site Laxemar
International Nuclear Information System (INIS)
2009-12-01
The Swedish Nuclear Fuel and Waste Management Company (SKB) has undertaken site characterisation in two different areas, Forsmark and Laxemar-Simpevarp, in order to identify a suitable location for a geological repository of spent nuclear fuel according to the KBS-3 method. The site investigations have been conducted in campaigns, punctuated by data freezes. After each data freeze, the site data have been analysed and modelling has been carried out with the overall purpose to develop a site descriptive model (SDM). The site descriptive model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It is also essential for safety assessment, since the SDM is the only source for site-specific input. Another important use of the site descriptive model is in the environmental impact assessment. An SDM is an integrated model of geology, thermal properties, rock mechanics, hydrogeology, hydrogeochemistry, bedrock transport properties and a description of the surface system. The site descriptive model compiled in the current report, SDM-Site Laxemar, presents an integrated understanding of the Laxemar-Simpevarp area (with special emphasis on the Laxemar subarea) at the completion of the surface-based investigations, which were conducted during the period 2002 to 2007. A summary is also provided of the abundant underlying data and the discipline specific models that support the site understanding. The description relies heavily on background reports that address, in particular, details of the data analyses and modelling of the different disciplines. The Laxemar-Simpevarp area is located in the province of Smaaland within the municipality of Oskarshamn, about 230 km south of Stockholm. The candidate area for site investigation is located along the shoreline of the strait of Kalmarsund, within a 1.8 billion year old suite of well preserved bedrock belonging to the Transscandinavian Igneous Belt formed during
Site description of Forsmark at completion of the site investigation phase. SDM-Site Forsmark
International Nuclear Information System (INIS)
2008-12-01
The Swedish Nuclear Fuel and Waste Management Co., SKB, has undertaken site characterisation in two different areas, Forsmark and Laxemar-Simpevarp, in order to identify a suitable location for a geological repository of spent nuclear fuel according to the KBS-3 method. The site investigations have been conducted in campaigns, punctuated by data freezes. After each data freeze, the site data have been analysed and modelling has been carried out with the overall purpose to develop a site descriptive model (SDM). The site descriptive model is used by repository engineering to design the underground facility and to develop a repository layout adapted to the site. It is also essential for safety assessment, since the model is the only source for site-specific input. Another important use of the site descriptive model is in the environmental impact assessment. An SDM is an integrated model for geology, thermal properties, rock mechanics, hydrogeology, hydrogeochemistry, bedrock transport properties and a description of the surface system. The site descriptive model compiled in the current report, SDM-Site, presents an integrated understanding of the Forsmark area at the completion of the surface-based investigations, which were conducted at Forsmark during the period 2002 to 2007. It also provides a summary of the abundant underlying data and the discipline-specific models that support the site understanding. The description relies heavily on background reports that address, in particular, details in data analyses and modelling in the different disciplines. The Forsmark area is located in northern Uppland within the municipality of Oesthammar, about 120 km north of Stockholm. The candidate area for site investigation is located along the shoreline of Oeregrundsgrepen, within the north-western part of a major tectonic lens that formed between 1.87 and 1.85 billion years ago during the Svecokarelian orogeny. The candidate area is approximately 6 km long and 2 km wide. The
AbuElela, Ayman
2017-12-01
During tumor progression and development of distant metastases, a subset of cancer cells undergoes transformation programs, such as epithelial-mesenchymal transition (EMT), to acquire enhanced migratory attributes to commence the metastatic cascade with the intension of achieving an active cell adhesion molecule-mediated organ-specific homing. Similarly, naive T cells reform the assemblage of their surface adhesion molecules during differentiation to activated T cells in order to successfully home to sites of inflammation and other extra-lymphoid organs for surveillance purposes. Sialyl-Lewis X (sLex) is well-known for mediating the homing of epithelial circulating tumor cellss (CTCs) and activated T cells to target sites through the interaction with endothelial selectins. Since glycan structures are not directly encoded by the genome, their expression is dependent on the glycosyltransferase (GT) expression and activity. Yet, the modulation of GTs during breast cancer transformation and in different molecular subtypes is still unknown. In addition, although the regulation of GTs during T cell activation is well-understood, the regulation at the epigenetic level is lacking. O-glycan-type sLex expression and E-selectin binding under static and flow conditions varies among molecular subtypes of breast cancer and upon the induction of EMT which is linked to the expression patterns of GTs. GTs displayed a significant prognostic value of in the association with the patients\\' survival profiles and in the ability to predict the breast cancer molecular subtypes from the expression data of a random patient sample. Also, GTs were able to differentiate between tumor and their normal counterparts as well as cancer types and glioblastoma subtypes. On the other hand, we studied the regulation of GTs in human CD4+ memory T cells compared to the naive cells at the epigenetic level. Memory T cell subsets demonstrated differential chromatin accessibility and histone marks within
Edwards, C. S.; Piqueux, S.; Hamilton, V. E.; Fergason, R. L.; Herkenhoff, K. E.; Vasavada, A. R.; Sacks, L. E.; Lewis, K. W.; Smith, M. D.
2017-12-01
The surface of Mars has been characterized using orbital thermal infrared observations from the time of the Mariner 9 and Viking missions. More recent observations from missions such as the Thermal Emission Spectrometer onboard the Mars Global Surveyor and the Thermal Emission Imaging System (THEMIS) instrument onboard the 2001 Mars Odyssey orbiter have continued to expand global coverage at progressively higher resolution. THEMIS has been producing 100 m/pixel thermal infrared data with nearly global coverage of the surface for >15 years and has enabled new investigations that successfully link outcrop-scale information to physical properties of the surface. However, significant discrepancies between morphologies and interpreted surface properties derived from orbital thermal measurements remain, requiring a robust link to direct surface measurements. Here, we compare the thermophysical properties and particle sizes derived from the Mars Science Laboratory (MSL) rover's Ground Temperature Sensor (GTS), to those derived orbitally from THEMIS, ultimately linking these measurements to ground truth particle sizes determined from Mars Hand Lens Imager (MAHLI) images. We focus on the relatively homogenous Bagnold dunes, specifically Namib dune, and in general find that all three datasets report consistent particle sizes for the Bagnold dunes ( 110-350 µm, and are within measurement and model uncertainties), indicating that particles sizes of homogeneous materials determined from thermal measurements are reliable. In addition, we assess several potentially significant effects that could influence the derived particle sizes, including: 1) fine-scale (cm-m scale) ripples, and 2) thin (mm-cm) layering of indurated/armored materials. To first order, we find that small scale ripples and thin layers do not significantly affect the determination of bulk thermal inertia determined from orbit. However, a layer of coarser/indurated material and/or fine-scale layering does change
International Nuclear Information System (INIS)
Seppaelae, Timo
2001-01-01
In Finland, Posiva Oy is responsible for the final disposal of spent nuclear fuel. In the 1990's investigations have been carried out on four intended sites for final disposal. Posiva implemented Environmental Impact Assessment (EIA) on the investigation sites in 1997-1999. The results of the EIA procedure were published in the EIA report which was attached to the application filed to the Government in May 1999 for a policy decision on the construction of the final disposal facility in Olkiluoto in the municipality of Eurajoki. In December 2000, the Finnish Government made a favourable policy decision ( D ecision in Principle ) on the construction of final disposal facility for spent nuclear fuel in Olkiluoto. According to the decision, the facility is in line with the overall good of the society. According to the Government's decision the prerequisites of the policy decision had been met. The municipality of Eurajoki supported the construction of the facility in Olkiluoto and STUK, the Radiation and Nuclear Safety Authority, also approved of the advancement of the project. The positive policy decision of the Government will still need to be ratified by the Parliament. The parliamentary proceedings of the policy decision will probably start in February 2001. The policy decision will make it possible for Posiva to concentrate the future site confirmation studies in Olkiluoto, Eurajoki, and construct an underground research facility there. The excavation of the research facility in the bedrock is planned to start in a few years' time. The construction of the final disposal facility is scheduled to start after the year 2010. The transition from the site selection to the site confirmation phase in Eurajoki means a new challenge not only to Posiva's research work but also to Posiva's communication. In addition to meeting the safety criteria, Posiva's activities shall in the future also meet all the criteria specified by the surrounding society
Searching for Tourette’s syndrome gene. Part 1. Heterogeneity of clinical phenotypes
Directory of Open Access Journals (Sweden)
Anna Kowalska
2012-02-01
Full Text Available The French neuropsychiatrist Georges Gilles de la Tourette described in 1885 the “Maladie des Tics” which later was named after him, as Gilles de la Tourette syndrome (GTS. Gilles de la Tourette syndrome is a neurodevelopmental disorder characterized by simple and complex motor and vocal tics with multiple neuropsychiatric comorbidities. GTS is often concurrent with obsessive-compulsive disorder (OCD and attention deficit hyperactivity disorder (ADHD. There are several clinical GTS subtypes: GTS only, GTS OCD, and GTS OCD ADHD. Additional clinical aspects of the disorder include occurrence of anger episodes, anxiety and mood disorders, and learning and sleeping disturbances. The genetics of GTS is complex and remains unclear. So far, no causative candidate genes have been identified. However, segregation studies in families and twins with GTS provide strong evidence for the existence of a genetic background associated with a multifactorial mode of inheritance. Progress in studies on genome variability among patients with GTS is necessary to improve pharmacotherapeutic strategies of the disorder.
International Nuclear Information System (INIS)
Sanami, Toshiya; Ban, Syuichi; Sasaki, Shin-ichi
2015-01-01
The International Linear Collider (ILC) is a proposed high-energy collider consisting of two linear accelerators, two dumping rings, electron and positron sources, and a single colliding hall with two detectors. The total length and CMS energy of the ILC will be 31 km and 500 GeV, respectively (and 50 km and 1 TeV after future upgrade). The design of the ILC has entered the pre-project phase, which includes site-dependent design. Radiation safety design for the ILC is on-going as a part of conventional facility and siting activities of the pre-project phase. The thickness of a central wall of normal concrete is designed to be 3.5 m under a pessimistic assumption of beam loss. The beam loss scenario is under discussion. Experience and knowledge relating to shielding design and radiation control operational work at other laboratories are required. (authors)
National Research Council Canada - National Science Library
Yang, Kyoung
2005-01-01
This final report summarizes the progress during the Phase I SBIR project entitled "Embedded Electro-Optic Sensor Network for the On-Site Calibration and Real-Time Performance Monitoring of Large-Scale Phased Arrays...
Genetikken bag Gilles de laTourettes syndrom
DEFF Research Database (Denmark)
Bertelsen, Birgitte; Melchior, L.; Debes, Nanette Mol
2012-01-01
Knowledge about the aetiology of Gilles de la Tourette syndrome (GTS) is very limited. GTS has a complex mode of inheritance in which both genetic and environmental factors are believed to be involved in disease development. Different approaches to identify GTS associated genes have led to the di......Knowledge about the aetiology of Gilles de la Tourette syndrome (GTS) is very limited. GTS has a complex mode of inheritance in which both genetic and environmental factors are believed to be involved in disease development. Different approaches to identify GTS associated genes have led...
International Nuclear Information System (INIS)
Druba, V.V.; Druba, T.A.; Reznik, V.R.
1989-01-01
Determination of time dependence of phase difference of residual voltage on motor windings of the main circulation pumps (MCP) and voltage of power supply section under MCP self-starting under conditions of short-time breaks in electric power supply is one of the main problems to which reliability and safety of NPP operation is related. A method to measure this dependence in real conditions in case of MCP free run-out and run-out in generating mode is suggested. The method considered is used for tests of the Kalinin NPP-2 MCP-195M self-starting. Analysis of run-out curves in the case of a break in MCP power supply for 1.8 s shows that the most favourable conditions for MCP self-starting are 0.63±0.03 s after de-energizing. 2 refs.; 3 figs.; 1 tab
Basheer, Chanbasha
2018-04-01
An efficient on-site extraction technique to determine carcinogenic heterocyclic aromatic amines in seawater has been reported. A micro-solid-phase extraction device placed inside a portable battery-operated pump was used for the on-site extraction of seawater samples. Before on-site applications, parameters that influence the extraction efficiency (extraction time, type of sorbent materials, suitable desorption solvent, desorption time, and sample volume) were investigated and optimized in the laboratory. The developed method was then used for the on-site sampling of heterocyclic aromatic amines determination in seawater samples close to distillation plant. Once the on-site extraction completed, the small extraction device with the analytes was brought back to the laboratory for analysis using high-performance liquid chromatography with fluorescence detection. Based on the optimized conditions, the calibration curves were linear over the concentration range of 0.05-20 μg/L with correlation coefficients up to 0.996. The limits of detection were 0.004-0.026 μg/L, and the reproducibility values were between 1.3 and 7.5%. To evaluate the extraction efficiency, a comparison was made with conventional solid-phase extraction and it was applied to various fortified real seawater samples. The average relative recoveries obtained from the spiked seawater samples varied in the range 79.9-95.2%. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Grimsel and planning of the nuclear waste management in Switzerland
International Nuclear Information System (INIS)
Kallio, H.
1997-01-01
NAGRA (Nationale Genossenschaft fuer die Lagerung Radioaktiver Abfaelle) was founded 25 years ago as a responsible for all preparatory work associated with the safe disposal of radioactive waste in Switzerland. Extensive international R and D work has been carried out during the past 14 years at the GRIMSEL test site (GTS), one of the two underground rock laboratories headed by NAGRA. GTS is located approximately 450 meters beneath the crystalline rock in the Alps in the southern Central Switzerland. The rock lab is open for visitors not only to get acquainted with the research technology but also to admire the 16 million year old crystal cave at the place (author)
Directory of Open Access Journals (Sweden)
Shanmukha Sampath Padmanabhuni
2016-11-01
Full Text Available Gilles de la Tourette syndrome (GTS is a neuropsychiatric disorder characterized by multiple motor and vocal tics. GTS is a complex disorder, with environmental factors and several genes involved. Although variations within a few genes such as AADAC, NRXN1, SLITRK1, HDC, and IMMP2L have been tentatively associated with GTS (in a small number of patients, the causative genes underlying GTS pathophysiology remain unknown. In a previous genome-wide association study (GWAS a single nucleotide polymorphism (SNP, rs2060546 near the Netrin-4 (NTN4 - MIM 610401 gene was shown to be associated with GTS [odds ratio (OR = 1.7; p-value = 5.8x10-7] thus warranting further investigations. As NTN4 is one of the axon guidance molecules expressed in the central nervous system and it interacts with encoded protein of SLIT and WNT genes guiding the growth cone towards its target, it is an attractive candidate susceptibility gene for GTS. In this study we attempted to replicate the association of rs2060546 with GTS by genotyping a cohort of 240 Danish GTS patients and 1007 healthy controls. Our results did not reveal an association (OR= 1.363; p-value = 0.3329 in the Danish cohort alone, which may be due to the small sample size. However, a meta-analysis including the present cohort and a total of 1316 GTS patients and 5023 controls from GTS GWAS Replication Initiative (GGRI and the first GTS-GWAS yielded a significant signal (OR = 3.74; p-value = 0.00018 and same direction of effect in the three cohorts. Thus, our study strengthens the evidence of the possible involvement of NTN4 in GTS etiology, suggesting that further studies in even larger samples and functional studies are warranted to investigate the role of this region in GTS pathogenesis.
Superfund and Toxic Release Inventory Sites - MDC_ContaminatedSite
NSGIC Local Govt | GIS Inventory — A point feature class of open DERM Contaminated sites - see phase code for status of site. Contaminated sites identifies properties where environmental contamination...
International Nuclear Information System (INIS)
Riedi, J.; Goloub, P.; Marchand, Roger T.
2001-01-01
In our present study, cloud boundaries derived from a combination of active remote sensors at the ARM SGP site are compared to POLDER cloud top phase index which is derived from polarimetric measurements using an innovative method. This approach shows the viability of the POLDER phase retrieval algorithm, and also leads to interesting results. In particular, the analysis demonstrates the sensitivity of polarization measurements to ice crystal shape and indicates that occurrence of polycrystalline ice clouds has to be taken into account in order to improve the POLDER phase retrieval algorithm accuracy. Secondly, the results show that a temperature threshold of 240 K could serve for cloud top particle phase classification. Considering the limitations of the analysis, the temperature threshold could be biased high, but not by more than about 5 degrees
International Nuclear Information System (INIS)
Kim, Sang Eun; Shim, In Sop; Chung, June Key; Lee, Myung Chul
2002-01-01
We investigated the effect of ginseng total saponin (GTS) on nicotine-induced dopamine (DA) release in the striatum and nucleus accumbens of freely moving rats using in vivo microdialysis technique. Systemic pretreatment with GTS decreased striatal DA release induced by local infusion of nicotine into the striatum. However, GTS had no effect on the resting levels of extracellular DA in the striatum. GTS also blocked nicotine-induced DA release in the nucleus accumbens. The results of the present study suggest that GTS acts on the DA terminals to prevent DA release induced by nicotine. This may reflect the blocking effect of GTS on behavioral hyperactivity induced by psychostimulants
Energy Technology Data Exchange (ETDEWEB)
Kim, Sang Eun [Sungkyunkwan University School of Medicine, Seoul (Korea, Republic of); Shim, In Sop [Kyunghee University, Seoul (Korea, Republic of); Chung, June Key; Lee, Myung Chul [Seoul National University College of Medicine, Seoul (Korea, Republic of)
2002-10-01
We investigated the effect of ginseng total saponin (GTS) on nicotine-induced dopamine (DA) release in the striatum and nucleus accumbens of freely moving rats using in vivo microdialysis technique. Systemic pretreatment with GTS decreased striatal DA release induced by local infusion of nicotine into the striatum. However, GTS had no effect on the resting levels of extracellular DA in the striatum. GTS also blocked nicotine-induced DA release in the nucleus accumbens. The results of the present study suggest that GTS acts on the DA terminals to prevent DA release induced by nicotine. This may reflect the blocking effect of GTS on behavioral hyperactivity induced by psychostimulants.
International Nuclear Information System (INIS)
Shim, Jai-Joon; Lee, Jeong Won; Jeon, Min Hyok; Lee, Sang Mi
2016-01-01
We report a case of a 31-year-old man who showed recurrently elevated level of the serum inflammatory marker C-reactive protein (CRP) after spinal operation. He underwent 18 F-flurodeoxyglucose ( 18 F-FDG) positron emission tomography/computed tomography (PET/CT) and dual 18 F-sodium-fluoride ( 18 F-NaF) PET/CT with an additional early-phase scan to find a hidden inflammation focus. Only mildly increased 18 F-FDG was found at the surgical site of T11 spine on 18 F-FDG PET/CT. In contrast, dual 18 F-NaF bone PET/CT with early-phase scan demonstrated focal active inflammation at the surgical site of T11 spine. After a revision operation of the T11 spine, serum CRP level decreased to the normal range without any symptom or sign of inflammation. Inflammatory focus in the surgical site of the spine can be detected with using dual 18 F-NaF bone PET/CT scan with early-phase scan. (orig.)
Directory of Open Access Journals (Sweden)
Anatoli Y Kabakov
Full Text Available Glutamate is the major excitatory neurotransmitter, but prolonged exposure even at micromolar concentrations causes neuronal death. Extracellular glutamate is maintained at nanomolar level by glutamate transporters, which, however, may reverse transport and release glutamate. If and when the reverse occurs depends on glutamate transport stoichiometry (GTS. Previously we found that in the presence of chloride, the coupled GLT-1 glutamate transporter current and its relationship to radiolabeled glutamate flux significantly decreased when extracellular glutamate concentration increased above 0.2 mM, which implies a change in GTS. Such high concentrations are feasible near GLT-1 expressed close to synaptic release site during excitatory neurotransmission. The aim of this study was to determine GLT-1 GTS at both low (19-75 μM and high (300-1200 μM glutamate concentration ranges. GTS experiments were conducted in the absence of chloride to avoid contributions by the GLT-1 uncoupled chloride conductance. Mathematical analysis of the transporter thermodynamic equilibrium allowed us to derive equations revealing the number of a particular type of ion transported per elementary charge based on the measurements of the transporter reversal potential. We found that GLT-1a expressed in COS-7 cells co-transports 1.5 Na+, 0.5 Glu-, 0.5 H+ and counter-transports 0.6 K+ per elementary charge in both glutamate concentration ranges, and at both 37°C and 26°C temperatures. The thermodynamic parameter Q10 = 2.4 for GLT-1 turnover rate of 19 s-1 (37°C, -50 mV remained constant in the 10 μM-10 mM glutamate concentration range. Importantly, the previously reported decrease in the current/flux ratio at high glutamate concentration was not seen in the absence of chloride in both COS-7 cells and cultured rat neurons. Therefore, only in the absence of chloride, GLT-1 GTS remains constant at all glutamate concentrations. Possible explanations for why apparent GTS might
Seo, Jeong-Ju; Lee, Jae-Woong; Lee, Wan-Kyu; Hong, Jin-Tae; Lee, Chong-Kil; Lee, Myung-Koo; Oh, Ki-Wan
2008-02-01
We have reported that ginseng total saponin (GTS) inhibited the development of physical and psychological dependence on morphine. However, the possible molecular mechanisms of GTS are unclear. Therefore, this study was undertaken to understand the possible molecular mechanism of GTS on the inhibitory effects of morphine-induced dependence. It has been reported that the up-regulated cAMP pathway in the LC of the mouse brain after repeated administration of morphine contributes to the feature of withdrawals. GTS inhibited up-regulation of cAMP pathway in the LC after repeated administration of morphine in this experiment. GTS inhibited cAMP levels and protein expression of protein kinase A (PKA). In addition, GTS inhibited the increase of cAMP response element binding protein (CREB) phosphorylation. Therefore, we conclude that the inhibitory effects of GTS on morphine-induced dependence might be mediated by the inhibition of cAMP pathway.
Rizzo, Renata; Gulisano, Mariangela; Martino, Davide; Robertson, Mary May
2017-04-01
Gilles de la Tourette syndrome (GTS) and depression are both common disorders. It has been suggested that depression occurs in 13%-76% GTS patients. Despite this, there are few studies into the specific relationships and correlates between the two disorders. There is only some consensus as to the precise relationship between the two disorders. We undertook the study to investigate the relationship between depressive symptomatology and the core clinical features of GTS in a well-characterized clinical population of youth with this disorder. Our aim was to verify the association between depression and comorbid obsessive-compulsive disorder and explore further other potential associations highlighted in some, but not all, of the studies focused on this topic. Our results demonstrated that (1) the GTS patients were significantly older than the controls, (2) the GTS patients were significantly more depressed than controls, (3) depression was associated with tic severity, (4) the Diagnostic Confidence Index scores were higher in GTS patients without depression, (5) anxiety, attention-deficit/hyperactivity disorder (ADHD), conduct disorder (CD), and behavioral problems were significantly associated with depression, and (6) finally, patients with GTS and depression have a positive family history of depression. However, obsessionality (CY-BOCS) did not differentiate between depressed and not depressed GTS patients. Depression is common in patients with GTS and occurs significantly more in GTS than in controls. Depression is significantly associated with GTS factors such as tic severity, comorbidity with ADHD, and the presence of coexistent anxiety, CDs, and behavior problems. Depression is importantly significantly associated with a positive family history of depression. Intriguingly, depression in our sample was not related to obsessionality.
Directory of Open Access Journals (Sweden)
Natalie J Forde
2016-08-01
Full Text Available Gilles de la Tourette Syndrome (GTS is characterised by the presence of multiple motor and phonic tics with a fluctuating course of intensity, frequency and severity. Up to 90% of patients with GTS present with comorbid conditions, most commonly attention-deficit/hyperactivity disorder (ADHD and obsessive-compulsive disorder (OCD, thus providing an excellent model for the exploration of shared aetiology across disorders. TS-EUROTRAIN (FP7-PEOPLE-2012-ITN, Grant Agr.No.316978 is a Marie Curie Initial Training Network (http://ts-eurotrain.eu that aims to elucidate the complex aetiology of the onset and clinical course of GTS, investigate the neurobiological underpinnings of GTS and related disorders, translate research findings into clinical applications and establish a pan-European infrastructure for the study of GTS. This includes the challenges of (i assembling a large genetic database for the evaluation of the genetic architecture with high statistical power; (ii exploring the role of gene-environment interactions including the effects of epigenetic phenomena; (iii employing endophenotype-based approaches to understand the shared aetiology between GTS, OCD and ADHD; (iv establishing a developmental animal model for GTS; (v gaining new insights into the neurobiological mechanisms of GTS via cross-sectional and longitudinal neuroimaging studies; and (vi partaking in outreach activities including the dissemination of scientific knowledge about GTS to the public. Fifteen partners from academia and industry and twelve PhD candidates pursue the project. Our ultimate aims are to elucidate the complex aetiology and neurobiological underpinnings of GTS, translate research findings into clinical applications and establish Pan-European infrastructure for the study of GTS and associated disorders.
Status of initial phase of site-specific seismic monitoring: Basalt Waste Isolation Project
International Nuclear Information System (INIS)
Rohay, A.C.
1981-01-01
This report presents the status of the initial phase of site-specific seismic monitoring work conducted under the Basalt Waste Isolation Project. This work is currently organized under two main elements: (1) a portable array; and (2) a baseline data collection array. Progress toward the development of each array is discussed along with an interpretation of preliminary data obtained from the test of a borehole seismometer at potential repository depths. The text is supplemented by nine figures and one table. 9 figs., 1 tab
The SITE Program funded a field demonstration to evaluate the Eco Logic Gas-Phase Chemical Reduction Process developed by ELI Eco Logic International Inc. (ELI), Ontario, Canada. The Demonstration took place at the Middleground Landfill in Bay City, Michigan using landfill wa...
Energy Technology Data Exchange (ETDEWEB)
Genty, A.; Certes, C.; Serres, C.; Besnus, F. [Institut de Radioprotection et de Surete Nucleaire IRSN, 92 - Fontenay aux Roses (France); Fischer-Appelt, K.; Baltes, B.; Rohlig, J. [Gesellschaft fuer Anlagen- und Reaktorsicherheit mbH (GRS), Koeln (Germany)
2003-01-01
This paper presents the safety assessment exercise 'REGIME' (Repository Evaluation performed by GRS and IRSN through a Modelling Exercise) performed jointly by GRS and IRSN. The main objective of the project is to test the ability of integrated modelling to contribute to site selection and repository conception in the context of high-level radioactive waste disposal. The project is divided in two parts. Phase 1 consisted in studying different flow patterns in a given geological context. The selected hydrogeological contexts and three site locations potentially favourable for hosting a repository are described. Phase 2, under progress, aims at evaluating the rote of limitation of releases played by the different components of the disposal system taking into account possible dysfunctions. The main issues to be addressed in phase 2, the modelling outline and the scenarios to be studied are presented. (authors)
International Nuclear Information System (INIS)
1977-11-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Gunnison, Colorado. The Phase II - Title I services include the preparation of topographic measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology, and the evaluation and costing of alternative corrective actions. Radon gas release from the 0.5 million tons of tailings at the Gunnison site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The nine alternative actions presented range from millsite decontamination (Option I), to adding various depths of stabilization cover material (Options II and III), to removal of the tailings to long-term storage sites and decontamination of the present site (Options IV through IX). Cost estimates for the nine options range from $480,000 to $5,890,000. Reprocessing the tailings for uranium does not appear to be economically attractive at present
Yu, Elmer; Miotto, Karen; Akerele, Evaristo; Montgomery, Ann; Elkashef, Ahmed; Walsh, Robert; Montoya, Ivan; Fischman, Marian W.; Collins, Joseph; McSherry, Frances; Boardman, Kathy; Davies, David K.; O’Brien, Charles P.; Ling, Walter; Kleber, Herbert; Herman, Barbara H.
2008-01-01
Context Lofexidine is an alpha-2-A noradrenergic receptor agonist that is approved in the United Kingdom for the treatment of opioid withdrawal symptoms. Lofexidine has been reported to have more significant effects on decreasing opioid withdrawal symptoms with less hypotension than clonidine. Objective To demonstrate that lofexidine is well tolerated and effective in the alleviation of observationally-defined opioid withdrawal symptoms in opioid dependent individuals undergoing medically supervised opioid detoxification as compared to placebo. Design An inpatient, Phase 3, placebo-controlled, double blind, randomized multi-site trial with three phases: (1) Opioid Agonist Stabilization Phase (days 1–3), (2) Detoxification/Medication or Placebo Phase (days 4–8), and (3) Post Detoxification/Medication Phase (days 9–11). Subjects Sixty-eight opioid dependent subjects were enrolled at three sites with 35 randomized to lofexidine and 33 to placebo. Main Outcome Measure Modified Himmelsbach Opiate Withdrawal Scale (MHOWS) on study day 5 (2nd opioid detoxification treatment day). Results Due to significant findings, the study was terminated early. On the study day 5 MHOWS, subjects treated with lofexidine had significantly lower scores (equating to fewer/less severe withdrawal symptoms) than placebo subjects (Least squares means 19.5 ± 2.1 versus 30.9 ± 2.7; p=0.0019). Lofexidine subjects had significantly better retention in treatment than placebo subjects (38.2% versus 15.2%; Log rank test p=0.01). Conclusions Lofexidine is well tolerated and more efficacious than placebo for reducing opioid withdrawal symptoms in inpatients undergoing medically supervised opioid detoxification. Trial Registration trial registry name A Phase 3 Placebo-Controlled, Double-Blind Multi-Site Trial of Lofexidine for Opiate Withdrawal, registration number NCT00032942, URL for the registry http://clinicaltrials.gov/ct/show/NCT00032942?order=4. PMID:18508207
Energy Technology Data Exchange (ETDEWEB)
Yamamoto, Kohji, E-mail: yamamok@agr.kyushu-u.ac.jp [Faculty of Agriculture, Kyushu University Graduate School, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Suzuki, Mamoru; Higashiura, Akifumi [Institute for Protein Research, Osaka University, Suita 565-0871 (Japan); Aritake, Kosuke; Urade, Yoshihiro; Uodome, Nobuko [Department of Molecular Behavioral Biology, Osaka Bioscience Institute, 6-2-4 Furuedai, Suita, Osaka 565-0874 (Japan); Hossain, MD. Tofazzal [Faculty of Agriculture, Kyushu University Graduate School, 6-10-1 Hakozaki, Higashi-ku, Fukuoka 812-8581 (Japan); Nakagawa, Atsushi [Institute for Protein Research, Osaka University, Suita 565-0871 (Japan)
2013-11-01
Highlights: •Structure of Bombyx mori prostaglandin E synthase is determined. •Bound glutathione sulfonic acid is located at the glutathione-binding site. •Electron-sharing network is present in this protein. •This network includes Asn95, Asp96, and Arg98. •Site-directed mutagenesis reveals that the residues contribute to the catalytic activity. -- Abstract: Prostaglandin E synthase (PGES) catalyzes the isomerization of PGH{sub 2} to PGE{sub 2}. We previously reported the identification and structural characterization of Bombyx mori PGES (bmPGES), which belongs to Sigma-class glutathione transferase. Here, we extend these studies by determining the structure of bmPGES in complex with glutathione sulfonic acid (GTS) at a resolution of 1.37 Å using X-ray crystallography. GTS localized to the glutathione-binding site. We found that electron-sharing network of bmPGES includes Asn95, Asp96, and Arg98. Site-directed mutagenesis of these residues to create mutant forms of bmPGES mutants indicate that they contribute to catalytic activity. These results are, to our knowledge, the first to reveal the presence of an electron-sharing network in bmPGES.
ON-SITE SOLID-PHASE EXTRACTION AND LABORATORY ...
Fragrance materials such as synthetic musks in aqueous samples, are normally determined by gas chromatography/mass spectrometry in the selected ion monitoring (SIM) mode to provide maximum sensitivity after liquid-liquid extraction of I -L samples. Full-scan mass spectra are required to verify that a target analyte has been found by comparison with the mass spectra of fragrance compounds in the NIST mass spectral library. A I -L sample usually provides insufficient analyte for full scan data acquisition. This paper describes an on-site extraction method developed at the U.S. Environmental Protection Agency (USEPA)- Las Vegas Nevada - for synthetic musks from 60 L of wastewater effluent. Such a large sample volume permits high-quality, full-scan mass spectra to be obtained for a wide array of synthetic musks. Quantification of these compounds was achieved from the full-scan data directly, without the need to acquire SIM data. The detection limits obtained with this method are an order of magnitude lower than those obtained from liquid-liquid and other solid phase extraction methods. This method is highly reproducible, and recoveries ranged from 80 to 97% in spiked sewage treatment plant effluent. The high rate of sorbent-sample mass transfer eliminated the need for a methanolic activation step, which reduced extraction time, labor, and solvent use, More samples could be extracted in the field at lower cost. After swnple extraction, the light- weight cartridges ar
Besserve, Michel; Lowe, Scott C; Logothetis, Nikos K; Schölkopf, Bernhard; Panzeri, Stefano
2015-01-01
Distributed neural processing likely entails the capability of networks to reconfigure dynamically the directionality and strength of their functional connections. Yet, the neural mechanisms that may allow such dynamic routing of the information flow are not yet fully understood. We investigated the role of gamma band (50-80 Hz) oscillations in transient modulations of communication among neural populations by using measures of direction-specific causal information transfer. We found that the local phase of gamma-band rhythmic activity exerted a stimulus-modulated and spatially-asymmetric directed effect on the firing rate of spatially separated populations within the primary visual cortex. The relationships between gamma phases at different sites (phase shifts) could be described as a stimulus-modulated gamma-band wave propagating along the spatial directions with the largest information transfer. We observed transient stimulus-related changes in the spatial configuration of phases (compatible with changes in direction of gamma wave propagation) accompanied by a relative increase of the amount of information flowing along the instantaneous direction of the gamma wave. These effects were specific to the gamma-band and suggest that the time-varying relationships between gamma phases at different locations mark, and possibly causally mediate, the dynamic reconfiguration of functional connections.
Sexton, E. A.; Snelson, C. M.; Chipman, V.; Emer, D. F.; White, R. L.; Emmitt, R.; Wright, A. A.; Drellack, S.; Huckins-Gang, H.; Mercadante, J.; Floyd, M.; McGowin, C.; Cothrun, C.; Bonal, N.
2013-12-01
An objective of the Source Physics Experiment (SPE) is to identify low-yield nuclear explosions from a regional distance. Low-yield nuclear explosions can often be difficult to discriminate among the clutter of natural and man-made explosive events (e.g., earthquakes and mine blasts). The SPE is broken into three phases. Phase I has provided the first of the physics-based data to test the empirical models that have been used to discriminate nuclear events. The Phase I series of tests were placed within a highly fractured granite body. The evolution of the project has led to development of Phase II, to be placed within the opposite end member of geology, an alluvium environment, thereby increasing the database of waveforms to build upon in the discrimination models. Both the granite and alluvium sites have hosted nearby nuclear tests, which provide comparisons for the chemical test data. Phase III of the SPE is yet to be determined. For Phase II of the experiment, characterization of the location is required to develop the geologic/geophysical models for the execution of the experiment. Criteria for the location are alluvium thickness of approximately 170 m and a water table below 170 m; minimal fracturing would be ideal. A P-wave mini-vibroseis survey was conducted at a potential site in alluvium to map out the subsurface geology. The seismic reflection profile consisted of 168 geophone stations, spaced 5 m apart. The mini-vibe was a 7,000-lb peak-force source, starting 57.5 m off the north end of the profile and ending 57.5 m past the southern-most geophone. The length of the profile was 835 m. The source points were placed every 5 m, equally spaced between geophones to reduce clipping. The vibroseis sweep was from 20 Hz down to 180 Hz over 8 seconds, and four sweeps were stacked at each shot location. The shot gathers show high signal-to-noise ratios with clear first arrivals across the entire spread and the suggestion of some shallow reflectors. The data were
Downing, J.; Ryan, S. E.
2001-12-01
Ten simultaneous bedload measurements were made with an Elhwa sampler and an acoustic-gravel-transport sensor (GTS) on the Middle Fork of the Piedra River in southwestern Colorado near the end of the spring freshet in water year 2001. The purpose was to compare bedload samples with acoustic measurements acquired under field conditions. Upstream of the measurement site, the river drains 86 km2 of andesite, ash flows, tuffs, and breccias in the San Juan Mountains, contributing a relatively high sediment load to the river system. The channel transitions from step-pools at high elevations to a plane bed with a slope of 0.018 in the study reach. Channel width, mean depth and bank-full velocity at the site are: 13.6 m, 0.52, and 1.5 m s-1. The D50 of the riverbed surface is 0.08 m which is 6 to 40 times larger than the D50s of the bedload samples. D16 and D84 of the bed = 0.02 and 0.21 m respectively. Water discharges from 7.3 to 9.3 m3 s-1 transported about 0.01 kg of gravel m-1 s-1 in the channel. Transport of coarse gravel (8-64 mm) ranged from 0.00063 to 0.024 kg m-1 s-1. The Elwha sampler is a portable, pressure-differential trap with a 0.2 m wide by 0.1 m high opening. The acoustic sensor is a 0.025-m wide by 0.1 m high strip of PVDF piezoelectric film connected to a signal processor and bonded to an aluminum pressure plate. When the plate is struck by stones, the GTS produces signal peaks with areas that are accurate measures of stone momentum. The GTS was calibrated with steels balls dropped on the pressure plate in still water to develop a curve of ball momentum as a function of peak areas. Based on these calibrations, the standard error of the GTS momentum estimates is 0.0017 kg m s-1. Five transects with 30 verticals, each occupied for 60 s, were completed with the sampler and GTS separated by < 1 m. Five additional verticals were occupied for about 1800 s each with the instruments separated by < 0.5 m. The trapped material was sieved and weighed and the water
International Nuclear Information System (INIS)
1977-11-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Naturita, Colorado. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings sufficient to determine areas and volumes of tailings, the performance of radiometric measurements to determine the extent of radium contamination, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology, and the costing of alternative corrective actions. Radon gas release from the 704,000 tons of tailings at the Naturita site constitutes the most significant environmental impact although windblown tailings and external gamma radiation are also factors. Ranchers Exploration and Development Company has been licensed by the State of Colorado to reprocess the tailings at a location 3 mi from the present site where they will be stabilized for long-term storage. The remedial action options include remedial action for structures in Naturita and Nucla (Option I) at an estimated cost of $270,000 and remedial action for structures and open land adjacent to the tailings site (Option II) at an estimated cost of $950,000
Energy Technology Data Exchange (ETDEWEB)
1977-03-31
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Shiprock, New Mexico. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 1.7 million tons of tailings at the Shiprock site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The 11 alternative actions presented range from completion of the present ongoing EPA site decontamination plan (Option I), to stabilizing in-place with varying depths of cover material (Options II-IV), to removal to an isolated long-term disposal site (Options V-XI). All options include remedial action costs for off-site locations where tailings have been placed. Costs estimates for the 11 options range from $540,000 to $12,500,000. Reprocessing the tailings for uranium is not economically feasible.
International Nuclear Information System (INIS)
1977-01-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Shiprock, New Mexico. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 1.7 million tons of tailings at the Shiprock site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The 11 alternative actions presented range from completion of the present ongoing EPA site decontamination plan (Option I), to stabilizing in-place with varying depths of cover material (Options II-IV), to removal to an isolated long-term disposal site (Options V-XI). All options include remedial action costs for off-site locations where tailings have been placed. Costs estimates for the 11 options range from $540,000 to $12,500,000. Reprocessing the tailings for uranium is not economically feasible
Energy Technology Data Exchange (ETDEWEB)
Kober, Florian; Gaus, Irina [Nagra, Wettingen (Switzerland)
2015-07-01
The FEBEX experiment at the Grimsel Test Site (GTS) consists of an in-situ full-scale engineered barrier system (EBS) test for the disposal of high-level waste (HLW). It is performed under natural conditions in crystalline rock in which the canisters are placed horizontally in drifts and are surrounded by a clay barrier constructed of highly compacted bentonite blocks. A partial dismantling and sampling of the EBS was carried out during 2002. Heating of the FEBEX started in 1997 and since then a constant temperature of 100 deg C has been maintained, while the bentonite buffer has been slowly hydrating in a natural way. A total of 632 sensors in the bentonite barrier, the rock mass, the heaters and the service zone record temperature, water saturation, humidity, total pressure, displacement, and water pressure. The hydration pattern is relatively symmetric, with no major differences along the axis. Although the host rock is characterized by heterogeneities with zones of higher permeability, the resaturation process is driven by the suction of the bentonite rather than by the availability of water in the rock, especially in the early phase. After 17 years, the water content in the buffer close to the heater still continues to increase slowly. The hydraulic pore pressures in the buffer and the geosphere have practically stabilized. The total pressure in general continues to increase in most points into the buffer, where in some parts pressures of over 6 MPa are registered. The long monitoring phase and the partial dismantling in 2002 indicate that the EBS has largely performed as expected and the major processes and couplings affecting the buffer saturation during the initial thermal period identified prior to the start of the experiment have been confirmed. A comprehensive report documents and reviews the state of the FEBEX (Lanyon and Gaus, 2013). After 18 years of operation the experiment will be excavated and dismantled in 2015. The main objectives of the FEBEX
Cath, D.C.; Spinhoven, P.; Woerkom, T.C.A.M. van; Wetering, B.J.M. van de; Hoogduin, C.A.L.; Landman, A.D.; Roos, R.A.C.; Rooijmans, H.G.M.
2001-01-01
Stereotyped repetitive behaviors occur in Gilles de la Tourette's Syndrome (GTS) and obsessive-compulsive disorder (OCD). The present study was undertaken to compare the distribution of obsessive-compulsive and Tourette-related impulsive behaviors in GTS with (+) OCD, GTS without (-) OCD, tic-free
Kim, Jeong Eun; Hong, Yong Sang; Lee, Jae-Lyun; Kim, Kyu-Pyo; Park, Seong Joon; Sym, Sun Jin; Shin, Dong Bok; Lee, Jeeyun; Park, Young Suk; Ahn, Jin Seok; Kim, Tae Won
2015-06-01
The granisetron transdermal system (GTS) showed non-inferior efficacy to oral granisetron to control chemotherapy-induced nausea and vomiting (CINV) during multiday chemotherapy. We compared the efficacy and safety of GTS with that of intravenous and oral granisetron in Korean patients receiving moderately emetogenic chemotherapy (MEC). A total of 276 patients were randomized into GTS (n = 139, one patch on days 1-4) or control group (n = 137, intravenous on day 1 and oral on days 2-4). The primary endpoint was the percentage of patients achieving complete response (CR) from chemotherapy initiation until 24 h after the final administration. Out of 234 patients (112 in GTS and 122 in control group) included in the per protocol analysis, 97.9 % had gastrointestinal cancer and 76.9 % received 3-day chemotherapy. The GTS showed non-inferior efficacy achieving CR in 75.0 % of the patients; 74.6 % of the patients in the control group achieved CR (95 % confidence interval -10.73 to 11.55 %). The CR rate did not change after subgroup analyses by sex, age, and chemotherapy naivety and analysis per day and overall days of treatment. The GTS group showed sustained CR from day 1 to day 4. Patients' satisfaction, assessed using Functional Living Index-Emesis (FLI-E), showed no difference. Both treatments were well tolerated and safe. The GTS showed non-inferior efficacy to intravenous and oral granisetron. The safety, tolerability, and FLI-E scores of the GTS were comparable to those of control group. The GTS offers a convenient alternative option for relieving CINV in patients receiving MEC.
Hydrologic modelling of the migration site in the Grimsel rock laboratory -the steady state
International Nuclear Information System (INIS)
Herzog, F.
1989-07-01
Tracer migration experiments are in progress at the Grimsel Test Site (GTS) in order to test radionuclide transport models and to develop appropriate experimental techniques. In order to assist design and to interpret field tracer tests the knowledge of the hydrology of the site is essential. This report describes the hydraulic modelling efforts with the following objectives: 1) to interpret experimental findings. 2) to provide input, such as flowpaths and flow velocities, for transport modelling. 3) to assist in the design of the tracer experiments. The model concept is based upon the observations, that the fracture, where the migration experiments will take place, is relatively planar, has an average aperture of a few millimeters and is filled with a clayish mateial: The migration fracture is modelled as a two-dimensional, isotropic, heterogeneous equivalent porous medium. To allow for a sufficiently detailed model a hierarchical approach was followed where the boundaries for the 'local' model, i.e. the model in the vicinity of the migration site, were taken by first solving a larger 'regional' model with coarser discretization. Transmissivity values as extracted from single borehole tests were used for definition of the heterogeneous transmissivity field in the model calculations. Model results for hydrostatic pressures and discharge rates compare favourably with experimental data, even though some problems remain to be resolved. Calculations for dipole arrangements have been performed; they turned out to be useful tools for deciding on injection- and withdrawal rates to be applied in the migration experiments as well as for qualitatively estimating tracer recovery rates. (author) 20 figs., 10 tabs., 11 refs
DEFF Research Database (Denmark)
Wahedi, Haseebullah
2016-01-01
different practices in the construction phase. The research is based on an ethnographic study of a case in Denmark. The empirical data were collected through direct observations and semi-structured interviews with site managers, contract managers, foremen and craftsmen. Findings revealed...... that the construction phase comprises several communities and practices, leading to various uses of the drawings. The results indicated that the craftsmen used drawings to position themselves in the correct location, and that the site managers and contract managers used them as management tools and legal documents...
Genetikken bag Gilles de laTourettes syndrom
DEFF Research Database (Denmark)
Bertelsen, Birgitte; Melchior, Linea Cecilie; Debes, Nanette Mol
2012-01-01
Knowledge about the aetiology of Gilles de la Tourette syndrome (GTS) is very limited. GTS has a complex mode of inheritance in which both genetic and environmental factors are believed to be involved in disease development. Different approaches to identify GTS associated genes have led...
Piazza, Leonardo A; López, Daniela; Silva, Mariana P; López Rivilli, Marisa J; Tourn, Mónica G; Cantero, Juan J; Scopel, Ana L
2018-03-01
The distribution and ultrastructure of capitate glandular trichomes (GTs) in Flourensia species (Asteraceae) have been recently elucidated, but their metabolic activity and potential biological function remain unexplored. Selective nonvolatile metabolites from isolated GTs were strikingly similar to those found on leaf surfaces. The phytotoxic allelochemical sesquiterpene (-)-hamanasic acid A ((-)-HAA) was the major constituent (ca. 40%) in GTs. Although GTs are quaternary ammonium compounds (QACs)-accumulating species, glycine betaine was not found in GTs; it was only present in the leaf mesophyll. Two (-)-HAA accompanying surface secreted products: compounds 4-hydroxyacetophenone (piceol; 1) and 2-hydroxy-5-methoxyacetophenone (2), which were isolated and fully characterized (GC/MS, NMR), were present in the volatiles found in GTs. The essential oils of fresh leaves revealed ca. 33% monoterpenes, 26% hydrocarbon- and 30% oxygenated sesquiterpenes, most of them related to cadinene and bisabolene derivatives. Present results suggest a main role of GTs in determining the volatile and nonvolatile composition of F. campestris leaves. Based on the known activities of the compounds identified, it can be suggested that GTs in F. campestris would play key ecological functions in plant-pathogen and plant-plant interactions. In addition, the strikingly high contribution of compounds derived from cadinene and bisabolene pathways, highlights the potential of this species as a source of high-valued bioproducts. © 2018 Wiley-VHCA AG, Zurich, Switzerland.
Weiss, Roger D.; Potter, Jennifer Sharpe; Provost, Scott E.; Huang, Zhen; Jacobs, Petra; Hasson, Albert; Lindblad, Robert; Connery, Hilary Smith; Prather, Kristi; Ling, Walter
2010-01-01
The National Institute on Drug Abuse Clinical Trials Network launched the Prescription Opioid Addiction Treatment Study (POATS) in response to rising rates of prescription opioid dependence and gaps in understanding the optimal course of treatment for this population. POATS employed a multi-site, two-phase adaptive, sequential treatment design to approximate clinical practice. The study took place at 10 community treatment programs around the United States. Participants included men and women age ≥18 who met Diagnostic and Statistical Manual, 4th Edition criteria for dependence upon prescription opioids, with physiologic features; those with a prominent history of heroin use (according to pre-specified criteria) were excluded. All participants received buprenorphine/naloxone (bup/nx). Phase 1 consisted of 4 weeks of bup/nx treatment, including a 14-day dose taper, with 8 weeks of follow-up. Phase 1 participants were monitored for treatment response during these 12 weeks. Those who relapsed to opioid use, as defined by pre-specified criteria, were invited to enter Phase 2; Phase 2 consisted of 12 weeks of bup/nx stabilization treatment, followed by a 4-week taper and 8 weeks of post-treatment follow-up. Participants were randomized at the beginning of Phase 1 to receive bup/nx, paired with either Standard Medical Management (SMM) or Enhanced Medical Management (EMM; defined as SMM plus individual drug counseling). Eligible participants entering Phase 2 were re-randomized to either EMM or SMM. POATS was developed to determine what benefit, if any, EMM offers over SMM in short-term and longer-term treatment paradigm. This paper describes the rationale and design of the study. PMID:20116457
Neurofeedback and its possible relevance for the treatment of Tourette syndrome.
Farkas, Aniko; Bluschke, Annet; Roessner, Veit; Beste, Christian
2015-04-01
Neurofeedback is an increasingly recognized therapeutic option in various neuropsychiatric disorders to treat dysfunctions in cognitive control as well as disorder-specific symptoms. In this review we propose that neurofeedback may also reflect a valuable therapeutic option to treat executive control functions in Gilles-de-la-Tourette syndrome (GTS). Deficits in executive control functions when ADHD symptoms appear in GTS likely reflect pathophysiological processes in cortico-thalamic-striatal circuits and may also underlie the motor symptoms in GTS. Such executive control deficits evident in comorbid GTS/ADHD depend on neurophysiological processes well-known to be modifiable by neurofeedback. However, so far efforts to use neurofeedback to treat cognitive dysfunctions are scarce. We outline why neurofeedback should be considered a promising treatment option, what forms of neurofeedback may prove to be most effective and how neurofeedback may be implemented in existing intervention strategies to treat comorbid GTS/ADHD and associated dysfunctions in cognitive control. As cognitive control deficits in GTS mostly appear in comorbid GTS/ADHD, neurofeedback may be most useful in this frequent combination of disorders. Copyright © 2015 Elsevier Ltd. All rights reserved.
Hanford low-level waste process chemistry testing data package
International Nuclear Information System (INIS)
Smith, H.D.; Tracey, E.M.; Darab, J.G.; Smith, P.A.
1996-03-01
Recently, the Tri-Party Agreement (TPA) among the State of Washington Department of Ecology, U.S. Department of Energy (DOE) and the US Environmental Protection Agency (EPA) for the cleanup of the Hanford Site was renegotiated. The revised agreement specifies vitrification as the encapsulation technology for low level waste (LLW). A demonstration, testing, and evaluation program underway at Westinghouse Hanford Company to identify the best overall melter-system technology available for vitrification of Hanford Site LLW to meet the TPA milestones. Phase I is a open-quotes proof of principleclose quotes test to demonstrate that a melter system can process a simulated highly alkaline, high nitrate/nitrite content aqueous LLW feed into a glass product of consistent quality. Seven melter vendors were selected for the Phase I evaluation: joule-heated melters from GTS Duratek, Incorporated (GDI); Envitco, Incorporated (EVI); Penberthy Electomelt, Incorporated (PEI); and Vectra Technologies, Incorporated (VTI); a gas-fired cyclone burner from Babcock ampersand Wilcox (BCW); a plasma torch-fired, cupola furnace from Westinghouse Science and Technology Center (WSTC); and an electric arc furnace with top-entering vertical carbon electrodes from the U.S. Bureau of Mines (USBM)
Imitation in patients with Gilles de la Tourette syndrome--a behavioral study
DEFF Research Database (Denmark)
Jonas, Melanie; Thomalla, Götz; Biermann-Ruben, Katja
2010-01-01
Echophenomena in Gilles de la Tourette syndrome (GTS) may relate to deficient processing of observed biological movements. This would be reflected in altered effects of movement observation on motor responses in these patients. We studied reaction times in 11 unmedicated GTS patients without...... in both groups, provided stimulus presentation and response initiation coincided. Healthy subjects responded faster to compatible biological than nonbiological stimuli. In contrast, GTS patients responded slower to incompatible biological than nonbiological stimuli. Patients' mean reaction time...... in experiment 2 correlated with phonic tic-frequency. Motor facilitation by observing biological movements appears to rely on concomitance of stimuli and responses in GTS patients and healthy individuals. Differing behavioral effects of movement observation in GTS might reflect altered activation of an action...
Drury, Anna Joy; Westerhold, Thomas; Frederichs, Thomas; Tian, Jun; Wilkens, Roy; Channell, James E. T.; Evans, Helen; John, Cédric M.; Lyle, Mitch; Röhl, Ursula
2017-10-01
Accurate age control of the late Tortonian to early Messinian (8.3-6.0 Ma) is essential to ascertain the origin of benthic foraminiferal δ18O trends and the late Miocene carbon isotope shift (LMCIS), and to examine temporal relationships between the deep-sea, terrasphere and cryosphere. The current Tortonian-Messinian Geological Time Scale (GTS2012) is based on astronomically calibrated Mediterranean sections; however, no comparable non-Mediterranean stratigraphies exist for 8-6 Ma suitable for testing the GTS2012. Here, we present the first high-resolution, astronomically tuned benthic stable isotope stratigraphy (1.5 kyr resolution) and magnetostratigraphy from a single deep-sea location (IODP Site U1337, equatorial Pacific Ocean), which provides unprecedented insight into climate evolution from 8.3-6.0 Ma. The astronomically calibrated magnetostratigraphy provides robust ages, which differ by 2-50 kyr relative to the GTS2012 for polarity Chrons C3An.1n to C4r.1r, and eliminates the exceptionally high South Atlantic spreading rates based on the GTS2012 during Chron C3Bn. We show that the LMCIS was globally synchronous within 2 kyr, and provide astronomically calibrated ages anchored to the GPTS for its onset (7.537 Ma; 50% from base Chron C4n.1n) and termination (6.727 Ma; 11% from base Chron C3An.2n), confirming that the terrestrial C3:C4 shift could not have driven the LMCIS. The benthic records show that the transition into the 41-kyr world, when obliquity strongly influenced climate variability, already occurred at 7.7 Ma and further strengthened at 6.4 Ma. Previously unseen, distinctive, asymmetric saw-tooth patterns in benthic δ18O imply that high-latitude forcing played an important role in late Miocene climate dynamics from 7.7-6.9 Ma. This new integrated deep-sea stratigraphy from Site U1337 can act as a new stable isotope and magnetic polarity reference section for the 8.3-6.0 Ma interval.
Maike Achterberg, Inke Elisabeth; Eckstein, Jan; Birkholz, Bernhard; Bauerochse, Andreas; Leuschner, Hanns Hubert
2018-01-01
The investigated northwest German mire site at Totes Moor is densely covered with subfossil pine stumps (Pinus sylvestris L.) from the fen-bog transition. This facilitates the spatio-temporal reconstruction of mire development, which is based on 212 in situ tree stumps in the case study presented here. Six dendrochronologically dated site chronologies together cover 2345 years between 6703 and 3403 BC. The gaps in between are 6 to 550 years long. Additionally, a floating chronology of 309 years, containing 30 trees, was radiocarbon-dated to the beginning of the 7th millennium cal BC. Peat-stratigraphical survey was carried out additionally, and elevations a.s.l. were determined at several locations. Tree dying-off phases, which indicate water level rise at the site, mostly in context of the local fen-bog transition, are evident for ca. 6600-6450, ca. 6350-5750, ca. 5300-4900, ca. 4700-4550, ca. 3900-3850, ca. 3700-3600, ca. 3500-3450 and ca. 3400 BC. The spatial distribution of the dated in situ trees illustrates the phase-wise expansion of raised bog over fen peat at the site. The documented bog expansion pulses likely correspond to climatic wet sifts.
Trabal, Natalia; Mazón-Suástegui, José M; Vázquez-Juárez, Ricardo; Asencio-Valle, Felipe; Morales-Bojórquez, Enrique; Romero, Jaime
2012-08-01
Microbiota presumably plays an essential role in inhibiting pathogen colonization and in the maintenance of health in oysters, but limited data exist concerning their different growth phases and conditions. We analyzed the bacterial microbiota composition of two commercial oysters: Crassostrea gigas and Crassostrea corteziensis. Differences in microbiota were assayed in three growth phases: post-larvae at the hatchery, juvenile, and adult at two grow-out cultivation sites. Variations in the microbiota were assessed by PCR analysis of the 16S rRNA gene in DNA extracted from depurated oysters. Restriction fragment length polymorphism (RFLP) profiles were studied using Dice's similarity coefficient (Cs) and statistical principal component analysis (PCA). The microbiota composition was determined by sequencing temperature gradient gel electrophoresis (TGGE) bands. The RFLP analysis of post-larvae revealed homology in the microbiota of both oyster species (Cs > 88 %). Dice and PCA analyses of C. corteziensis but not C. gigas showed differences in the microbiota according to the cultivation sites. The sequencing analysis revealed low bacterial diversity (primarily β-Proteobacteria, Firmicutes, and Spirochaetes), with Burkholderia cepacia being the most abundant bacteria in both oyster species. This study provides the first description of the microbiota in C. corteziensis, which was shown to be influenced by cultivation site conditions. During early growth, we observed that B. cepacia colonized and remained strongly associated with the two oysters, probably in a symbiotic host-bacteria relationship. This association was maintained in the three growth phases and was not altered by environmental conditions or the management of the oysters at the grow-out site.
International Nuclear Information System (INIS)
Pons, Y.
2010-01-01
shipped to BNF number 164, named CEDRA on Cadarache site (in operation in 2009). AREVA TA (ATA) is pleased to provide AREVA Federal Services (AFS) a phased plan to provide an Adaptation Design Technical Report and Organization. This approach will facilitate the assessment of the Final design Phase (After September 2010) and funding to support the engineering, procurement, and construction planning leading to the fabrication of a Mobile Hot Cell (MHC). (author)
Energy Technology Data Exchange (ETDEWEB)
None
1977-10-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Grand Junction, Colorado. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 1.9 million tons of tailings at the Grand Junction site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The eight alternative actions presented range from millsite decontamination (Option I), to adding various depths of stabilization cover material (Options II and III), to removal of the tailings to long-term storage sites and decontamination of the present site (Options IV through VIII). Cost estimates for the eight options range from $470,000 to $18,130,000. Reprocessing the tailings for uranium recovery does not appear to be economically attractive at present.
International Nuclear Information System (INIS)
1977-10-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Grand Junction, Colorado. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 1.9 million tons of tailings at the Grand Junction site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The eight alternative actions presented range from millsite decontamination (Option I), to adding various depths of stabilization cover material (Options II and III), to removal of the tailings to long-term storage sites and decontamination of the present site (Options IV through VIII). Cost estimates for the eight options range from $470,000 to $18,130,000. Reprocessing the tailings for uranium recovery does not appear to be economically attractive at present
Zhang, Xiaoqiong; Wang, Peiyi; Han, Qiang; Li, Hengzhen; Wang, Tong; Ding, Mingyu
2018-04-01
In-syringe solid-phase extraction is a promising sample pretreatment method for the on-site sampling of water samples because of its outstanding advantages of portability, simple operation, short extraction time, and low cost. In this work, a novel in-syringe solid-phase extraction device using metal-organic frameworks as the adsorbent was fabricated for the on-site sampling of polycyclic aromatic hydrocarbons from environmental waters. Trace polycyclic aromatic hydrocarbons were effectively extracted through the self-made device followed by gas chromatography with mass spectrometry analysis. Owing to the excellent adsorption performance of metal-organic frameworks, the analytes could be completely adsorbed during one adsorption cycle, thus effectively shortening the extraction time. Moreover, the adsorbed analytes could remain stable on the device for at least 7 days, revealing the potential of the self-made device for on-site sampling of degradable compounds in remote regions. The limit of detection ranged from 0.20 to 1.9 ng/L under the optimum conditions. Satisfactory recoveries varying from 84.4 to 104.5% and relative standard deviations below 9.7% were obtained in real samples analysis. The results of this study promote the application of metal-organic frameworks in sample preparation and demonstrate the great potential of in-syringe solid-phase extraction for the on-site sampling of trace contaminants in environmental waters. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Motor-cortical interaction in Gilles de la Tourette syndrome.
Directory of Open Access Journals (Sweden)
Stephanie Franzkowiak
Full Text Available BACKGROUND: In Gilles de la Tourette syndrome (GTS increased activation of the primary motor cortex (M1 before and during movement execution followed by increased inhibition after movement termination was reported. The present study aimed at investigating, whether this activation pattern is due to altered functional interaction between motor cortical areas. METHODOLOGY/PRINCIPAL FINDINGS: 10 GTS-patients and 10 control subjects performed a self-paced finger movement task while neuromagnetic brain activity was recorded using Magnetoencephalography (MEG. Cerebro-cerebral coherence as a measure of functional interaction was calculated. During movement preparation and execution coherence between contralateral M1 and supplementary motor area (SMA was significantly increased at beta-frequency in GTS-patients. After movement termination no significant differences between groups were evident. CONCLUSIONS/SIGNIFICANCE: The present data suggest that increased M1 activation in GTS-patients might be due to increased functional interaction between SMA and M1 most likely reflecting a pathophysiological marker of GTS. The data extend previous findings of motor-cortical alterations in GTS by showing that local activation changes are associated with alterations of functional networks between premotor and primary motor areas. Interestingly enough, alterations were evident during preparation and execution of voluntary movements, which implies a general theme of increased motor-cortical interaction in GTS.
Directory of Open Access Journals (Sweden)
Makoto Kondo
2014-07-01
Full Text Available Green and black tea by-products, obtained from ready-made tea industry, were ensiled at 10°C, 20°C, and 30°C. Green tea by-product silage (GTS and black tea by-product silage (BTS were opened at 5, 10, 45 days after ensiling. Fermentation characteristics and nutrient composition, including tannins, were monitored and the silages on day 45 were subjected to in vitro ruminal fermentation to assess anti-nutritive effects of tannins using polyethylene glycol (PEG as a tannin-binding agent. Results showed that the GTS and BTS silages were stable and fermented slightly when ensiled at 10°C. The GTS stored at 20°C and 30°C showed rapid pH decline and high acetic acid concentration. The BTS was fermented gradually with moderate change of pH and acid concentration. Acetic acid was the main acid product of fermentation in both GTS and BTS. The contents of total extractable phenolics and total extractable tannins in both silages were unaffected by storage temperatures, but condensed tannins in GTS were less when stored at high temperature. The GTS showed no PEG response on in vitro gas production, and revealed only a small increase by PEG on NH3-N concentration. Storage temperature of GTS did not affect the extent of PEG response to both gas production and NH3-N concentration. On the other hand, addition of PEG on BTS markedly increased both the gas production and NH3-N concentration at any ensiled temperature. It can be concluded that tannins in both GTS and BTS suppressed rumen fermentation, and tannins in GTS did more weakly than that in BTS. Ensiling temperature for both tea by-products did not affect the tannin’s activity in the rumen.
Experimental Evaluation of Actinide Transport in a Fractured Granodiorite
Energy Technology Data Exchange (ETDEWEB)
Dittrich, Timothy M. [Los Alamos National Laboratory; Reimus, Paul W. [Los Alamos National Laboratory
2015-03-16
The objective of this study was to demonstrate and evaluate new experimental methods for quantifying the potential for actinide transport in deep fractured crystalline rock formations. We selected a fractured granodiorite at the Grimsel Test Site (GTS) in Switzerland as a model system because field experiments have already been conducted with uranium and additional field experiments using other actinides are planned at the site. Thus, working on this system provides a unique opportunity to compare lab experiment results with fieldscale observations. Rock cores drilled from the GTS were shipped to Los Alamos National Laboratory, characterized by x-ray diffraction and microscopy, and used in batch sorption and column breakthrough experiments. Solutions with pH 6.8 and 8.8 were tested. Solutions were switched to radionuclide-free synthetic Grimsel groundwater after near-steady actinide/colloid breakthrough occurred in column experiments. We are currently evaluating actinide adsorption/desorption rates as a function of water chemistry (initial focus on pH), with future testing planned to evaluate the influence of carbonate concentrations, flow rates, and mineralogy in solutions and suspensions with bentonite colloids. (auth)
Galvanic Tongue Stimulation Inhibits Five Basic Tastes Induced by Aqueous Electrolyte Solutions
Directory of Open Access Journals (Sweden)
Kazuma Aoyama
2017-12-01
Full Text Available Galvanic tongue stimulation (GTS modulates taste sensation. However, the effect of GTS is contingent on the electrode polarity in the proximity of the tongue. If an anodal electrode is attached in the proximity of the tongue, an electrical or metallic taste is elicited. On the other hand, if only cathodal electrode is attached in the proximity of the tongue, the salty taste, which is induced by electrolyte materials, is inhibited. The mechanism of this taste inhibition is not adequately understood. In this study, we aim to demonstrate that the inhibition is cause by ions, which elicit taste and which migrate from the taste sensors on the tongue by GTS. We verified the inhibitory effect of GTS on all five basic tastes induced by electrolyte materials. This technology is effective for virtual reality systems and interfaces to support dietary restrictions. Our findings demonstrate that cathodal-GTS inhibits all the five basic tastes. The results also support our hypothesis that the effects of cathodal-GTS are caused by migrating tasting ions in the mouth.
Diagnosis of malaria by acridine orange fluorescent microscopy in an endemic area of Venezuela
Directory of Open Access Journals (Sweden)
Irene Bosch
1996-02-01
Full Text Available Fluorescent (acridine orange microscopical examination of capillary centrifuged blood (quantitative buffy coat [QBC®] analysis and Giemsa stained thick blood smears (GTS were compared for diagnosis of malaria in blood specimens from adults living in malaria transmission areas of the States of Bolivar and Amazonas in southeastern and south Venezuela, respectively. Of a total of 198 GTS examined, 95 subjects (48% showed parasitaemia. Among the 95 blood films with a positive GTS, 94 were judged positive by the QBC. However, positive QBC tubes were found in 29 out of 103 blood specimens with a negative GTS. Thus, relative to a GTS standard, the sensitivity and specificity of the QBC-test was 99.2% and 72%, respectively. Young trophozoites of Plasmodium vivax and P. falciparum could not be distinguished with certainty. It is confirmed that the QBC offers many advantages compared with the standard diagnosis of malaria parasites, specifically in the speed of staining and ease of interpretation. However, in places where P. falciparum and P. vivax occur, species and stage differentiation should be confirmed with the GTS.
Prevalence and phenomenology of eye tics in Gilles de la Tourette syndrome.
Martino, Davide; Cavanna, Andrea E; Robertson, Mary M; Orth, Michael
2012-10-01
Eye tics seem to be common in Gilles de la Tourette syndrome (GTS). We analyzed the frequency and clinical characteristics of eye tics in 212 GTS patients. Of the 212 patients, 201 (94.8 %) reported eye tics in their life-time; 166 (78.3 %) reported eye movement tics (rolling eyes up/down, eyes looking sideways, staring), and 194 (91.5 %) eyelid/eyebrow movement tics (frowning, raising eyebrows, blinking or winking). Patients with eye movement tics were younger at age of GTS onset (7.1 ± 4 years) than those without (8.9 ± 6.8; p = 0.024). Tic severity positively correlated to lifetime history of eye and/or eyelid/eyebrow movement tics. Our data confirm that eye and eyelid/eyebrow movement tics are very common in GTS, and most patients have several types of eye tics over time. Eye tic phenomenology was similar in patients with or without co-morbidity. Eye tics are therefore likely to be a core feature of GTS and should be routinely evaluated in order to strengthen the clinician's confidence in diagnosing GTS.
Novel phase transitions in B-site doped manganites
International Nuclear Information System (INIS)
Popovic, Z.V.; Cantarero, A.; Thijssen, W.H.A.; Paunovic, N.; Dohcevic-Mitrovic, Z.; Sapina, F.
2005-01-01
We have examined the infrared reflectivity and the electrical resistivity of La 1- x [Sr(Ba)] x Mn 1- z [Cu(Zn)] z O 3 samples in ferromagnetic metallic and insulator regime. Several phase transitions are observed, the most obvious being the transition from a ferromagnetic metallic to a ferromagnetic insulator phase that is related to the formation of short-range orbitally ordered domains. The temperature T 1 of the phase transition is dependent on doping concentration and for optimally doped samples (∼32% of Mn 4+ ions) we have found T 1 ∼0.93 T C
Energy Technology Data Exchange (ETDEWEB)
Ghiani, Gianpaolo, E-mail: gianpaolo.ghiani@unisalento.it; Manni, Andrea, E-mail: andrea.manni@unisalento.it; Manni, Emanuele, E-mail: emanuele.manni@unisalento.it; Toraldo, Massimiliano, E-mail: massimiliano.toraldo@unisalento.it
2014-11-15
Highlights: • We study the problems of locating collection areas and zoning the service territory in a municipal waste management system. • We investigate the impact that an efficient collection sites location has on the subsequent zoning phase. • On a real-world test case, we show that the proposed approach could allow achieving significant monetary savings. - Abstract: In this paper, we study two decisional problems arising when planning the collection of solid waste, namely the location of collection sites (together with bin allocation) and the zoning of the service territory, and we assess the potential impact that an efficient location has on the subsequent zoning phase. We first propose both an exact and a heuristic approach to locate the unsorted waste collection bins in a residential town, and to decide the capacities and characteristics of the bins to be located at each collection site. A peculiar aspect we consider is that of taking into account the compatibility between the different types of bins when allocating them to collection areas. Moreover, we propose a fast and effective heuristic approach to identify homogeneous zones that can be served by a single collection vehicle. Computational results on data related to a real-life instance show that an efficient location is fundamental in achieving consistent monetary savings, as well as a reduced environmental impact. These reductions are the result of one vehicle less needed to perform the waste collection operations, and an overall traveled distance reduced by about 25% on the average.
Trials of Pharmacological Interventions for Tourette Syndrome: A Systematic Review
Directory of Open Access Journals (Sweden)
Karen Waldon
2013-01-01
Full Text Available Introduction: Gilles de la Tourette Syndrome (GTS is a childhood-onset hyperkinetic movement disorder defined by the chronic presence of multiple motor tics and at least one vocal tic and often complicated by co-morbid behavioural problems. The pharmacological treatment of GTS focuses on the modulation of monoaminergic pathways within the cortico-striato-thalamo-cortical circuitry. This paper aims to evaluate the efficacy and safety profiles of pharmacological agents used in the treatment of tics in patients with GTS, in order to provide clinicians with an evidence-based rationale for the pharmacological treatment in GTS.
Energy Technology Data Exchange (ETDEWEB)
Wilson, C.N., Westinghouse Hanford
1996-06-27
Following negotiation of the fourth amendment to the Tri- Party Agreement for Hanford Site cleanup, commercially available melter technologies were tested during 1994 and 1995 for vitrification of the low-level waste (LLW) stream to be derived from retrieval and pretreatment of the radioactive defense wastes stored in 177 underground tanks. Seven vendors were selected for Phase 1 testing to demonstrate vitrification of a high-sodium content liquid LLW simulant. The tested melter technologies included four Joule-heated melters, a carbon electrode melter, a combustion melter, and a plasma melter. Various dry and slurry melter feed preparation processes also were tested. The technologies and Phase 1 testing results were evaluated and a preliminary technology down-selection completed. This report describes the Phase 1 LLW melter vendor testing and the tested technologies, and summarizes the testing results and the preliminary technology recommendations.
Novel phase transitions in B-site doped manganites
Energy Technology Data Exchange (ETDEWEB)
Popovic, Z.V. [Institute of Physics, P.O. Box 68, 11080 Belgrade/Zemun (Serbia and Montenegro)]. E-mail: zoran.popovic@phy.bg.ac.yu; Cantarero, A. [Materials Science Institute, University of Valencia, P.O. Box 22085, 46071 Valencia (Spain); Thijssen, W.H.A. [Kamerlingh Onnes Laboratorium, Leiden University, Postbus 9504, 2300 RA Leiden (Netherlands); Paunovic, N. [Institute of Physics, P.O. Box 68, 11080 Belgrade/Zemun (Serbia and Montenegro); Dohcevic-Mitrovic, Z. [Institute of Physics, P.O. Box 68, 11080 Belgrade/Zemun (Serbia and Montenegro); Sapina, F. [Materials Science Institute, University of Valencia, P.O. Box 22085, 46071 Valencia (Spain)
2005-04-30
We have examined the infrared reflectivity and the electrical resistivity of La{sub 1-} {sub x} [Sr(Ba)] {sub x} Mn{sub 1-} {sub z} [Cu(Zn)] {sub z} O{sub 3} samples in ferromagnetic metallic and insulator regime. Several phase transitions are observed, the most obvious being the transition from a ferromagnetic metallic to a ferromagnetic insulator phase that is related to the formation of short-range orbitally ordered domains. The temperature T {sub 1} of the phase transition is dependent on doping concentration and for optimally doped samples ({approx}32% of Mn{sup 4+} ions) we have found T {sub 1}{approx}0.93 T {sub C}.
Mallik, Abul K; Qiu, Hongdeng; Kuwahara, Yutaka; Takafuji, Makoto; Ihara, Hirotaka
2015-09-28
A double β-alanylated L-glutamide-derived organic phase has been newly designed and synthesized in such a way that integrated H-bonding (interaction) sites make it very suitable for the separation of versatile analytes, including shape-constrained isomers, and nonpolar, polar and basic compounds. The β-alanine residues introduced into two long-chain alkyl group moieties provide ordered polar groups through H-bonding among the amide groups.
Atmospheric muons in the NEMO Phase 1 detector at the Catania test site
International Nuclear Information System (INIS)
Margiotta, Annarita
2006-01-01
The NEMO Collaboration is involved in a long term R and D activity towards the construction of a km 3 telescope in the Mediterranean sea. It has dedicated special efforts in the development of technologies for a km 3 detector and in the search, characterization and monitoring of a deep sea site adequate for the installation of the Mediterranean km 3 . Now the NEMO Collaboration is involved in the Phase 1 of the project, planning to install a fully equipped deep-sea facility to test prototypes and develop new technologies for the detector. A full Monte Carlo simulation has been performed to analyse the response of a reduced-size detector to the passage of atmospheric muons. Preliminary steps of the simulation are presented in this work
Closure of the condensed-phase organic-nitrate reaction unreviewed safety question at Hanford site
International Nuclear Information System (INIS)
COWLEY, W.L.
1999-01-01
A discovery Unreviewed Safety Question (USQ) was declared on the underground waste storage tanks at the Hanford Site in May 1996. The USQ was for condensed-phase organic-nitrate reactions (sometimes called organic complexant reactions) in the tanks. This paper outlines the steps taken to close the USQ, and resolve the related safety issue. Several processes were used at the Hanford Site to extract and/or process plutonium. These processes resulted in organic complexants (for chelating multivalent cations) and organic extraction solvents being sent to the underground waste storage tanks. This paper addresses the organic complexant hazard. The organic complexants are in waste matrices that include inert material, diluents, and potential oxidizers. In the presence of oxidizing material, the complexant salts can be made to react exothermically by heating to high temperatures or by applying an external ignition source of sufficient energy. The first organic complexant hazard assessments focused on determining whether a hulk runaway reaction could occur, similar to the 1957 accident at Kyshtm (a reprocessing plant in the former U.S.S.R.). Early analyses (1977 through 1994) examined organic-nitrate reaction onset temperatures and concluded that a bulk runaway reaction could not occur at the Hanford Site because tank temperatures were well below that necessary for bulk runaway. Therefore, it was believed that organic-nitrate reactions were adequately described in the then current Authorization Basis (AB). Subsequent studies examined a different accident scenario, propagation resulting from an external ignition source (e.g., lightning or welding slag) that initiates a combustion front that propagates through the organic waste. A USQ evaluation determined that localized high energy ignition sources were credible, and that point source ignition of organic complexant waste was not adequately addressed i n the then existing AB. Consequently, the USQ was declared on the
Terrace Geochemistry at the Shiprock, New Mexico, Disposal Site - WM2017-17232 Initial Phase
Energy Technology Data Exchange (ETDEWEB)
Kautsky, Mark [USDOE Office of Legacy Management, Washington, DC (United States); Ranalli, Tony [Navarro Research and Engineering, Oak Ridge, TN (United States); Dander, David [Navarro Research and Engineering, Oak Ridge, TN (United States); Miller, David [Navarro Research and Engineering, Oak Ridge, TN (United States)
2017-03-08
The objective of this investigation was to identify and differentiate potential non- mill-related water inputs to a shallow terrace groundwater system through the use of aqueous chemical and isotopic tracers at a former uranium- and vanadium-ore processing facility. Terrace groundwater in the vicinity of the Shiprock, New Mexico, site is hypothesized to be largely anthropogenic because natural rates of recharge in the terrace are likely insufficient to sustain a continuous water table in the terrace alluvial system, as observed in several analogue terrace locations east of the site and in response to post-mill dewatering efforts across the site. The terrace is composed of alluvial sand and gravel and weathered and unweathered Mancos Shale. Terrace groundwater exists and flows in the alluvium and to a much less extent in the Mancos Shale. Historical data established that in both the terrace and floodplain below the terrace, mill-derived uranium and sulfate is found primarily in the alluvium and the upper portion of the weathered Mancos Shale. Groundwater extraction is being conducted in the vicinity of former mill operations and in washes and seeps to dewater the formation and remove contamination, thus eliminating these exposure pathways and minimizing movement to the floodplain. However, past and present contribution of non-mill anthropogenic water sources may be hindering the dewatering effort, resulting in reduced remedy effectiveness. Groundwater source signatures can be determined based on chemical and isotopic ratios and are used to help identify and delineate both mill and non-mill water contributions. Aqueous chemical and isotopic tracers, such as 234U/238U activity ratios and uranium concentrations, δ34S sulfate and sulfate concentrations, tritium concentrations, and δ2Hwater and δ18O water are being used in this Phase I study. The aqueous chemical and isotopic analysis has identified areas on the terrace where groundwater is derived from mill
International Nuclear Information System (INIS)
1977-11-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Gunnison, Colorado. The Phase II--Title I services include the preparation of topographic measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology, and the evaluation and costing of alternative corrective actions. Radon gas release from the 0.5 million tons of tailings at the Gunnison site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The nine alternative actions presented range from millsite decontamination (Option I), to adding various depths of stabilization cover material (Options II and III), to removal of the tailings to long-term storage sites and decontamination of the present site (Options IV through IX). Cost estimates for the nine options range from $480,000 to $5,890,000. Reprocessing the tailings for uranium does not appear to be economically attractive at present
International Nuclear Information System (INIS)
1977-11-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Durango, Colorado. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 1.555 million tons of tailings at the Durango site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The eight alternative actions presented range from vegetative stabilization (Option I), to contouring and stabilizing in-place with varying depths of cover material (Options II and III), to removal to an isolated long-term disposal site (Options V to VIII). All options include remedial action costs for offsite locations where tailings have been placed. Costs estimated for the eight options range from $4,340,000 to $13,590,000. Reprocessing the tailings for uranium is sufficiently economically attractive to justify reprocessing in conjunction with each of the options
Economic assessment of the general thoracic surgery outpatient service.
Jones, David R; Vaughters, Ann B R; Smith, Philip W; Daniel, Thomas M; Shen, K Robert; Heinzmann, Janet L
2006-09-01
One aspect of the definition of institutional value for any program is based on the return on investment (ROI) for that program. Program requests for future resource allocations depend, in part, on that information. The purpose of this project was to determine the ROI for initial outpatient visits only for our General Thoracic Surgery (GTS) program. The number of GTS outpatient visits, studies, and requested consultations ordered by GTS surgeons only was determined after review of the hospital database and office records for the calendar year 2003. Only charges associated with the initial outpatient visits (no inpatient or physician charges) were included. Charges were based on hospital finance department data. The ROI for GTS outpatient services was calculated using total hospital costs and hospital collections. There were 689 initial outpatient GTS visits. The majority were for lung cancer (48%), benign lung diseases (21%), and esophageal diseases (14%). Total outpatient charges were 1.25M dollars and by disease process were lung cancer (644,000 dollars), benign lung disease (90,000 dollars), esophageal disease (159,000 dollars), and other (357,000 dollars). The most significant hospital charges were the following: radiology (850,000 dollars), laboratory studies (82,000 dollars), gastrointestinal medicine studies (59,000 dollars), and cardiology (42,000 dollars). Total operational costs for the GTS clinic were 415,000 dollars and hospital collections were 513,000 dollars, yielding an ROI of 98,000 dollars or an operating margin of 19%. An operating margin of 19% for GTS outpatient services is better than most Fortune 500 companies. Acquisition of this type of information by GTS surgeons may be helpful for future program development and institutional resource allocation.
Patients with Gilles de la Tourette syndrome have widespread personality differences.
Trillini, Morounke O; Müller-Vahl, Kirsten R
2015-08-30
Only little is known about pathological personality traits in patients with Gilles de la Tourette syndrome (GTS). The aim of this study was to further investigate the prevalence of personality traits in adults with GTS. We used a variety of rating scales to assess not only personality traits, but also severity of tics, quality of life, and comorbidities (obsessive-compulsive disorder (OCD), attention deficit hyperactivity disorder (ADHD), depression), in a large group (n=50) of patients. Our major finding was that pathological personality traits are very common in patients with GTS encompassing a wide range of different personality traits, but most typically personality traits related to cluster C. Demand-anxious was the most common personality trait, while histrionic personality trait was absent. Patients' quality of life was more impaired by personality traits than comorbidities. Personality traits were more common in patients with comorbid OCD and depression, while comorbid ADHD had no influence. Our findings, therefore, corroborate the hypothesis that GTS plus OCD represents a more severe subtype of GTS, and support the assumption that OCD and depression, but not ADHD, are part of the GTS spectrum. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
Glycosyltransferases and non-alcoholic fatty liver disease
Zhan, Yu-Tao; Su, Hai-Ying; An, Wei
2016-01-01
Non-alcoholic fatty liver disease (NAFLD) is the most common form of chronic liver disease and its incidence is increasing worldwide. However, the underlying mechanisms leading to the development of NAFLD are still not fully understood. Glycosyltransferases (GTs) are a diverse class of enzymes involved in catalyzing the transfer of one or multiple sugar residues to a wide range of acceptor molecules. GTs mediate a wide range of functions from structure and storage to signaling, and play a key role in many fundamental biological processes. Therefore, it is anticipated that GTs have a role in the pathogenesis of NAFLD. In this article, we present an overview of the basic information on NAFLD, particularly GTs and glycosylation modification of certain molecules and their association with NAFLD pathogenesis. In addition, the effects and mechanisms of some GTs in the development of NAFLD are summarized. PMID:26937136
McCann, Melinda C; Liu, Keshun; Trujillo, William A; Dobert, Raymond C
2005-06-29
Previous studies have shown that the composition of glyphosate-tolerant soybeans (GTS) and selected processed fractions was substantially equivalent to that of conventional soybeans over a wide range of analytes. This study was designed to determine if the composition of GTS remains substantially equivalent to conventional soybeans over the course of several years and when introduced into multiple genetic backgrounds. Soybean seed samples of both GTS and conventional varieties were harvested during 2000, 2001, and 2002 and analyzed for the levels of proximates, lectin, trypsin inhibitor, and isoflavones. The measured analytes are representative of the basic nutritional and biologically active components in soybeans. Results show a similar range of natural variability for the GTS soybeans as well as conventional soybeans. It was concluded that the composition of commercial GTS over the three years of breeding into multiple varieties remains equivalent to that of conventional soybeans.
Laboratory investigations in support of the migration experiments at the Grimsel test site
International Nuclear Information System (INIS)
Bradbury, M.H.
1989-04-01
Tracer migration experiments are in progress at the underground Grimsel Test Site (GTS). In order to interpret tracer tests a supporting laboratory experimental programme is essential. This report describes the results from the first part of such a programme. Insufficient material from the protomylonite surrounding the fracture was available from the migration site for the foreseen experiments and so mylonite from an adjacent fault zone was used instead. Detailed petrographic and mineralogical characterisations of the protomylonite and mylonite were carried out. The mylonitic samples from these two sources were shown to be mineralogically similar although some potentially significant differences did exist. The promylonite was slightly depleted in those minerals (chlorite, muscovite etc.) which could be significant for sorption/exchange processes. This may have consequences for predictions of the sorption behaviour in the migration zone deduced from laboratory measurements. The fracture zone exhibited groundwater discharge at five discrete channels situated in a single fracture. Groundwater emerging from these five locations, and from two boreholes intersecting the plane of the fracture, were sampled and analysed at approximately monthly intervals over a period of 12 months. The results showed that there were no significant temporal or spatial variations in the compositions. This groundwater may be characterised as being of low ionic strength (∼9.6) with Na + , Ca 2+ , Cl - , SO 4 2- , F - and HCO 3 - as the major ions. The partial pressure of CO 2 calculated to be in equilibrium with the groundwater was ∼4x10 -6 bar. (author) 14 figs., 17 tabs., 31 refs
Energy Technology Data Exchange (ETDEWEB)
Kerkhof, L.; Williams, K.H.; Long, P.E.; McGuinness, L.
2011-02-21
Previous experiments at the Rifle, Colorado Integrated Field Research Challenge (IFRC) site demonstrated that field-scale addition of acetate to groundwater reduced the ambient soluble uranium concentration. In this report, sediment samples collected before and after acetate field addition were used to assess the active microbes via {sup 13}C acetate stable isotope probing on 3 phases [coarse sand, fines (8-approximately 150 {micro}m), groundwater (0.2-8 {micro}m)] over a 24-day time frame. TRFLP results generally indicated a stronger signal in {sup 13}C-DNA in the 'fines' fraction compared to the sand and groundwater. Before the field-scale acetate addition, a Geobacter-like group primarily synthesized {sup 13}C-DNA in the groundwater phase, an alpha Proteobacterium primarily grew on the fines/sands, and an Acinetobacter sp. and Decholoromonas-like OTU utilized much of the {sup 13}C acetate in both groundwater and particle-associated phases. At the termination of the field-scale acetate addition, the Geobacter-like species was active on the solid phases rather than the groundwater, while the other bacterial groups had very reduced newly synthesized DNA signal. These findings will help to delineate the acetate utilization patterns of bacteria in the field and can lead to improved methods for stimulating distinct microbial populations in situ.
Site investigations for final disposal of high-level nuclear waste
International Nuclear Information System (INIS)
Aeikaes, T.; Laine, T.
1982-12-01
Research concerning disposal of high-level nuclear waste of the Industrial Power Company Ltd has focused on deep underground disposal in Finnish precambrian bedrock. The present target is to have a repository for high-level waste in operation by 2020. Selection of the repository site is based on site investigations. In addition to geosciences, selection of appropriate site includes many branches of studies; engineering, safety analysis, ecology, transport, demography etc. The investigations required for site selection for high-level waste have been arranged in a sequence of four phases. The aim of the phases is that investigations become more and more detailed as the selection process continues. Phase I of the investigations is the characterization of potential areas. This comprises establishment of criteria for site selection and identification of areas that meet selection criteria. Objective of these studies is to determine areas for phase II field investigations. The studies are largely made by reviewing existing data and remote-sensing techniques. Phase II field investigations will be undertaken between 1986-1992. The number of potential candidates for repository site is reduced to few preferred areas by preceeding generic study. The site selection process culminates in phase III in site confirmation studies carried out at 2...3 most suitable sites during 1992-2010. This is then followed by phase IV, which comprises very detailed investigations at the selected site. An alternative for these investigations is to undertake them by using pilot shaft and drifts. Active development is taking place in all phases concerning investigation methods, criteria, parameters, data processing and modelling. The applicability of the various investigation methods and techniques is tested in a deep borehole in phase I. The co-operation with countries with similar geological conditions makes it possible to compare results obtained by different techniques
Directory of Open Access Journals (Sweden)
Piotr Janik
Full Text Available Gilles de la Tourette syndrome (GTS is a neurodevelopmental disorder characterized by motor and vocal tics. Hyperactivity of dopaminergic transmission is considered a prime abnormality in the pathophysiology of tics. There are reciprocal antagonistic interactions between adenosine and dopamine transmission. The aim of the study was to analyze the association of two polymorphisms, rs2228079 in ADORA1 and rs5751876 in ADORA2A, with the risk of GTS and co-morbid disorders.A total of 162 Polish GTS patients and 270 healthy persons were enrolled in the study. Two polymorphisms were selected on the basis of knowledge of SNPs frequencies in ADORA1 and ADORA2A. Chi-square test was used for allelic and genotypic association studies. Association of genotypes with age of tic onset was analyzed with Mann-Whitney test. Multivariate logistic regression was used to find independent predictors of GTS risk.We found that the risk of GTS was associated with rs2228079 and rs5751876 polymorphisms. The GG+GT genotypes of rs2228079 in ADORA1 were underrepresented in GTS patients (p = 0.011, whereas T allele of rs5751876 in ADORA2A was overrepresented (p = 0.017. The GG genotype of rs2228079 was associated with earlier age of tic onset (p = 0.046. We found also that the minor allele G of rs2228079 was more frequent in GTS patients with depression as compared to the patients without depression (p = 0.015. Also the genotype GG was significantly more frequent in patients with obsessive compulsive disorder/behavior (OCD/OCB, p = 0.021 and depression (p = 0.032, as compared to the patients without these co-morbidities. The minor allele T frequency of rs5751876 was lower in GTS patients with co-morbid attention deficit hyperactivity disorder (p = 0.022, and TT+TC genotypes were less frequent in the non-OCD anxiety disorder group (p = 0.045.ADORA1 and ADORA2A variants are associated with the risk of GTS, co-morbid disorders, and may affect the age of tic onset.
Nuclear Energy Center study. Phase II. Site suitability analysis. Final report
International Nuclear Information System (INIS)
Fellows, W.S.; Sharp, J.M.; Benator, B.I.
1978-06-01
A site screening study was conducted to identify a site or sites for detailed, site-specific study as a nuclear energy center. Using technical criteria of water requirements, geotechnical constraints, and projected load center and transmission considerations as well as environmental and institutional considerations, five potential study sites in the State of South Carolina were identified, evaluated against established criteria, and ranked according to their acceptability as potential nuclear energy center study sites. Consideration of what is ''representative'' of a site as well as the ranking score was factored into site recommendations, since the site deemed easiest to license and permit may not be the most desirable site for future study of the technical and institutional feasibility and practicality of a specific site. The sites near Lake Hartwell and the Savannah River Plant (SRP) of the Department of Energy were selected as potential study sites after consideration of the above criteria. Because the Lake Hartwell site offers the opportunity to consider institutional issues which may be more representative of other possible NEC sites, it is recommended that the Lake Hartwell site be studied to establish the feasibility and practicality of the nuclear energy concept on a site-specific basis
INTRAVAL Phase 2: Modeling testing at the Las Cruces Trench Site
International Nuclear Information System (INIS)
Hills, R.G.; Rockhold, M.; Xiang, J.; Scanlon, B.; Wittmeyer, G.
1994-01-01
Several field experiments have been performed by scientists from the University of Arizona and New Mexico State University at the Las Cruces Trench Site to provide data tc test deterministic and stochastic models for water flow and solute transport. These experiments were performed in collaboration with INTRAVAL, an international effort toward validation of geosphere models for the transport of radionuclides. During Phase I of INTRAVAL, qualitative comparisons between experimental data and model predictions were made using contour plots of water contents and solute concentrations. Detailed quantitative comparisons were not made. To provide data for more rigorous model testing, a third Las Cruces Trench experiment was designed by scientists from the University of Arizona and New Mexico State University. Modelers from the Center for Nuclear Waste Regulatory Analysis, Massachusetts Institute of Technology, New Mexico State University, Pacific Northwest Laboratory, and the University of Texas provided predictions of water flow and tritium transport to New Mexico State University for analysis. The corresponding models assumed soil characterizations ranging from uniform to deterministically heterogeneous to stochastic. This report presents detailed quantitative comparisons to field data
Shore, Joel D.; Thurston, George M.
2018-01-01
We report a charge-patterning phase transition on two-dimensional square lattices of titratable sites, here regarded as protonation sites, placed in a low-dielectric medium just below the planar interface between this medium and a salt solution. We calculate the work-of-charging matrix of the lattice with use of a linear Debye-Hückel model, as input to a grand-canonical partition function for the distribution of occupancy patterns. For a large range of parameter values, this model exhibits an approximate inverse cubic power-law decrease of the voltage produced by an individual charge, as a function of its in-lattice separation from neighboring titratable sites. Thus, the charge coupling voltage biases the local probabilities of proton binding as a function of the occupancy of sites for many neighbors beyond the nearest ones. We find that even in the presence of these longer-range interactions, the site couplings give rise to a phase transition in which the site occupancies exhibit an alternating, checkerboard pattern that is an analog of antiferromagnetic ordering. The overall strength W of this canonical charge coupling voltage, per unit charge, is a function of the Debye length, the charge depth, the Bjerrum length, and the dielectric coefficients of the medium and the solvent. The alternating occupancy transition occurs above a curve of thermodynamic critical points in the (pH-pK,W) plane, the curve representing a charge-regulation analog of variation of the Néel temperature of an Ising antiferromagnet as a function of an applied, uniform magnetic field. The analog of a uniform magnetic field in the antiferromagnet problem is a combination of pH-pK and W, and 1/W is the analog of the temperature in the antiferromagnet problem. We use Monte Carlo simulations to study the occupancy patterns of the titratable sites, including interactions out to the 37th nearest-neighbor category (a distance of 74 lattice constants), first validating simulations through
Directory of Open Access Journals (Sweden)
Lin Chen
2014-01-01
Full Text Available This study aimed to explore the antidepressant mechanisms of ginseng total saponins (GTS in the corticosterone-induced mouse depression model. In Experiment 1, GTS (50, 25, and 12.5 mg kg−1 d−1, intragastrically were given for 3 weeks. In Experiment 2, the same doses of GTS were administrated after each corticosterone (20 mg kg−1 d−1, subcutaneously injection for 22 days. In both experiments, mice underwent a forced swimming test and a tail suspension test on day 20 and day 21, respectively, and were sacrificed on day 22. Results of Experiment 1 revealed that GTS (50 and 25 mg kg−1 d−1 exhibited antidepressant activity and not statistically altered hippocampal protein levels of brain-derived neurotrophic factor (BDNF and neurofilament light chain (NF-L. Results of Experiment 2 showed that GTS (50 and 25 mg kg−1 d−1 ameliorated depression-like behavior without normalizing hypercortisolism. The GTS treatments reversed the corticosterone-induced changes in mRNA levels of BDNF and NF-L, and protein levels of BDNF NF-L, phosphor-cAMP response element-binding protein (Ser133, and phosphor-glycogen synthase kinase-3β (Ser9 in the hippocampus. These findings imply that the effect of GTS on corticosterone-induced depression-like behavior may be mediated partly through interfering with hippocampal GSK-3β-CREB signaling pathway and reversing decrease of some plasticity-related proteins.
Nuclear Energy Center study. Phase II. Site suitability analysis. Final report
Energy Technology Data Exchange (ETDEWEB)
Fellows, W.S.; Sharp, J.M.; Benator, B.I.
1978-06-01
A site screening study was conducted to identify a site or sites for detailed, site-specific study as a nuclear energy center. Using technical criteria of water requirements, geotechnical constraints, and projected load center and transmission considerations as well as environmental and institutional considerations, five potential study sites in the State of South Carolina were identified, evaluated against established criteria, and ranked according to their acceptability as potential nuclear energy center study sites. Consideration of what is ''representative'' of a site as well as the ranking score was factored into site recommendations, since the site deemed easiest to license and permit may not be the most desirable site for future study of the technical and institutional feasibility and practicality of a specific site. The sites near Lake Hartwell and the Savannah River Plant (SRP) of the Department of Energy were selected as potential study sites after consideration of the above criteria. Because the Lake Hartwell site offers the opportunity to consider institutional issues which may be more representative of other possible NEC sites, it is recommended that the Lake Hartwell site be studied to establish the feasibility and practicality of the nuclear energy concept on a site-specific basis.
International Nuclear Information System (INIS)
1977-01-01
An engineering assessment was made of the problems resulting from the existence of radioactive uranium mill tailings at the Monument Valley millsite in Arizona. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals residing nearby, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the tailings on the site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The sparse population and relatively low radiation levels yield minimal immediate environmental impact; hence, the two alternative actions presented are directed towards restricting access to the site and returning the windblown tailings to the pile and stabilizing the pile. Both options include remedial action costs for offsite locations where tailings have been placed. Cost estimates for the two options are $585,000 and $1,165,000
International Nuclear Information System (INIS)
1977-12-01
Results are reported from an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Ray Point, Texas. The Phase II--Title I services generally include the preparation of topographic maps, the performance of soil sampling and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. About 490,000 tons of ore were processed at this mill with all of the uranium sold on the commercial market. None was sold to the AEC; therefore, this report focuses on a physical description of the site and the identification of radiation pathways. No remedial action options were formulated for the site, inasmuch as none of the uranium was sold to the AEC and Exxon Corporation has agreed to perform all actions required by the State of Texas. Radon gas release from the tailings at the Ray Point site constitutes the most significant environmental impact. Windblown tailings, external gamma radiation and localized contamination of surface waters are other environmental effects. Exxon is also studying the feasibility of reprocessing the tailings
2014-01-01
M.Com. (Business Management) The Global Transactions Services (GTS) business unit was established alongside the Rand Merchant Bank (RMB) brand reporting into a Corporate and Investment Banking Board. GTS has been mandated to deliver global cash management, trade and custody services and account services to large corporates in the jurisdictions where FirstRand operates. Technology advances in centralising operating structures, have made it possible for GTS to centralise back office operatio...
Marsh, Rachel; Alexander, Gerianne M; Packard, Mark G; Zhu, Hongtu; Peterson, Bradley S
2005-01-01
Procedural learning and memory systems likely comprise several skills that are differentially affected by various illnesses of the central nervous system, suggesting their relative functional independence and reliance on differing neural circuits. Gilles de la Tourette syndrome (GTS) is a movement disorder that involves disturbances in the structure and function of the striatum and related circuitry. Recent studies suggest that patients with GTS are impaired in performance of a probabilistic classification task that putatively involves the acquisition of stimulus-response (S-R)-based habits. Assessing the learning of perceptual-motor skills and probabilistic classification in the same samples of GTS and healthy control subjects may help to determine whether these various forms of procedural (habit) learning rely on the same or differing neuroanatomical substrates and whether those substrates are differentially affected in persons with GTS. Therefore, we assessed perceptual-motor skill learning using the pursuit-rotor and mirror tracing tasks in 50 patients with GTS and 55 control subjects who had previously been compared at learning a task of probabilistic classifications. The GTS subjects did not differ from the control subjects in performance of either the pursuit rotor or mirror-tracing tasks, although they were significantly impaired in the acquisition of a probabilistic classification task. In addition, learning on the perceptual-motor tasks was not correlated with habit learning on the classification task in either the GTS or healthy control subjects. These findings suggest that the differing forms of procedural learning are dissociable both functionally and neuroanatomically. The specific deficits in the probabilistic classification form of habit learning in persons with GTS are likely to be a consequence of disturbances in specific corticostriatal circuits, but not the same circuits that subserve the perceptual-motor form of habit learning.
Technical know-how of site descriptive modeling for site characterization - 59089
International Nuclear Information System (INIS)
Saegusa, Hiromitsu; Onoe, Hironori; Doke, Ryosuke; Niizato, Tadafumi; Yasue, Ken-ichi
2012-01-01
The site descriptive model covering the current status of characteristics of geological environment and the site evolution model for estimation of the long-term evolution of site conditions are used to integrate multi-disciplinary investigation results. It is important to evaluate uncertainties in the models, to specify issues regarding the uncertainties and to prioritize the resolution of specified issues, for the planning of site characterization. There is a large quantity of technical know-how in the modeling process. It is important to record the technical know-how with transparency and traceability, since site characterization projects generally need long duration. The transfer of the technical know-how accumulated in the research and development (R and D) phase to the implementation phase is equally important. The aim of this study is to support the planning of initial surface-based site characterizations based on the technical know-how accumulated from the underground research laboratory projects. These projects are broad scientific studies of the deep geological environment and provide a technical basis for the geological disposal of high-level radioactive wastes. In this study, a comprehensive task flow from acquisition of existing data to planning of field investigations through the modeling has been specified. Specific task flow and decision-making process to perform the tasks have been specified. (authors)
International Nuclear Information System (INIS)
1977-10-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Maybell, Colorado. The Phase II--Title I services include the preparation of topographic maps, the performance of core drillings sufficient to determine areas and volumes of tailings and radiometric measurements to determine radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 2.6 million tons of tailings at the Maybell site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The three alternative actions presented range from fencing and maintenance (Option I), to placing the tailings in an open-pit mine and adding 2 ft of stabilization cover material (Option III). Cost estimates for the three options range from $250,000 to $4,520,000. Reprocessing the tailings for uranium does not appear to be economically attractive at present
Colloid and radionuclide retention mechanisms in fractured rock under near-natural flow conditions
International Nuclear Information System (INIS)
Delos, A.; Schaefer, T.; Geckeis, H.; Guimera, J.; Carrera, J.; Fanghaenel, T.
2005-01-01
Full text of publication follows: Experiments in fractured host rock (Grimsel Test Site, GTS, Switzerland) revealed that the colloid relevance for actinide migration is high due to the specific geochemical groundwater conditions [1]. However, even under such conditions it is found that retention of colloids and colloid-borne actinides becomes significant under near-natural groundwater flow rates (1-10 m/a) [2]. Underlying mechanisms of colloid and radionuclide retention are not well understood up to now. The present study co-funded by the NoE ACTINET-6 focuses on (i) the kinetics of actinide-colloid interactions and (ii) the relevance of matrix diffusion as a competition process to other retention mechanisms which affect the actinides behavior in fractured rock systems such as the Grimsel granodiorite. Colloid migration is studied with well defined model colloids as e.g. fluorescence dyed carboxylated polystyrene particles, and natural colloids extracted from bentonite (FEBEX) and from fracture filling material (GTS). In order to study the influence of matrix porosity on actinides migration, those experiments are performed in columns of well defined geometry filled with microporous unmodified silica spheres, porous ceramic material and natural fracture filling material from the GTS. The behaviour of actinides (Pu(IV) and Am(III)) sorbed onto bentonite colloids is investigated in column and batch experiments. All experiments are performed under anoxic conditions. Colloid characterization methods used in this study include the combination of photon correlation spectroscopy (PCS), laser-induced breakdown detection (LIBD), fluorimetry and field flow fractionation (FFF). Experimental results and their application to the parametrisation of reactive colloid transport models are discussed. [1] Geckeis H, Schaefer T, Hauser W, Rabung T, Missana T, Degueldre C, Moeri A, Eikenberg J, Fierz T, Alexander WR (2004) Results of the Colloid and Radionuclide Retention experiment
International Nuclear Information System (INIS)
1984-04-01
Low level radioactive wastes, arising from the use of radioisotopes in medicine and industry are accumulating throughout Australia. The rate of accumulation has not been large and storage of these wastes close to the point of use has proved practicable to date, but consideration must now be given to a central repository or repositories for these low level wastes. This report considers the question of selecting a site suitable for disposal of wastes by shallow ground burial. It attempts to asses the practicability of using factors suggested by the IAEA for the initial phase of site screening. The screening process described has essentially two stages. In the first, New South Wales was divided into broad structural units and these ranked in order of suitability. In the second stage, survey sites in which thick clay beds outcropped were delineated in the five highest ranking structural units. These survey sites were ranked on the basis of various geomorphological properties which largely described the hydrogeology of the site
Hanford Site Composite Analysis Technical Approach Description: Hanford Site Disposition Baseline.
Energy Technology Data Exchange (ETDEWEB)
Cobb, M. A. [CH2M HILL Plateau Remediation Company, Richland, WA (United States); Dockter, R. E. [CH2M HILL Plateau Remediation Company, Richland, WA (United States)
2017-10-02
The permeability of ground surfaces within the U.S. Department of Energy’s (DOE) Hanford Site strongly influences boundary conditions when simulating the movement of groundwater using the Subsurface Transport Over Multiple Phases model. To conduct site-wide modeling of cumulative impacts to groundwater from past, current, and future waste management activities, a site-wide assessment of the permeability of surface conditions is needed. The surface condition of the vast majority of the Hanford Site has been and continues to be native soils vegetated with dryland grasses and shrubs.
International Nuclear Information System (INIS)
1977-10-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Rifle, Colorado. The Phase II - Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 3.1 million tons of tailings at the two Rifle sites, constitutes the most significant environmental impact. Windblown tailings, external gamma radiation and localized contamination of surface waters are other environmental effects. The 15 alternative remedial action options presented range from millsite decomtamination and off-site remedial action (Options I and IV), to adding various depths of stabilization cover material (Options II, V, VI, and VII), to removal of the tailings to long-term storage sites and decontamination of the present sites (Options III and VIII through XV). Cost estimates for the first 14 options range from $224,000 to $20,300,000. Option XV, estimated at $32,200,000, includes the cost for moving both Rifle tailings piles and the Grand Junction tailings pile to DeBeque for long-term storage and site decontamination after removal of the piles. Reprocessing of the tailings for uranium appears to be economically attractive at present
International Nuclear Information System (INIS)
1977-10-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Rifle, Colorado. The Phase II--Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 3.1 million tons of tailings at the two Rifle sites, constitutes the most significant environmental impact. Windblown tailings, external gamma radiation and localized contamination of surface waters are other environmental effects. The 15 alternative remedial action options presented range from millsite decontamination and off-site remedial action (Options I and IV), to adding various depths of stabilization cover material (Options II, V, VI and VII), to removal of the tailings to long-term storage sites and decontamination of the present sites (Options III and VIII through XV). Cost estimates for the first 14 options range from $224,000 to $20,300,000. Option XV, estimated at $32,200,000, includes the cost for moving both Rifle tailings piles and the Grand Junction tailings pile to DeBeque for long-term storage and site decontamination after removal of the piles. Reprocessing of the tailings for uranium appears to be economically attractive at present
Energy Technology Data Exchange (ETDEWEB)
None
1977-10-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Rifle, Colorado. The Phase II--Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 3.1 million tons of tailings at the two Rifle sites, constitutes the most significant environmental impact. Windblown tailings, external gamma radiation and localized contamination of surface waters are other environmental effects. The 15 alternative remedial action options presented range from millsite decontamination and off-site remedial action (Options I and IV), to adding various depths of stabilization cover material (Options II, V, VI and VII), to removal of the tailings to long-term storage sites and decontamination of the present sites (Options III and VIII through XV). Cost estimates for the first 14 options range from $224,000 to $20,300,000. Option XV, estimated at $32,200,000, includes the cost for moving both Rifle tailings piles and the Grand Junction tailings pile to DeBeque for long-term storage and site decontamination after removal of the piles. Reprocessing of the tailings for uranium appears to be economically attractive at present.
Site selection report basalt waste isolation program near-surface test facility
International Nuclear Information System (INIS)
Sharpe, S.D.
1978-01-01
A site selection committee was established to review the information gathered on potential sites and to select a site for the Near-Surface Test Facility Phase I. A decision was made to use a site on the north face of Gable Mountain located on the Hanford Site. This site provided convenient access to the Pomona Basalt Flow. This flow was selected for use at this site because it exhibited the characteristics established in the primary criteria. These criteria were: the flows thickness; its dryness; its nearness to the surface; and, its similarities to basalt units which are candidates for the repository. After the selection of the Near-Surface Test Facility Phase I Site, the need arose for an additional facility to demonstrate safe handling, storage techniques, and the physical effects of radioactive materials on an in situ basalt formation. The committee reviewed the sites selected for Phase I and chose the same site for locating Phase II of the Near-Surface Test Facility
Pinpointing Phosphorylation Sites: Quantitative Filtering and a Novel Site-specific x-Ion Fragment
DEFF Research Database (Denmark)
Kelstrup, Christian D; Hekmat, Omid; Francavilla, Chiara
2011-01-01
Phosphoproteomics deals with the identification and quantification of thousands of phosphopeptides. Localizing the phosphorylation site is however much more difficult than establishing the identity of a phosphorylated peptide. Further, recent findings have raised doubts of the validity of the site......-phase phosphate rearrangement reactions during collision-induced dissociation (CID) and used these spectra to devise a quantitative filter that by comparing signal intensities of putative phosphorylated fragment ions with their nonphosphorylated counterparts allowed us to accurately pinpoint which fragment ions...... contain a phosphorylated residue and which ones do not. We also evaluated higher-energy collisional dissociation (HCD) and found this to be an accurate method for correct phosphorylation site localization with no gas-phase rearrangements observed above noise level. Analyzing a large set of HCD spectra...
Gilles De La Tourette′s Syndrome : A Case Series Of 14 Patients From India
Directory of Open Access Journals (Sweden)
Anil Gurtoo
2005-01-01
Full Text Available Background: Gilles de la Tourette′s Syndrome (GTS is a neuropsychiatric disorder characterized by motor and vocal tics associated with obsessive compulsive disorder (OCD and attention deficit hyperactivity disorder (ADHD. This syndrome is often misdiagnosed as psychiatric disorder, therefore neuropsychiatric evaluation in patients suffering from it is very essential to make the correct diagnosis. Few reports, mostly single case reports of GTS from India have been published, this series attempts to define the clinical spectrum of patients from India. Aim : To study the clinical profile of patients with GTS in India. Setting and Design : Prospective hospital based study. Material and Methods : Ct scan of the head and EEG were done in all the 14 cases in addition to clinical history and detailed neurological examination. The diagnosis of GTS was made according to Tourette Syndrome Classification Study Criteria Group. Findings were statistically analyzed. Results : In all a total of 101 simple motor tics and 21 complex motor tics were observed in 14 cases. Most common site of simple motor tics was the facio-nuchal region (70% and type was eyebrow raising seen in 10 cases (71%. Commonest type of complex motor tics nose blowing (35%. Vocal tics were found in all 14 cases, simple (56%, being more common than complex vocal tics i.e, coprolalia (42%. Throat clearing was found in (50% cases and was the most positive in 28%. OCD was seen in 64% and ADHD in 28%. All the 14 cases Responded well to treatment. Conclusion : The clinical profile of patients in our case series is similar to those reported from the western countries with the exception of coprolalia, and ADHD, the incidence of which is higher in this case series.
International Nuclear Information System (INIS)
1977-10-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at the two millsites in Slick Rock, Colorado. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals residing nearby, the investigation of site hydrology and meteorology, and the evaluation and costing of alternative corrective actions. The Union Carbide site has 350,000 tons of tailings and the North Continent site now owned by Union Carbide has 37,000 tons of tailings. Both tailings piles have been stabilized in accordance with regulations of the State of Colorado. Radon gas release from the tailings on the sites constitute the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The sparse population and relatively low radiation levels yield minimal immediate environmental impact. Hence the three alternative actions presented are directed towards restricting access to the sites (Option I), and returning the windblown tailings to the piles and stabilizing the piles with cover material (Option II), and consolidating the two piles on the UC site and stabilizing with 2 ft of cover (Option III). Fencing around the tailings piles is included in all options. Options II and III provide 2 ft of cover material on the tailings. Costs of the options range from $370,000 to $1,100,000. Reprocessing the tailings for uranium is not economically feasible
DEFF Research Database (Denmark)
Davies, Richard; Harty, Chris
2013-01-01
Numerous Building Information Modelling (BIM) tools are well established and potentially beneficial in certain uses. However, issues of adoption and implementation persist, particularly for on-site use of BIM tools in the construction phase. We describe an empirical case-study of the implementation...... of an innovative ‘Site BIM’ system on a major hospital construction project. The main contractor on the project developed BIM-enabled tools to allow site workers using mobile tablet personal computers to access design information and to capture work quality and progress data on-site. Accounts show that ‘Site BIM...
Beam experiments with the Grenoble test electron cyclotron resonance ion source at iThemba LABS
Energy Technology Data Exchange (ETDEWEB)
Thomae, R., E-mail: rthomae@tlabs.ac.za; Conradie, J.; Fourie, D.; Mira, J.; Nemulodi, F. [iThemba LABS, P.O. Box 722, Somerset West 7130 (South Africa); Kuechler, D.; Toivanen, V. [CERN, BE/ABP/HSL, 1211 Geneva 23 (Switzerland)
2016-02-15
At iThemba Laboratory for Accelerator Based Sciences (iThemba LABS) an electron cyclotron ion source was installed and commissioned. This source is a copy of the Grenoble Test Source (GTS) for the production of highly charged ions. The source is similar to the GTS-LHC at CERN and named GTS2. A collaboration between the Accelerators and Beam Physics Group of CERN and the Accelerator and Engineering Department of iThemba LABS was proposed in which the development of high intensity argon and xenon beams is envisaged. In this paper, we present beam experiments with the GTS2 at iThemba LABS, in which the results of continuous wave and afterglow operation of xenon ion beams with oxygen as supporting gases are presented.
Phase analysis in gated blood pool tomography
International Nuclear Information System (INIS)
Nakajima, Kenichi; Bunko, Hisashi; Tada, Akira; Taki, Junichi; Nanbu, Ichiro
1984-01-01
Phase analysis of gated blood pool study has been applied to detect the site of accessory conduction pathway (ACP) in the Wolff-Parkinson-White (WPW) syndrome; however, there was a limitation to detect the precise location of ACP by phase analysis alone. In this study, we applied phase analysis to gated blood pool tomography using seven pin hole tomography (7PT) and gated emission computed tomography (GECT) in 21 patients with WPW syndrome and 3 normal subjects. In 17 patients, the sites of ACPs were confirmed by epicardial mapping and the result of the surgical division of ACP. In 7PT, the site of ACP grossly agreed to the abnormal initial phase in phase image in 5 out of 6 patients with left cardiac type. In GECT, phase images were generated in short axial, vertical and horizontal long axial sections. In 8 out of 9 patients, the site of ACP was correctly identified by phase images, and in a patient who had two ACPs, initial phase corresponded to one of the two locations. Phase analysis of gated blood pool tomography has advantages for avoiding overlap of blood pools and for estimating three-dimensional propagation of the contraction, and can be a good adjunctive method in patients with WPW syndrome. (author)
Mumtaz, Fiza; Jaffari, G. Hassnain; Hassan, Qadeer ul; Shah, S. Ismat
2018-06-01
We present detailed comparative study of effect of isovalent i.e. Eu+3 substitution at A-site and tetra (Ti+4, Zr+4), penta (V+5) and hexavalent (W+6) substitutions at B-site in BiFeO3. Eu+3 substitution led to phase transformation and exhibited mixed phases i.e. rhombohedral and orthorhombic, while tetravalent substituents (Ti+4 and Zr+4) led to stabilization of cubic phase. In higher valent (i.e. V+5 and W+6) cases solubility limit was significantly reduced where orthorhombic phase was observed as in the case of parent compound. Phase transformation as a consequence of increase in microstrain and chemical pressure induced by the substituent has been discussed. Solubility limit of different B-site dopants i.e. Zr, W and V was extracted to 5%, 2% and 2%, respectively. Extra phases in various cases were Bi2Fe4O9, Bi25FeO40, Bi14W2O27, and Bi23V4O44.5 and their fractional amount have been quantified. Ti was substituted up to 15% and has been observed to be completely soluble in the parent compound. Solubility limits depends on ionic radii mismatch and valance difference of Fe+3 and dopant, in which valance difference plays more dominant role. Solubility limit and phase transformation has been explained in terms of change in bond strength and tolerance factor induced by incorporation of dopant which depend on its size and valence state. Detail optical, dielectric, ferroelectric, magnetic and transport properties of Eu and Ti co-doped samples and selected low concentration B-site doped compositions (i.e. 2%) have presented and discussed. Two d-d transitions and three charge transfer transitions were observed within UV-VIS range. Both change in cell volume for the same phase and transformation in crystal structure affects the band gap. Increase in room temperature dielectric constant and saturation polarization was also found to increase in case of Eu-Ti co-doped samples with increasing concentration of Ti. Substitution of Eu at A-site and Ti at B-site led to
Intelligent Cognitive Radio Models for Enhancing Future Radio Astronomy Observations
Directory of Open Access Journals (Sweden)
Ayodele Abiola Periola
2016-01-01
Full Text Available Radio astronomy organisations desire to optimise the terrestrial radio astronomy observations by mitigating against interference and enhancing angular resolution. Ground telescopes (GTs experience interference from intersatellite links (ISLs. Astronomy source radio signals received by GTs are analysed at the high performance computing (HPC infrastructure. Furthermore, observation limitation conditions prevent GTs from conducting radio astronomy observations all the time, thereby causing low HPC utilisation. This paper proposes mechanisms that protect GTs from ISL interference without permanent prevention of ISL data transmission and enhance angular resolution. The ISL transmits data by taking advantage of similarities in the sequence of observed astronomy sources to increase ISL connection duration. In addition, the paper proposes a mechanism that enhances angular resolution by using reconfigurable earth stations. Furthermore, the paper presents the opportunistic computing scheme (OCS to enhance HPC utilisation. OCS enables the underutilised HPC to be used to train learning algorithms of a cognitive base station. The performances of the three mechanisms are evaluated. Simulations show that the proposed mechanisms protect GTs from ISL interference, enhance angular resolution, and improve HPC utilisation.
Crystal Structure of a UDP-glucose-specific Glycosyltransferase from a Mycobacterium Species
Energy Technology Data Exchange (ETDEWEB)
Fulton, Zara; McAlister, Adrian; Wilce, Matthew C.J.; Brammananth, Rajini; Zaker-Tabrizi, Leyla; Perugini, Matthew A.; Bottomley, Stephen P.; Coppel, Ross L.; Crellin, Paul K.; Rossjohn, Jamie; Beddoe, Travis (Monash); (Melbourne)
2008-10-24
Glycosyltransferases (GTs) are a large and ubiquitous family of enzymes that specifically transfer sugar moieties to a range of substrates. Mycobacterium tuberculosis contains a large number of GTs, many of which are implicated in cell wall synthesis, yet the majority of these GTs remain poorly characterized. Here, we report the high resolution crystal structures of an essential GT (MAP2569c) from Mycobacterium avium subsp. paratuberculosis (a close homologue of Rv1208 from M. tuberculosis) in its apo- and ligand-bound forms. The structure adopted the GT-A fold and possessed the characteristic DXD motif that coordinated an Mn{sup 2+} ion. Atypical of most GTs characterized to date, MAP2569c exhibited specificity toward the donor substrate, UDP-glucose. The structure of this ligated complex revealed an induced fit binding mechanism and provided a basis for this unique specificity. Collectively, the structural features suggested that MAP2569c may adopt a 'retaining' enzymatic mechanism, which has implications for the classification of other GTs in this large superfamily.
Pedroarena-Leal, Nicole; Ruge, Diane
2017-09-01
Therapy resistance of approximately one-third of patients with Gilles de la Tourette syndrome (GTS) requires consideration of alternative therapeutic interventions. The article demonstrates the role of the cerebellum in neuropsychiatric disorders and GTS in particular, specifically its role in functions relating to motor and cognitive symptoms. Certain circuits in the cerebellum have been shown to undergo learning-induced changes during conditioning, with cells in the cortex of the cerebellum appearing to decrease their activity whilst those in deep nuclei seem to do the inverse. Evidence exists showing that abnormal excitability of the motor cortex via the cerebellum could be expected to participate in motor tics in GTS possibly due to aberrations in certain structures of involved circuits. The role of the cerebellum in learning and plasticity processes renders it a strategic and valuable structure to consider for brain stimulation when investigating potential treatment options for neuropsychiatric disorders such as GTS. This article puts forth the concept of using non-invasive and invasive brain stimulation techniques as a novel platform for non-pharmacological neuromodulation of GTS symptoms. © 2015 The British Psychological Society.
International Nuclear Information System (INIS)
1977-01-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at the Tuba City millsite in Arizona. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals residing nearby, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the tailings on the site constitutes the most significant environmental impact to the inhabited area near the site. In the downwind direction, to the northeast of the site, airborne radioactivity is greater than Federal guidelines but there are no dwellings in that direction in the area of concern. Gamma radiation is significant over the tailings but is near background levels in the housing area. The sparse population and relatively low radiation levels yield minimal immediate environmental impact; hence, the four alternative actions presented are directed towards restricting access to the site (Option I), and returning the windblown tailings to the pile and stabilizing the pile with cover material (Options II, III, and IV). Fencing around the site or the tailings pile and the removal or decontamination of mill buildings is included in all options. Option II provides 2 ft of cover material on the tailings, Option III provides 4 ft of cover, and Option IV provides 13 ft of cover. Costs of the options range from $671,000 to $2,904,000. Reprocessing the tailings for uranium is only marginally feasible and would require a more detailed economic evaluation before any action was taken
Lateral frontal cortex volume reduction in Tourette syndrome revealed by VBM
Directory of Open Access Journals (Sweden)
Wittfoth Matthias
2012-02-01
Full Text Available Abstract Background Structural changes have been found predominantly in the frontal cortex and in the striatum in children and adolescents with Gilles de la Tourette syndrome (GTS. The influence of comorbid symptomatology is unclear. Here we sought to address the question of gray matter abnormalities in GTS patients with co-morbid obsessive-compulsive disorder (OCD and/or attention deficit hyperactivity disorder (ADHD using voxel-based morphometry (VBM in twenty-nine adult actually unmedicated GTS patients and twenty-five healthy control subjects. Results In GTS we detected a cluster of decreased gray matter volume in the left inferior frontal gyrus (IFG, but no regions demonstrating volume increases. By comparing subgroups of GTS with comorbid ADHD to the subgroup with comorbid OCD, we found a left-sided amygdalar volume increase. Conclusions From our results it is suggested that the left IFG may constitute a common underlying structural correlate of GTS with co-morbid OCD/ADHD. A volume reduction in this brain region that has been previously identified as a key region in OCD and was associated with the active inhibition of attentional processes may reflect the failure to control behavior. Amygdala volume increase is discussed on the background of a linkage of this structure with ADHD symptomatology. Correlations with clinical data revealed gray matter volume changes in specific brain areas that have been described in these conditions each.
Quality of life in adults with Gilles de la Tourette Syndrome
2012-01-01
Background Few studies have used standardized QOL instruments to assess the quality of life (QOL) in Gilles de la Tourette Syndrome (GTS) patients. This work investigates the QOL of adult GTS patients and examines the relationships between physical and psychological variables and QOL. Methods Epidemiological investigation by anonymous national postal survey of QOL of patients of the French Association of Gilles de la Tourette Syndrome (AFGTS) aged 16 years or older. The clinical and QOL measures were collected by four questionnaires: a sociodemographic and GTS-related symptoms questionnaire, the World Health Organization Quality Of Life questionnaire (WHOQOL-26), the Functional Status Questionnaire (FSQ), and a self-rating questionnaire on psychiatric symptoms (SCL-90), all validated in French. We used stepwise regression analysis to explicitly investigate the relationships between physical and psychological variables and QOL domains in GTS. Results Questionnaires were posted to 303 patients, of whom 167 (55%) completed and returned them. Our results, adjusted for age and gender, show that patients with GTS have a worse QOL than the general healthy population. In particular, the “Depression” psychological variable was a significant predictor of impairment in all WHOQOL-26 domains, psychological but also physical and social. Conclusions The present study demonstrates a strong relationship between QOL in GTS and psychiatric symptoms, in particular those of depression. PMID:22888766
International Nuclear Information System (INIS)
1977-11-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Naturita, Colorado. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings sufficient to determine areas and volumes of tailings, the performance of radiometric measurements to determine the extent of radium contamination, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology, and the costing of alternative corrective actions. Radon gas release from the 704,000 tons of tailings at the Naturita site constitutes the most significant environmental impact although windblown tailings and external gamma radiation are also factors. Ranchers Exploration and Development Company has been licensed by the State of Colorado to reprocess the tailings at a location 3 mi from the present site where they will be stabilized for long-term storage. The remedial action options include remedial action for structures in Naturita and Nucla (Option I) at an estimated cost of $270,000 and remedial action for structures and open land adjacent to the tailings site (Option II) at an estimated cost of $950,000
EPR Flamanville 3, Site Management
International Nuclear Information System (INIS)
Menager, Antoine
2014-01-01
Antoine Menager, the EPR Flamanville 3 Site Manager described the organization and the management of the Flamanville site during the construction phase. He placed emphasis on Health and Safety, Environmental and Social Responsibility and on Nuclear Safety and Quality
Repetitive behaviours in patients with Gilles de la Tourette syndrome: tics, compulsions, or both?
Worbe, Yulia; Mallet, Luc; Golmard, Jean-Louis; Béhar, Cécile; Durif, Franck; Jalenques, Isabelle; Damier, Philippe; Derkinderen, Pascal; Pollak, Pierre; Anheim, Mathieu; Broussolle, Emannuel; Xie, Jing; Mesnage, Valérie; Mondon, Karl; Viallet, François; Jedynak, Pierre; Ben Djebara, Mouna; Schüpbach, Michael; Pelissolo, Antoine; Vidailhet, Marie; Agid, Yves; Houeto, Jean-Luc; Hartmann, Andreas
2010-09-24
Repetitive behaviours (RB) in patients with Gilles de la Tourette syndrome (GTS) are frequent. However, a controversy persists whether they are manifestations of obsessive-compulsive disorder (OCD) or correspond to complex tics. 166 consecutive patients with GTS aged 15-68 years were recruited and submitted to extensive neurological, psychiatric and psychological evaluations. RB were evaluated by the YBOCS symptom checklist and Mini International Neuropsychiatric Interview (M.I.N.I), and classified on the basis of a semi-directive psychiatric interview as compulsions or tics. RB were present in 64.4% of patients with GTS (107/166) and categorised into 3 major groups: a 'tic-like' group (24.3%-40/166) characterised by RB such as touching, counting, 'just right' and symmetry searching; an 'OCD-like' group (20.5%-34/166) with washing and checking rituals; and a 'mixed' group (13.2%-22/166) with both 'tics-like' and 'OCD-like' types of RB present in the same patient. In 6.3% of patients, RB could not be classified into any of these groups and were thus considered 'undetermined'. The results confirm the phenomenological heterogeneity of RB in GTS patients and allows to distinguish two types: tic-like behaviours which are very likely an integral part of GTS; and OCD-like behaviours, which can be considered as a comorbid condition of GTS and were correlated with higher score of complex tics, neuroleptic and SSRIs treatment frequency and less successful socio-professional adaptation. We suggest that a meticulous semiological analysis of RB in GTS patients will help to tailor treatment and allow to better classify patients for future pathophysiologic studies. ClinicalTrials.gov NCT00169351.
Repetitive behaviours in patients with Gilles de la Tourette syndrome: tics, compulsions, or both?
Directory of Open Access Journals (Sweden)
Yulia Worbe
2010-09-01
Full Text Available Repetitive behaviours (RB in patients with Gilles de la Tourette syndrome (GTS are frequent. However, a controversy persists whether they are manifestations of obsessive-compulsive disorder (OCD or correspond to complex tics.166 consecutive patients with GTS aged 15-68 years were recruited and submitted to extensive neurological, psychiatric and psychological evaluations. RB were evaluated by the YBOCS symptom checklist and Mini International Neuropsychiatric Interview (M.I.N.I, and classified on the basis of a semi-directive psychiatric interview as compulsions or tics.RB were present in 64.4% of patients with GTS (107/166 and categorised into 3 major groups: a 'tic-like' group (24.3%-40/166 characterised by RB such as touching, counting, 'just right' and symmetry searching; an 'OCD-like' group (20.5%-34/166 with washing and checking rituals; and a 'mixed' group (13.2%-22/166 with both 'tics-like' and 'OCD-like' types of RB present in the same patient. In 6.3% of patients, RB could not be classified into any of these groups and were thus considered 'undetermined'.The results confirm the phenomenological heterogeneity of RB in GTS patients and allows to distinguish two types: tic-like behaviours which are very likely an integral part of GTS; and OCD-like behaviours, which can be considered as a comorbid condition of GTS and were correlated with higher score of complex tics, neuroleptic and SSRIs treatment frequency and less successful socio-professional adaptation. We suggest that a meticulous semiological analysis of RB in GTS patients will help to tailor treatment and allow to better classify patients for future pathophysiologic studies.ClinicalTrials.gov NCT00169351.
Moriarty, J; Ring, H A; Robertson, M M
1993-11-01
We describe the existence of the savant syndrome in association with Gilles de la Tourette's Syndrome (GTS). The presentation of savant abilities is typical of that previously described. Similarities between autism, the disorder most characteristically associated with savants, and GTS in terms of obsessionality are noted. Previously reported psychological studies of autistic savants are briefly reviewed and, together with evidence from neuroimaging in GTS, obsessive compulsive disorder (OCD), and autism, used to support a model of the underpinnings of savant skills.
Decisions on sites by Laender parliaments
International Nuclear Information System (INIS)
1977-01-01
The Vereinigung Deutscher Elektrizitaetswerke (VDEW, Association of German Electricity Utilities) proposes two independent steps in the licensing procedure for each nuclear power plant constuction project: one first phase in which to establish site guarantees, and one licensing phase for construction and operation of the power plant. The first phase should henceforth proceed with the active participation of the public involved within the framework of a plans approval procedure. The novel aspect would be the binding clarification in this procedure not only of the nuclear aspects of the case, as formerly, but of all public aspects relating to the site. The construction and operating permits, which would constitute phase two, could then be handled in the usual procedure without any need for urgency. (orig.) [de
DEFF Research Database (Denmark)
Thomalla, Götz; Siebner, Hartwig R; Jonas, Melanie
2009-01-01
Gilles de la Tourette syndrome (GTS) is a neuropsychiatric disorder characterized by multiple motor and vocal tics. Previous structural MRI studies have identified regional abnormalities in grey matter, especially in the basal ganglia. These findings are consistent with the assumption...... of white matter changes in GTS. In this study, we aimed to examine whether GTS is associated with abnormalities in white matter microstructure and whether these changes are correlated with tic severity. In a morphometric study based on diffusion tensor MRI of the whole brain, we compared brain tissue...... the groups. We also tested for a linear relationship between regional FA values and clinical scores of tic severity. Probabilistic fibre tracking was applied to characterize anatomical connectivity of those areas showing differences in regional FA. Compared with healthy controls, GTS patients showed...
Meteorology in site operations
International Nuclear Information System (INIS)
Anon.
1986-01-01
During the site selection and design phases of a plant, meteorological assistance must be based on past records, usually accumulated at stations not actually on the site. These preliminary atadvices will be averages and extremes that might be expected. After a location has been chosen and work has begun, current and forecast weather conditions become of immediate concern. On-site meteorological observations and forecasts have many applications to the operating program of an atomic energy site. Requirements may range from observations of the daily minimum temperatures to forecasts of radiation dosages from airborne clouds
A study on Z-phase nucleation in martensitic chromium steels
DEFF Research Database (Denmark)
Golpayegani, Ardeshir; Andrén, Hans-Olof; Danielsen, Hilmar Kjartansson
2008-01-01
, initial stages of precipitation of Z-phase have been studied and characterized using energy-filtered transmission electron microscopy (EFTEM). Vanadium nitrides were found to provide the most suitable nucleation site for Z-phase, since the misfit between the (0 0 1) planes of VN and Z-phase is very small....... Furthermore, such a nucleation site would provide vanadium and nitrogen for the growth of Z-phase. The presence of niobium carbide has also been observed close to Z-phase nucleation sites, indicating niobium to be important for the nucleation and growth of Z-phase....
On-site and off-site emergency planning at Cekmece Nuclear Research and Training Centre
International Nuclear Information System (INIS)
Soyberk, O.A.
1986-01-01
An emergency plan was prepared for minimizing the consequences of any unforeseen radiation accident in Cekmece Nuclear Research and Training Centre (CNAEM) in Istanbul, Turkey. CNAEM is situated near Kucukcekmece Lake, which is about 30 km to the west of Istanbul. It includes two pool-type research reactors of 1 MW(th) and 5 MW(th). The population in the nearest inhabited areas varies from 1000 to 50,000. Accidents are classified, according to their severity, into three categories at CNAEM: (a) local emergency, (b) on-site emergency, (c) off-site emergency. During local emergency situations evacuation is not necessary. An on-site emergency situation requires the evacuation of personnel from the plant. Personnel hearing the emergency alarm should move directly to the preselected place as soon as possible. An off-site emergency is any accident that leads to widespread contamination outside the boundary. In this situation the Turkish Atomic Energy Authority and governmental authorities are notified immediately. The emergency organization group consists of: (a) Plant Superintendent, (b) Emergency Director, (c) Reactor Supervisor, (d) Senior Health Physicist, (e) Reactor Shift Operator, (f) Health Physicists. The administration building will be used as the Emergency Control Centre. The emergency teams working under the direction of the Emergency Director consist of: (a) Health Physics, (b) Fire and Rescue, (c) First Aid and Decontamination, (d) Transportation, (e) Security and Patrol. The emergency situation is evaluated in three phases at CNAEM. The first phase is the first few hours after the beginning of the accident. The second phase is between 8-10 hours or more following the first phase. The third phase is the recovery phase. The integrated doses over periods of two hours and two days are calculated according to the situation of the core, i.e. total or partial melting, and weather conditions. The results of the calculated parameters can be adapted to possible
Sample Exchange Evaluation (SEE) Report - Phase II
Energy Technology Data Exchange (ETDEWEB)
Winters, W.I.
1994-09-28
This report describes the results from Phase II of the Sample Exchange Evaluation (SEE) Program, a joint effort to compare analytical laboratory performance on samples from the Hanford Site`s high-level waste tanks. In Phase II, the program has been expanded to include inorganic constituents in addition to radionuclides. Results from Phase II that exceeded 20% relative percent difference criteria are identified.
Radiological Control Technician: Phase 4, Facility practical training attachment
International Nuclear Information System (INIS)
1992-10-01
At DOE sites with more than one facility, and where RCT tasks at each facility may differ, site and facility tasks should be separated. The tasks that are common to all the facilities on the site should be included in Phase II training with the core tasks. Tasks unique to a facility should be added to the training program qualification standard, as an attachment, as Phase IV training. Not all the DOE sites will include Phase IV training in their programs. Phase IV training allows each site to qualify technicians to a select facility. Since the core training for the technicians is standardized, the transfer of technicians between facilities requires that only facility tasks be taught, provided the core qualification is current
International Nuclear Information System (INIS)
1998-12-01
The flow path between Pahute Mesa and the groundwater discharge area in Oasis Valley (approximately 18 miles to the southwest) is of concern due to the relatively short travel distance between a recharge area where underground nuclear testing has been conducted and the off-site water users. Groundwater flow and transport modeling by IT Corporation (IT) has shown rapid tritium transport in the volcanic rock aquifers along this flow path. The resultant estimates of rapid transport were based on water level data, limited hydraulic conductivity data, estimates of groundwater discharge rates in Oasis Valley, assumed porosities, and estimated retardation rates. Many of these parameters are poorly constrained and may vary considerably. Sampling and analytical techniques are being applied as an independent means to determine transport rates by providing an understanding of the geochemical processes that control solute movement along the flow path. As part of these geochemical investigations, this report summarizes the analysis of fracture coating mineral phases from drill core samples from the Pahute mesa area of the Nevada Test Site (NTS). Archived samples were collected based on the presence of natural fractures and on the types and abundance of secondary mineral phases present on those fracture surfaces. Mineral phases present along fracture surfaces are significant because, through the process of water-rock interaction, they can either contribute (as a result of dissolution) or remove (as a result of precipitation or adsorption) constituents from solution. Particular attention was paid to secondary calcite occurrences because they represent a potential source of exchangeable carbon and can interact with groundwater resulting in a modified isotopic signature and apparent water age
Synthesis gas demonstration plant program, Phase I. Site confirmation report
Energy Technology Data Exchange (ETDEWEB)
1978-12-01
With few reservations, the Baskett, Kentucky site exhibits the necessary characteristics to suggest compatibility with the proposed Synthesis Gas Demonstration Plant Project. An evaluation of a broad range of technical disciplinary criteria in consideration of presently available information indicated generally favorable conditions or, at least, conditions which could be feasibly accommodated in project design. The proximity of the Baskett site to market areas and sources of raw materials as well as a variety of transportation facilities suggests an overall favorable impact on Project economic feasibility. Two aspects of environmental engineering, however, have been identified as areas where the completion or continuation of current studies are required before removing all conditions on site suitability. The first aspect involves the current contradictory status of existing land use and planning ordinances in the site area. Additional investigation of the legality of, and local attitudes toward, these present plans is warranted. Secondly, terrestrial and aquatic surveys of plant and animal life species in the site area must be completed on a seasonal basis to confirm the preliminary conclusion that no exclusionary conditions exist.
2011-02-01
Spatial Outliers A1 Missing Data PREPARE Outlier Search A2 Time Slices A4 A5 A3 Data Import ER-0714 Final Report 23 February 2011 spots’ and/or...the back button, at times there appeared to be an icon loading issue with the icons located along the right of the panel. I did a lot of switching
Site qualification plan for the Subseabed Disposal Program
International Nuclear Information System (INIS)
Laine, E.P.; Anderson, D.R.; Hollister, C.D.
1983-01-01
In our evolving study to identify and examine sites in subseabed geological formations for use as repositories for high-level nuclear wastes, two primary criteria guide all phases of this work: the stability and barrier criteria of the site. The stability criterion defines areas of the seabed not likely to be disturbed by tectonic forces and oceanographic changes during the lifetime of a waste repository. The barrier criterion defines those subseabed geological formations most likely to form an effective barrier to the release of radionuclides. Because of the large area of the oceans, a phased approach has been adopted so that successively smaller areas of the seafloor can be studied in ever greater detail. The first phase, which is complete, has identified the abyssal clay deposits that are remote from tectonic boundaries and continental margins as being the regions (<10/sup 6/ km/sup 2/) on the seafloor within which acceptable sites might be most readily identified. The second phase involves downgrading less desirable areas within these regions using archived seismic reflection profiling, sediment cores, and oceanographic data. This winnowing process identifies locations about one degree square (≤10/sup 4/ km/sup 2/) for more detailed field studies during the first part of the third phase. From these locations candidate sites will be chosen, based on detailed geological and geophysical surveying. The second part of the third phase will involve detailed monitoring of the candidate sites to determine long-term baseline conditions. After monitoring is underway, a pilot repository will be established, using waste canisters
Individual variation in the motivational and neurobiological effects of an opioid cue.
Yager, Lindsay M; Pitchers, Kyle K; Flagel, Shelly B; Robinson, Terry E
2015-03-13
A discrete cue associated with intravenous injections of cocaine acquires greater control over motivated behavior in some rats ('sign-trackers', STs) than others ('goal-trackers', GTs). It is not known, however, if such variation generalizes to cues associated with other drugs. We asked, therefore, whether a discrete cue (a light) associated with the intravenous administration of an opioid drug (the short-acting mu receptor agonist, remifentanil) acquires incentive motivational properties differently in STs and GTs, as indicated by tests of Pavlovian conditioned approach and conditioned reinforcement. Consistent with studies using cocaine, STs approached a classically conditioned opioid cue more readily than GTs, and in a test of conditioned reinforcement worked more avidly to get it. Interestingly, STs and GTs did not differ in the acquisition of a conditioned orienting response. In addition, the performance of conditioned approach behavior, but not conditioned orientation, was attenuated by pretreatment with the dopamine receptor antagonist, flupenthixol, into the core of the nucleus accumbens. Lastly, food and opioid cues engaged similar amygdalo-striatal-thalamic circuitry to a much greater extent in STs than GTs, as indicated by Fos expression. Taken together, these data demonstrate that, similar to food and cocaine cues: (1) a discrete opioid cue attains greater incentive motivational value in STs than GTs; (2) the attribution of incentive motivational properties to an opioid cue is dopamine dependent; and (3) an opioid cue engages the so-called 'motive circuit' only if it is imbued with incentive salience.
Energy Technology Data Exchange (ETDEWEB)
Finley, Robert [Univ. of Illinois, Champaign, IL (United States); Payne, William [Schlumberger Carbon Services, Houston, TX (United States); Kirksey, Jim [Univ. of Illinois, Champaign, IL (United States)
2015-06-01
The Midwest Geological Sequestration Consortium (MGSC) has partnered with Archer Daniels Midland Company (ADM) and Schlumberger Carbon Services to conduct a large-volume, saline reservoir storage project at ADM’s agricultural products processing complex in Decatur, Illinois. The Development Phase project, named the Illinois Basin Decatur Project (IBDP) involves the injection of 1 million tonnes of carbon dioxide (CO2) into a deep saline formation of the Illinois Basin over a three-year period. This report focuses on objectives, execution, and lessons learned/unanticipated results from the site development (relating specifically to surface equipment), operations, and the site closure plan.
Famous people with Gilles de la Tourette syndrome?
Monaco, Francesco; Servo, Serena; Cavanna, Andrea Eugenio
2009-12-01
Virtually no neurologist nor psychiatrist today can be unaware of the diagnosis of Gilles de la Tourette syndrome (GTS). Although the eponymous description by Dr. Georges Gilles de la Tourette was published in 1885, familiarity with this syndrome has been achieved only recently. In this article, the two most renown accounts of exceptional individuals retrospectively diagnosed with GTS are critically analyzed: British lexicographer Samuel Johnson and Austrian musician Wolfgang Amadeus Mozart. In both cases, clinical descriptions have been retrieved from written documents predating Gilles de la Tourette's original publication. The case for Samuel Johnson having GTS is strong, mainly based on Boswell's extensive biographical account. Johnson was reported to have a great range of tics and compulsions, including involuntary utterances, repetitive ejaculations, and echo-phenomena. On the other hand, there is circumstantial evidence that Mozart may have had hyperactivity, restlessness, sudden impulses, odd motor behaviors, echo/palilalia, love of nonsense words, and scatology, the latter being documented in autograph letters ("coprographia"). However, the evidence supporting the core features of GTS, i.e., motor and vocal tics, is rather inconsistent. Thus, GTS seems to be an implausible diagnosis in Mozart's medical history and completely unrelated to his undisputed musical genius.
Evidence for land plant cell wall biosynthetic mechanisms in charophyte green algae
DEFF Research Database (Denmark)
Mikkelsen, Maria Dalgaard; Harholt, Jesper; Ulvskov, Peter
2014-01-01
in CGA is currently unknown, as no genomes are available, so this study sought to give insight into the evolution of the biosynthetic machinery of CGA through an analysis of available transcriptomes. METHODS: Available CGA transcriptomes were mined for cell wall biosynthesis GTs and compared with GTs...... to colonize land. These cell walls provide support and protection, are a source of signalling molecules, and provide developmental cues for cell differentiation and elongation. The cell wall of land plants is a highly complex fibre composite, characterized by cellulose cross-linked by non......-cellulosic polysaccharides, such as xyloglucan, embedded in a matrix of pectic polysaccharides. How the land plant cell wall evolved is currently unknown: early-divergent chlorophyte and prasinophyte algae genomes contain a low number of glycosyl transferases (GTs), while land plants contain hundreds. The number of GTs...
Sugianto, Agus; Indriani, Andi Marini
2017-11-01
Platform construction GTS (Gathering Testing Sattelite) is offshore construction platform with fix pile structure type/fixed platform functioning to support the mining of petroleum exploitation. After construction fabrication process platform was moved to barges, then shipped to the installation site. Moving process is generally done by pull or push based on construction design determined when planning. But at the time of lifting equipment/cranes available in the work area then the moving process can be done by lifting so that moving activity can be implemented more quickly of work. This analysis moving process of GTS platform in a different way that is generally done to GTS platform types by lifting using problem is construction reinforcement required, so the construction can be moved by lifting with analyzing and checking structure working stress that occurs due to construction moving process by lifting AISC code standard and analysis using the SAP2000 structure analysis program. The analysis result showed that existing condition cannot be moved by lifting because stress ratio is above maximum allowable value that is 0.950 (AISC-ASD89). Overstress occurs on the member 295 and 324 with stress ratio value 0.97 and 0.95 so that it is required structural reinforcement. Box plate aplication at both members so that it produces stress ratio values 0.78 at the member 295 and stress ratio of 0.77 at the member 324. These results indicate that the construction have qualified structural reinforcement for being moved by lifting.
International Nuclear Information System (INIS)
1977-10-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Grand Junction, Colorado. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology, and the evaluation and costing of alternative corrective actions. Radon gas release from the 1.9 million tons of tailings at the Grand Junction site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The eight alternative actions presented range from millsite decontamination (Option I), to adding various depths of stabilization cover material (Options II and III), to removal of the tailings to long-term storage sites and decontamination of the present site (Options IV through VIII). Cost estimates for the eight options range from $470,000 to $18,130,000. Reprocessing the tailings for uranium recovery does not appear to be economically attractive at present
An integrated transient model for simulating the operation of natural gas transport systems
Pambour, Kwabena Addo; Bolado-Lavin, Ricardo; Dijkema, Gerard P. J.
This paper presents an integrated transient hydraulic model that describes the dynamic behavior of natural gas transport systems (GTS). The model includes sub models of the most important facilities comprising a GTS, such as pipelines, compressor stations, pressure reduction stations, underground
Point Defects in Binary Laves-Phase Alloys
Energy Technology Data Exchange (ETDEWEB)
Liaw, P.K.; Liu, C.T.; Pike, L.M.; Zhu, J.H.
1999-01-11
Point defects in the binary C15 NbCrQ and NbCoz, and C 14 NbFe2 systems on both sides of stoichiometry were studied by both bulk density and X-ray Iattiee parameter measurements. It was found that the vacancy concentrations in these systems after quenching from 1000"C are essentially zero. The constitutional defects on both sides of stoichiometry for these systems were found to be of the anti-site type in comparison with the model predictions. Thermal vacancies exhibiting a maximum at the stoichiometric composition were obtained in NbCr2 Laves phase alloys after quenching from 1400"C. However, there are essentially no thermal vacancies in NbFe2 alloys after quenching from 1300oC. Anti-site hardening was found on both sides of stoichiometry for all the tie Laves phase systems studied, while the thermal vacancies in NbCr2 alloys quenched from 1400'C were found to soften the Laves phase. The anti-site hardening of the Laves phases is similar to that of the B2 compounds and the thermal vacancy softening is unique to the Laves phase. Neither the anti-site defects nor the thermal vacancies affect the fracture toughness of the Laves phases significantly.
Site characterization plan: Gulf Coast salt domes
International Nuclear Information System (INIS)
1983-12-01
The National Waste Terminal Storage (NWTS) program of the US Department of Energy (DOE) is responsible for developing technology and providing facilities for safe, environmentally acceptable, permanent disposal of high-level nuclear waste. The Office of Nuclear Waste Isolation has been intensively investigating Gulf Coast Salt Dome Basin salt domes and bedded salt in Texas and Utah since 1978. In the Gulf Coast, the application of screening criteria in the region phase led to selection of eight domes for further study in the location phase. Further screening in the area phase identified four domes for more intensive study in the location phase: Oakwood Dome, Texas; Vacherie Dome, Louisiana; and Richton Dome and Cypress Creek Dome, Mississippi. For each dome, this Site Characterization Plan identifies specific hydrologic, geologic, tectonic, geochemical, and environmental key issues that are related to the DOE/NWTS screening criteria or affect the feasibility of constructing an exploratory shaft. The Site Characterization Plan outlines studies need to: (1) resolve issues sufficiently to allow one or more salt domes to be selected and compared to bedded salt sites in order to determine a prime salt site for an exploratory shaft; (2) conduct issue-related studies to provide a higher level of confidence that the preferred salt dome site is viable for construction of an exploratory shaft; and (3) provide a vehicle for state input to issues. Extensive references, 7 figures, 20 tables
Site specific information in site selection
International Nuclear Information System (INIS)
Aeikaes, T.; Hautojaervi, A.
1998-01-01
The programme for the siting of a deep repository for final disposal of spent nuclear fuel was started already in 1983 and is carried out today by Posiva Oy which continues the work started by Teollisuuden Voima Oy. The programme aims at site selection by the end of the year 2000. The programme has progressed in successive interim stages with defined goals. After an early phase for site identification, five sites were selected in 1987 for preliminary site characterisation. Three of these were selected and judged to be best suited for the more detailed characterisation in 1992. An additional new site was included into the programme based on a separate feasibility study in the beginning of 1997. Since the year 1983 several safety assessments together with technical plans of the facility have been completed. When approaching the site selection the needs for more detailed consideration of the site specific properties in the safety assessment have been increased. The Finnish regulator STUK has published a proposal for general safety requirements for the final disposal of spent nuclear fuel in Finland. This set of requirements has been projected to be used in conjunction of the decision making by the end 2000. Based on the site evaluation all sites can provide a stable environment and there is evidence that the requirements for the longevity of the canister can be fulfilled at each site. In this manner the four candidate sites do not differ too much from each other. The main difference between the sites is in the salinity of the deep groundwater. The significance of differences in the salinity for the long-term safety cannot be defined yet. The differences may contribute to the discussion of the longevity of the bentonite buffer and also to the modelling of the groundwater flow and transport. The use of the geosphere as a transport barrier is basically culminated on the questions about sparse but fast flow routes and 'how bad channeling can be'. To answer these questions
Siting Process for HLW Repository in Japan
International Nuclear Information System (INIS)
Masuda, S.; Kitayama, K.; Umeki, H.; Naito, M.
2002-01-01
In the year 2000, the geological disposal program for high-level radioactive waste in Japan moved from the phase of generic research and development (R and D) into the phase of implementation. Following legislation entitled the ''Specified Radioactive Waste Final Disposal Act'', the Nuclear Waste Management Organization of Japan (NUMO) was established as the implementing organization. The assigned activities of NUMO include selection of the repository site, demonstration of disposal technology at the site, developing relevant licensing applications and construction, operation and closure of the repository. As the first milestone of siting process, NUMO announced to the public an overall procedure for selection of preliminary investigation areas for potential candidate sites on October 29, 2001. The procedure specifies that NUMO will solicit volunteer municipalities for preliminary investigation areas with publishing four documents as an information package. These documents are tentatively entitled ''Instructions for Application'', ''Siting Factors for the Preliminary Investigation Areas'', a ''Repository Concepts'' as well as an ''Site Investigation Community Outreach Scheme''
Silvestri, Paola R; Chiarotti, Flavia; Baglioni, Valentina; Neri, Valeria; Cardona, Francesco; Cavanna, Andrea E
2017-05-01
Gilles de la Tourette syndrome (GTS) is a childhood-onset neuropsychiatric disorder characterised by multiple tics and often associated with behavioural problems. Although there is evidence of significantly reduced self-esteem in children and adolescents with GTS, little is known about perceived self-concept and its clinical determinants at the transition age between adolescence and adulthood. We therefore set out to investigate self-concept in a clinical sample of young patients with GTS at this crucial age for personal development. In addition to standard demographic and clinical data, we collected self-ratings using a standardised battery of psychometric instruments, as well as the Multidimensional Self Concept Scale, a comprehensive questionnaire developed to assess self-concept in subjects aged 9- to 19 years, tapping into the social, competence, affect, academic, family, and physical domains. We found that patients diagnosed with at least one co-morbid psychiatric disorder ("GTS-plus" phenotype) reported significantly lower self-concept than patients with "pure GTS", whereas tic-related variables had no impact on self-concept. Anxiety symptoms were the main determinants of self-concept, especially trait anxiety with regard to social and affective domains. Affective symptoms could also have a negative impact on the physical, affective, competence, and social domains of self-concept. Routine screening for anxiety and affective symptoms should be recommended in all patients with GTS seen at transition clinics from paediatric to adult care, in order to implement effective treatment interventions whenever possible. Copyright © 2016 European Paediatric Neurology Society. Published by Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Forde, Natalie J; Kanaan, Ahmad S; Widomska, Joanna
2016-01-01
Gilles de la Tourette Syndrome (GTS) is characterized by the presence of multiple motor and phonic tics with a fluctuating course of intensity, frequency, and severity. Up to 90% of patients with GTS present with comorbid conditions, most commonly attention-deficit/hyperactivity disorder (ADHD...
Forde, Natalie J; Kanaan, Ahmad S; Widomska, Joanna; Padmanabhuni, Shanmukha S; Nespoli, Ester; Alexander, John; Rodriguez Arranz, Juan I; Fan, Siyan; Houssari, Rayan; Nawaz, Muhammad S; Rizzo, Francesca; Pagliaroli, Luca; Zilhäo, Nuno R; Aranyi, Tamas; Barta, Csaba; Boeckers, Tobias M; Boomsma, Dorret I; Buisman, Wim R; Buitelaar, Jan K; Cath, Danielle; Dietrich, Andrea; Driessen, Nicole; Drineas, Petros; Dunlap, Michelle; Gerasch, Sarah; Glennon, Jeffrey; Hengerer, Bastian; van den Heuvel, Odile A; Jespersgaard, Cathrine; Möller, Harald E; Müller-Vahl, Kirsten R; Openneer, Thaïra J C; Poelmans, Geert; Pouwels, Petra J W; Scharf, Jeremiah M; Stefansson, Hreinn; Tümer, Zeynep; Veltman, Dick J; van der Werf, Ysbrand D; Hoekstra, Pieter J; Ludolph, Andrea; Paschou, Peristera
2016-01-01
Gilles de la Tourette Syndrome (GTS) is characterized by the presence of multiple motor and phonic tics with a fluctuating course of intensity, frequency, and severity. Up to 90% of patients with GTS present with comorbid conditions, most commonly attention-deficit/hyperactivity disorder (ADHD), and
Forde, Natalie J.; Kanaan, Ahmad S.; Widomska, Joanna; Padmanabhuni, Shanmukha S.; Nespoli, Ester; Alexander, John; Arranz, Juan I. Rodriguez; Fan, Siyan; Houssari, Rayan; Nawaz, Muhammad S.; Rizzo, Francesca; Pagliaroli, Luca; Zilhao, Nuno R.; Aranyi, Tamas; Barta, Csaba; Boeckers, Tobias M.; Boomsma, Dorret I.; Buisman, Wim R.; Buitelaar, Jan K.; Cath, Danielle; Dietrich, Andrea; Driessen, Nicole; Drineas, Petros; Dunlap, Michelle; Gerasch, Sarah; Glennon, Jeffrey; Hengerer, Bastian; van den Heuvel, Odile A.; Jespersgaard, Cathrine; Moeller, Harald E.; Mueller-Vahl, Kirsten R.; Openneer, Thaira J. C.; Poelmans, Geert; Pouwels, Petra J. W.; Scharf, Jeremiah M.; Stefansson, Hreinn; Tumer, Zeynep; Veltman, Dick J.; van der werf, Ysbrand D.; Hoekstra, Pieter J.; Ludolph, Andrea; Paschou, Peristera
2016-01-01
Gilles de la Tourette Syndrome (GTS) is characterized by the presence of multiple motor and phonic tics with a fluctuating course of intensity, frequency, and severity. Up to 90% of patients with GTS present with comorbid conditions, most commonly attention-deficit/hyperactivity disorder (ADHD), and
Repetitive behaviors in Tourette's syndrome and OCD with and without tics: What are the differences?
Cath, D.C.; Spinhoven, P.; Hoogduin, C.A.L.; Landman, A.D.; Woerkom, T.C.A.M. van; Wetering, B.J.M. van de; Roos, R.A.C.; Rooijmans, H.G.M.
2001-01-01
Gilles de la Tourette Syndrome (GTS) and obsessive–compulsive disorder (OCD) share obsessive–compulsive phenomena. The aims of this study were to compare the OC symptom distribution between GTS and OCD and to investigate whether a subdivision of these phenomena into obsessions, compulsions and
Lunn, R. J.; Kinali, M.; Pytharouli, S.; Shipton, Z.; Stillings, M.; Lord, R.
2016-12-01
The drainage and refilling of a surface water reservoir beside the Grimsel Test Site (GTS) underground rock laboratory in Switzerland, has provided a unique opportunity to study in-situ rock mechanical, hydraulic and chemical interactions under large-scale stress changes. The reservoir was drained in October/November 2014 to enable dam maintenance and extension of the regional hydropower tunnel system. Reservoir drainage will have caused rapid unloading of the surrounding rock mass. The GTS sits 37m below the top of the reservoir and 200-600m away laterally within the mountainside on the eastern bank of the reservoir. Gradual refilling of the reservoir, via natural snowmelt and runoff, commenced in February 2015. As part of the European LASMO Project, researchers at Strathclyde, funded by Radioactive Waste Management Ltd., have been investigating mechanical-chemical-hydraulic coupling within the rock mass as an analogue for glacial unloading and loading of a future Geological Disposal Facility. We have deployed three 3-component and 6 single-component micro-seismometers within the GTS and surrounding hydropower tunnel network. In parallel, we have implemented a groundwater sampling programme, using boreholes within the GTS, for temporal determination of geochemistry and flow rate. Preliminary data analyses show geochemical anomalies during unloading, as well as detection of microseismic events. The signal-to-noise ratio of the micro-seismic data is extremely poor. Noise amplitude, and frequency content, variy throughout each day, between days, and from month-to-month on a highly unpredictable basis. This is probably due to the multitude of hydropower turbines and pump-storage systems within the surrounding mountains. To discriminate micro-seismic events, we have developed a new methodology for characterizing background noise within the seismic signal and combined this with cross-correlations techniques generally applied in microseismic analysis of hydraulic
Energy Technology Data Exchange (ETDEWEB)
Danzer, J. [Boden-und-Grundwasser GbR, Sonthofen (Germany)
2002-07-01
Chlorinated hydrocarbons, e.g. Perchloroethene (PCE) were commonly used for dry cleaning purposes among other ones. Since they have a significant toxic potential they impose a serious risk to groundwater quality. Due to their physico-chemical properties - particularly high volatility and medium to high water solubility - and their low biodegradation potential they are highly mobile within the unsaturated soil (vapour phase) as well as within the groundwater. This poster (paper) presents data and calculations of a consultant's ''virtual every day'' work in order to assess the risk of groundwater contamination at a former dry cleaner site. (orig.)
Williams, Dustin K.; Stokes, Clare; Horenstein, Nicole A.; Papke, Roger L.
2009-01-01
We have shown previously that a highly conserved Tyr in the nicotinic acetylcholine receptor (nAChR) ligand-binding domain (LBD) (α7 Tyr188 or α4 Tyr195) differentially regulates the activity of acetylcholine (ACh) and the α7-selective agonist 3-(4-hydroxy,2-methoxybenzylidene)anabaseine (4OH-GTS-21) in α4β2 and α7 nAChR. In this study, we mutated two highly conserved LBD Trp residues in human α7 and α4β2 and expressed the receptors in Xenopus laevis oocytes. α7 Re...
Energy Technology Data Exchange (ETDEWEB)
NONE
2013-05-15
The site descriptive model (SDM) presented in this report is an integrated model for bedrock geology, rock mechanics, bedrock hydrogeology and bedrock hydrogeochemistry of the site investigated in the SFR extension project (PSU). A description of the surface system is also included in the report. However, the surface system is not integrated with the other disciplines as new data regarding the surface system will not be available until after the completion of SDM-PSU. It is noted that SDM-PSU does not include all disciplines handled in SDM-Site Forsmark (SKB 2008b), the focus is to produce a site description that meets the needs of the SFR extension project. The overall objective of the SFR extension project is to have the application for the extension ready by 2013. This report presents an integrated site model incorporating the historic data acquired from the investigations for and construction of the existing SFR facility (1980-1986), as well as from the recent investigations for the planned extension of SFR (2008-2009). It also provides a summary of the abundant underlying data and the discipline-specific models that support the integrated site model. The description relies heavily on background reports concerning detailed data analyses and modelling in the different disciplines. It is noteworthy that the investigations conducted during the SFR extension project were guided by the choice of site prior to the investigations, which was based on the experience gained during the construction of the existing SFR facility.
International Nuclear Information System (INIS)
2013-05-01
The site descriptive model (SDM) presented in this report is an integrated model for bedrock geology, rock mechanics, bedrock hydrogeology and bedrock hydrogeochemistry of the site investigated in the SFR extension project (PSU). A description of the surface system is also included in the report. However, the surface system is not integrated with the other disciplines as new data regarding the surface system will not be available until after the completion of SDM-PSU. It is noted that SDM-PSU does not include all disciplines handled in SDM-Site Forsmark (SKB 2008b), the focus is to produce a site description that meets the needs of the SFR extension project. The overall objective of the SFR extension project is to have the application for the extension ready by 2013. This report presents an integrated site model incorporating the historic data acquired from the investigations for and construction of the existing SFR facility (1980-1986), as well as from the recent investigations for the planned extension of SFR (2008-2009). It also provides a summary of the abundant underlying data and the discipline-specific models that support the integrated site model. The description relies heavily on background reports concerning detailed data analyses and modelling in the different disciplines. It is noteworthy that the investigations conducted during the SFR extension project were guided by the choice of site prior to the investigations, which was based on the experience gained during the construction of the existing SFR facility
Gradstein, F.M.; Ogg, J.G.; Hilgen, F.J.
2012-01-01
This report summarizes the international divisions and ages in the Geologic Time Scale, published in 2012 (GTS2012). Since 2004, when GTS2004 was detailed, major developments have taken place that directly bear and have considerable impact on the intricate science of geologic time scaling. Precam
Association of AADAC Deletion and Gilles de la Tourette Syndrome in a Large European Cohort
DEFF Research Database (Denmark)
Bertelsen, Birgitte; Stefánsson, Hreinn; Riff Jensen, Lars
2016-01-01
BACKGROUND: Gilles de la Tourette syndrome (GTS) is a complex neuropsychiatric disorder with a strong genetic influence where copy number variations are suggested to play a role in disease pathogenesis. In a previous small-scale copy number variation study of a GTS cohort (n = 111), recurrent exon...
International Nuclear Information System (INIS)
1990-03-01
The Gas Research Institute (GRI) has embarked on a multi-year program to address the Management of Manufactured Gas Plant (MGP) Sites. The program focuses on three primary technical areas: site investigation, risk assessment, and site restoration. Program activities in each of these areas are separated into two phases. Phase 1 emphasizes the identification, collation, and analysis of the state-of-the-art applicable to specific MGP site situations. Phase 2 involves the generation of data through targeted research and development projects. The second phase of the program is producing a series of topical reports, such as this one, from laboratory and field experimental test programs. These programs are designed to fill data gaps required for the effective management of these sites and to advance the state-of-the-art for technologies determined during Phase 1 as potentially applicable to MGP site wastes. Other reports from the second phase will continue to be produced through 1991 as various portions of the program are completed
Gilles de la Tourette syndrome - A treatable condition?
Hartmann, A; Martino, D; Murphy, T
Gilles de la Tourette syndrome (GTS) is a neurodevelopmental disorder characterized by chronic motor and vocal tics. Psychiatric comorbidity is frequent but does not enter into the official classification of the syndrome. In the present article, we will focus on treatment options for tics. We have reviewed the relevant literature on treatment of tics and GTS, especially in the period from 2011-2016 since the publication of the European Society for the Study of Tourette Syndrome (ESSTS) treatment guidelines in 2011. We present current and up-to-date approaches in psychotherapy, pharmacotherapy and neurosurgery for GTS with an outlook for the upcoming years. Although many patients and health-care professionals seem to view tics and/or GTS as difficult to treat, or believe that treatment requires severe side effects with reduction in quality of life, we wish to convey that there is cause for optimism, both with regard to available treatment modalities and future therapeutic developments. Copyright © 2016. Published by Elsevier Masson SAS.
International Nuclear Information System (INIS)
1985-06-01
The Low-Level Radioactive Waste Policy Act of 1980 assigns to the states the responsibility for disposal of the low-level radioactive waste generated within their boundaries. It also provides for regional compacts among states to address their needs on a broader basis and permits restriction of the use of regional disposal facilities after January 1, 1986, to generators of low-level waste within the region. Each state, either individually or as a member of a compact, must therefore consider the establishment of a low-level radioactive waste disposal facility within its borders. The states of Arkansas, Kansas, Louisiana, Nebraska, and Oklahoma adopted the Central Interstate Low-Level Waste Compact (CILLWC) and legislation was submitted to Congress for consent in June of 1983 legislation is being reintroduced in the 99th Congress. In August of 1984, the CILLWC selected and contracted Dames and Moore to conduct a Phase I-Site Suitability Screening Study for a low-level radioactive waste disposal facility in the five-state region. This report presents the results of the Phase I Screening Study. Dames and Moore reported to the Technical Advisory Committee (TAC) of the CILLWC which provided guidance and comment on work progress and direction
Natural phenomena hazards project for Department of Energy sites
International Nuclear Information System (INIS)
Coats, D.W.
1985-01-01
Lawrence Livermore National Laboratory (LLNL) has developed seismic and wind hazard models for the Office of Nuclear Safety (ONS), Department of Energy (DOE). The work is part of a three-phase effort aimed at establishing uniform building design criteria for seismic and wind hazards at DOE sites throughout the United States. In Phase 1, LLNL gathered information on the sites and their critical facilities, including nuclear reactors, fuel-reprocessing plants, high-level waste storage and treatment facilities, and special nuclear material facilities. In Phase 2, development of seismic and wind hazard models, was initiated. These hazard models express the annual probability that the site will experience an earthquake or wind speed greater than some specified magnitude. In the final phase, it is anticipated that the DOE will use the hazard models to establish uniform criteria for the design and evaluation of critical facilities. 13 references, 2 figures, 1 table
International Nuclear Information System (INIS)
Powell, M.R.; Combs, W.H.; Farmer, J.R.; Gladki, H.; Hatchell, B.K.; Johnson, M.A.; Poirier, M.R.; Rodwell, P.O.
1999-01-01
Pacific Northwest National Laboratory (PNNL) performed mixer tests using 3-kW (4-hp) Flygt mixers in 1.8- and 5.7-m-diameter tanks at the 336 building facility in Richland, Washington to evaluate candidate scaling relationships for Flygt mixers used for sludge mobilization and particle suspension. These tests constituted the second phase of a three-phase test program involving representatives from ITT Flygt Corporation, the Savannah River Site (SRS), the Oak Ridge National Laboratory (ORNL), and PNNL. The results of the first phase of tests, which were conducted at ITT Flygt's facility in a 0.45-m-diameter tank, are documented in Powell et al. (1999). Although some of the Phase B tests were geometrically similar to selected Phase A tests (0.45-m tank), none of the Phase B tests were geometrically, cinematically, and/or dynamically similar to the planned Tank 19 mixing system. Therefore, the mixing observed during the Phase B tests is not directly indicative of the mixing expected in Tank 19 and some extrapolation of the data is required to make predictions for Tank 19 mixing. Of particular concern is the size of the mixer propellers used for the 5.7-m tank tests. These propellers were more than three times larger than required by geometric scaling of the Tank 19 mixers. The implications of the lack of geometric similarity, as well as other factors that complicate interpretation of the test results, are discussed in Section 5.4
Methodology of site protection studies
International Nuclear Information System (INIS)
Farges, L.
1980-01-01
Preliminary studies preceding building of a nuclear facility aim at assessing the choice of a site and establishing operating and control procedures. These studies are of two types. Studies on the impact of environment on the nuclear facility to be constructed form one type and studies on the impact of nuclear facilities on the environment form the second type. A methodology giving a framework to studies of second type is presented. These studies are undertaken to choose suitable sites for nuclear facilities. After a preliminary selection of a site based on the first estimate, a detailed site study is undertaken. The procedure for this consists of five successive phases, namely, (1) an inquiry assessing the initial state of the site, (2) an initial synthesis of accumulated information for assessing the health and safety consequences of releases, (3) laboratory and field studies simulating the movement of waste products for a quantitative assessment of effects, (4) final synthesis for laying down the release limits and radiological control methods, and (5) conclusions based on comparing the data of final synthesis to the limits prescribed by regulations. These five phases are outlined. Role of periodic reassessments after the facility is in operation for same time is explained. (M.G.B.)
DEFF Research Database (Denmark)
Padmanabhuni, Shanmukha S; Houssari, Rayan; Esserlind, Ann-Louise
2016-01-01
Gilles de la Tourette syndrome (GTS) is a neuropsychiatric disorder characterized by multiple motor and vocal tics. GTS is a complex disorder, with environmental factors and several genes involved. Although variations within a few genes such as AADAC, NRXN1, SLITRK1, HDC, and IMMP2L have been...
Gilles de la Tourette's Syndrome in Childhood: A Guide for School Professionals.
Walter, Abbe L.; Carter, Alice S.
1997-01-01
Gilles de la Tourette's Syndrome (GTS) is considered a neuropsychiatric condition characterized by multiple motor and vocal tics. With some cases, a variety of neurocognitive, social, and emotional difficulties are present. Describes core features of GTS and highlights how symptoms and their features may interfere with school functioning. School…
International Nuclear Information System (INIS)
Kageyama, Hitoshi; Suzuki, Shinji; Hirose, Ikuro; Yoshioka, Tatsuji
2014-06-01
In late years, local participation policies are being adopted in foreign countries at site selection for the disposal of the radioactive waste. We performed documents investigation about the examples of the site selection processes of Belgium, the U.K., and Switzerland to establish the site selection policy in Japan. In Belgium, after the failure of the site selection for the disposal of short-lived low and intermediate level radioactive waste (LILW) in an early stage, the idea of the local partnership (LP) was developed and three independent LPs were established between the implementing body and each municipality. About 7 years later, one site was decided as the disposal site in the cabinet meeting of the federal government. In the U.K., after the failure of the site selection for the rock characterization facility, the government policy was changed and the consultation process comprised of six phases was started. Though the process had been carried out for over 4 years since one combined partnership was established between the implementing body and the municipalities involved, they had to withdraw from the consulting process because a county council had not accepted that the process would step forward to the 4th phase. In Switzerland, the implementing body selected one site for LILW disposal at an early stage, but the project was denied by the referendum in the Canton having jurisdiction over the site area. After that the Federal Parliament established new Nuclear Energy Act and Nuclear Energy Ordinance precluding the veto of Canton. Now the site selection project is being carried out according to the process comprised of three phases with local participation policy. Reviewing the merits and demerits of each example through this investigation, we confirmed if we are to adopt local participation policy in our country in future, further prudent study would be necessary, considering current and future social conditions in Japan. (author)
TWRS privatization phase 1 monitoring wells engineering study
International Nuclear Information System (INIS)
Williams, B.A.; Newcomer, D.R.
1998-04-01
This engineering study provides an evaluation of existing wells and boreholes (wells) within the proposed location for the Tank Waste Remediation System (TWRS) Privatization Phase 1 demonstration site. Phase 1 is part of the TWRS program that was established to manage, retrieve, treat, immobilize, and dispose of high-level waste stored in underground tanks at the Hanford Site. This evaluation is to determine which wells will remain active within the demonstration site based on regulatory, programmatic, or other beneficial use requirements. An initial evaluation of wells within the demonstration site was conducted in 1996. However, changes in construction plans and expansion of the demonstration site necessitated a reevaluation and reclassification of the wells that are within the expanded site. Impacted wells include many of those previously evaluated as well as additional wells identified in or near the expansion areas. Thirty-three wells exist within and immediately adjacent to the identified boundary of the proposed demonstration site. The wells identified for decommissioning will be abandoned according to the well decommissioning plan. Future well requirements within the site include replacement wells for those wells impacted by construction activities, replacements for Resource Conservation and Recovery Act of 1976 (RCRA) wells going dry, and a new characterization well installed to support a TWRS Phase 2 site assessment
International Nuclear Information System (INIS)
1977-10-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Maybell, Colorado. The Phase II-Title I services include the preparation of topographic maps, the performance of core drillings sufficient to determine areas and volumes of tailings and radiometric measurements to determine radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 2.6 million tons of tailings at the Maybell site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The three alternative actions presented range from fencing and maintenance (Option I), to placing the tailings in an open-pit mine and adding 2 ft of stabilization cover material (Option III). Cost estimates for the three options range from $250,000 to $4,520,000. Reprocessing the tailings for uranium does not appear to be economically attractive at present
Al-Amoodi, Asma S.
2017-05-01
Recruitment of circulating cells towards target sites is primarily dependent on E-selectin receptor/ligand adhesive interactions. Glycosyltransferase (GTs) are involved in the creation of E-selectin ligands. A sialofucosylated terminal tetrasaccharide like glycan structure known as sialyl Lewis x (sLex), is the most recognized ligand by selectins. This structure is found on the surface of cancer cells and leukocytes but is often absent on the surface of many adult stem cell populations. In order to synthesize sLex, GTs must be endogenously expressed and remain active within the cells. Generally, these stem cells express terminal sialylated lactosamine structures on their glycoproteins which require the addition of alpha-(1,3)-fucose to be converted into an E-selectin ligand. There are a number of fucosyltransferases (FUTs) that are able to modify terminal lactosamine structures to create sLex such as FUT6. In this work we focused on expressing and purifying active recombinant FUTs as a tool to help create sLex structures on the surface of adult stem cells in order to enhance their migration.
Remedial Action Report for Operable Units 6-05 and 10-04, Phase III
Energy Technology Data Exchange (ETDEWEB)
R. P. Wells
2007-08-15
This Phase III remedial action report addresses the remediation of lead-contaminated soils found at the Security Training Facility STF-02 Gun Range at the Idaho National Laboratory Site. Phase I, consisting of developing and implementing institutional controls at Operble Unit 10-04 sites and developing and implementing Idaho National Laboratory Site-wide plans for both institutional controls and ecological monitoring, was addressed in a previous report. Phase II will remediate sites contaminated with trinitrotoluene and Royal Demolition Explosive. Phase IV will remediate hazards from unexploded ordnance.
Perkins, David Nikolaus; Brost, Randolph; Ray, Lawrence P.
2017-08-08
Various technologies for facilitating analysis of large remote sensing and geolocation datasets to identify features of interest are described herein. A search query can be submitted to a computing system that executes searches over a geospatial temporal semantic (GTS) graph to identify features of interest. The GTS graph comprises nodes corresponding to objects described in the remote sensing and geolocation datasets, and edges that indicate geospatial or temporal relationships between pairs of nodes in the nodes. Trajectory information is encoded in the GTS graph by the inclusion of movable nodes to facilitate searches for features of interest in the datasets relative to moving objects such as vehicles.
Ground Truth Studies - A hands-on environmental science program for students, grades K-12
Katzenberger, John; Chappell, Charles R.
1992-01-01
The paper discusses the background and the objectives of the Ground Truth Studies (GTSs), an activity-based teaching program which integrates local environmental studies with global change topics, utilizing remotely sensed earth imagery. Special attention is given to the five key concepts around which the GTS programs are organized, the pilot program, the initial pilot study evaluation, and the GTS Handbook. The GTS Handbook contains a primer on global change and remote sensing, aerial and satellite images, student activities, glossary, and an appendix of reference material. Also described is a K-12 teacher training model. International participation in the program is to be initiated during the 1992-1993 school year.
Application of guideline for the maintenance of guide tubes
International Nuclear Information System (INIS)
Matsubara, Toru
2009-01-01
Control Rod Cluster Guide Tubes (GTs) in PWR nuclear plant have the possibility to be worn due to fluid induced vibration of Control Rod Clusters. The maintenance rules for GTs had been established after the discussion with experts, and GTs in Japanese PWR plants have been already maintained in accordance with these maintenance rules. In these rules, the inspection period is decided based on the wear data and the wear progressing prediction with the assumption of constant wear speed. This paper describes the validity of the concepts about maintenance period based on the wear progressing prediction, by using the consecutive inspection data of actual plants. (author)
International Nuclear Information System (INIS)
1977-11-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at Durango, Colorado. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 1.555 million tons of tailings at the Durango site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The eight alternative actions presented range from vegetative stabilization (Option I), to contouring and stabilizing in-place with varying depths of cover material (Options II and III), to removal to an isolated long-term disposal site (Options V to VIII). All options include remedial action costs for offsite locations where tailings have been placed. Costs estimated for the eight options range from $4,340,000 to $13,590,000. Reprocessing the tailings for uranium is sufficiently economically attractive to justify reprocessing in conjunction with each of the options
International Nuclear Information System (INIS)
Eddy Dilek, C.A.; Jarosch, T.R.; Fliermans, C.B.; Looney, B.B.; Parker, W.H.
1993-08-01
The overall objective of the Integrated Demonstration Project for the Remediation of Organics at Nonarid Sites at the Savannah River Site (SRS) is to evaluate innovative remediation, characterization, and monitoring systems to facilitate restoration of contaminated sites. The first phase of the demonstration focused on the application and development of in situ air stripping technologies to remediate sediments and groundwater contaminated with volatile organic compounds (VOCs). The second phase focused on the enhancement of the in situ air stripping process by adding selected nutrients to stimulate naturally occurring microorganisms that degrade VOCs. The purpose of the third phase was to evaluate the use of heating technologies [radio frequency (rf) and ohmic heating] to enhance the removal of contamination from clay layers where mass transfer is limited. The objective of this report is to document pretest and post-test data collected in support of the rf heating demonstration. The following data are discussed in this report: (1) a general description of the site including piezometers and sensors installed to monitor the remedial process; (2) stratigraphy, lithology, and a detailed geologic cross section of the study site; (3) tabulations of pretest and post-test moisture and VOC content of the sediments; (4) sampling and analysis procedures for sediment samples; (5) microbial abundance and diversity; (6) three-dimensional images of pretest and post-test contaminant distribution; (7) volumetric calculations
Shelley, B. P.; Robertson, M. M.; Turk, J.
2007-01-01
This is the first published case description in the current literature of the association of definite Gilles de la Tourette syndrome (GTS) and the Smith-Magenis syndrome (SMS), both confirmed by DSM-IV-TR criteria and molecular cytogenetic analysis, respectively. The co-occurrence of GTS, SMS and their common behavioural/neuropsychiatric…
A study on Z-phase nucleation in martensitic chromium steels
International Nuclear Information System (INIS)
Golpayegani, Ardeshir; Andren, Hans-Olof; Danielsen, Hilmar; Hald, John
2008-01-01
9-12% chromium martensitic steels are liable to the precipitation of Z-phase, Cr(V,Nb)N, after long time exposure at 550-650 deg. C. This complex nitride consumes vanadium nitrides and causes the creep strength of the material to fall drastically after several thousand hours of exposure. In this work, initial stages of precipitation of Z-phase have been studied and characterized using energy-filtered transmission electron microscopy (EFTEM). Vanadium nitrides were found to provide the most suitable nucleation site for Z-phase, since the misfit between the (0 0 1) planes of VN and Z-phase is very small. Furthermore, such a nucleation site would provide vanadium and nitrogen for the growth of Z-phase. The presence of niobium carbide has also been observed close to Z-phase nucleation sites, indicating niobium to be important for the nucleation and growth of Z-phase
Altered intrahemispheric structural connectivity in Gilles de la Tourette syndrome
Directory of Open Access Journals (Sweden)
Bastian Cheng
2014-01-01
Full Text Available Gilles de la Tourette syndrome (GTS is a common developmental neuropsychiatric disorder characterized by tics and frequent psychiatric comorbidities, often causing significant disability. Tic generation has been linked to disturbed networks of brain areas involved in planning, controlling and execution of actions, particularly structural and functional disorders in the striatum and cortico–striato–thalamo–cortical loops. We therefore applied structural diffusion tensor imaging (DTI to characterize changes in intrahemispheric white matter connectivity in cortico-subcortical circuits engaged in motor control in 15 GTS patients without psychiatric comorbidities. White matter connectivity was analyzed by probabilistic fiber tractography between 12 predefined cortical and subcortical regions of interest. Connectivity values were combined with measures of clinical severity rated by the Yale Global Tic Severity Scale (YGTSS. GTS patients showed widespread structural connectivity deficits. Lower connectivity values were found specifically in tracts connecting the supplementary motor areas (SMA with basal ganglia (pre-SMA–putamen, SMA–putamen and in frontal cortico-cortical circuits. There was an overall trend towards negative correlations between structural connectivity in these tracts and YGTSS scores. Structural connectivity of frontal brain networks involved in planning, controlling and executing actions is reduced in adult GTS patients which is associated with tic severity. These findings are in line with the concept of GTS as a neurodevelopmental disorder of brain immaturity.
Directory of Open Access Journals (Sweden)
Ha-Neui Kim
2012-01-01
Full Text Available When we evaluated changes of glial fibrillary acidic protein (GFAP and two glutamate transporter (GTs by immunohistochemistry, expression of GFAP showed a significant increase in complete Freund's adjuvant (CFA-injected rats; however, this expression was strongly inhibited by electroacupuncture (EA stimulation. Robust downregulation of glutamate-aspartate transporter (GLAST and glutamate transporter-1 (GLT-1 was observed in CFA-injected rats; however, EA stimulation resulted in recovery of this expression. Double-labeling staining showed co-localization of a large proportion of GLAST or GLT-1 with GFAP. Using Western blot, we confirmed protein expression of two GTs, but no differences in the mRNA content of these GTs were observed. Because EA treatment resulted in strong inhibition of CFA-induced proteasome activities, we examined the question of whether thermal sensitivities and GTs expression could be regulated by proteasome inhibitor MG132. CFA-injected rats co-treated with EA and MG132 showed a significantly longer thermal sensitivity, compared with CFA-injected rats with or without MG132. Both EA and MG132 blocked CFA-induced GLAST and GLT-1 downregulation within the spinal cord. These results provide evidence for involvement of GLAST and GLT-1 in response to activation of spinal astrocytes in an EA antinociceptive effect. Antinociceptive effect of EA may be induced via proteasome-mediated regulation of spinal GTs.
Topoisomerase I tyrosine phosphorylation site and the DNA-interactive site
International Nuclear Information System (INIS)
Roll, D.; Durban, E.
1986-01-01
Phosphorylation of topoisomerase I (topo I) at serine by NII kinase is accompanied by stimulation of enzymatic activity. In contrast, phosphorylation at tyrosine by tyrosine kinase seems to inhibit enzymatic activity. This inhibition may be caused by interference of the phosphorylated tyrosine residue with the interaction of topo I with DNA. To test this, topo I was labeled with crude membrane fraction enriched for EGF-receptor kinase in presence of γ-P32-ATP and electrophoresed on SDS-polyacrylamide gels. Stained topo I bands were excised, dried, digested with trypsin and analyzed on a C18 reverse-phase HPLC column. One major peak of radioactivity eluted at fraction 23 with 20% acetonitrile. To obtain the DNA-interactive site, topo I was incubated with pBR322 DNA labeled by nick-translation followed by DNase I treatment, and electrophoresis on SDS-polyacrylamide gels. Tryptic peptides were generated and analyzed by reverse-phase HPLC. A major peak of radioactivity eluted at fraction 16-18 with 15.5-17% acetonitrile. Studies are in progress to resolve whether (a) the two peptides are different, i.e. the tyrosine-P site and DNA-tyrosine interactive site are localized at different regions of the topo I or (b) the peptide sequences are identical but the covalent attachment of deoxynucleotides altered the peptide's elution from the HPLC column
Evaluation of the impact of a committed site on fusion reactor development
International Nuclear Information System (INIS)
Reid, R.L.; Nagy, A.
1979-01-01
The technical and economic merits of a committed fusion site for development of tokamak, mirror, and EBT reactor from ignition through demo phases were evaluated. Schedule compression resulting from evolving several reactor concepts and/or phases on a committed site as opposed to sequential use of independent sites was estimated. Land, water, and electrical power requirements for a committed fusion site were determined. A conceptual plot plan for siting three fusion reactors on a committed site was configured. Reactor support equipment common to the various concepts was identified as candidates for sharing. Licensing issues for fusion plants were briefly addressed
Phase two of Site 300's ecological risk assessment: Model verification and risk management
International Nuclear Information System (INIS)
Carlson, T.M.; Gregory, S.D.
1995-01-01
The authors completed the baseline ecological risk assessment (ERA) for Lawrence Livermore National Laboratory's Site 300 in 1993. Using data collection and modeling techniques adapted from the human health risk assessment (HRA), they evaluated the potential hazard of contaminants in environmental media to ecological receptors. They identified potential hazards to (1) aquatic invertebrates from heavy metal contaminants in surface water, (2) burrowing vertebrates from contaminants volatilizing from subsurface soil into burrow air, and (3) grazing deer and burrowing vertebrates from cadmium contamination in surface soil. They recently began collecting data to refine the estimates of potential hazard to these ecological receptors. Bioassay results form the surface water failed to verify a hazard to aquatic invertebrates. Soil vapor surveys of subsurface burrows did verify the presence of high concentrations of volatile organic compounds (VOCs). However, they have not yet verified a true impact on the burrowing populations. The authors also completed an extensive surface soil sampling program, which identified local hot spots of cadmium contamination. In addition, they have been collecting data on the land use patterns of the deer population. Their data indicate that deer do not typically use those areas with cadmium surface soil contamination. Information from this phase of the ERA, along with the results of the HRA, will direct the selection of remedial alternatives for the site. For the ecological receptors, remedial alternatives include developing a risk management program which includes ensuring that (1) sensitive burrowing species (such as rare or endangered species) do not use areas of surface or subsurface contamination, and (2) deer populations do not use areas of surface soil contamination
Yurtbasi, Metin
2016-01-01
This study deals with a special methodology to meet the special needs of Turkish gifted and talented students (GTS) in terms of improving their English oral proficiency. Most GTS are known to have been born also "gifted in languages". Their language awareness shows by their "communicative skills, creative flair and arguing and…
Directory of Open Access Journals (Sweden)
K.M. Vasyliv
2013-04-01
Full Text Available By means of a mathematical experiment, electromagnetic and electromechanical processes in an independent electric power supply system based on an asynchronized generator with a three-phase modulated exciter are investigated. The processes are analyzed to specify the working capacity of the power supply system during its operation to an induction motors site. Regularities of the electromagnetic and electromechanical processes behavior versus load intensity and the switch control system parameters are identified.
Sex-related and non-sex-related comorbidity subtypes of tic disorders: a latent class approach.
Rodgers, S; Müller, M; Kawohl, W; Knöpfli, D; Rössler, W; Castelao, E; Preisig, M; Ajdacic-Gross, V
2014-05-01
Recent evidence suggests that there may be more than one Gilles de la Tourette syndrome (GTS)/tic disorder phenotype. However, little is known about the common patterns of these GTS/tic disorder-related comorbidities. In addition, sex-specific phenomenological data of GTS/tic disorder-affected adults are rare. Therefore, this community-based study used latent class analyses (LCA) to investigate sex-related and non-sex-related subtypes of GTS/tic disorders and their most common comorbidities. The data were drawn from the PsyCoLaus study (n = 3691), a population-based survey conducted in Lausanne, Switzerland. LCA were performed on the data of 80 subjects manifesting motor/vocal tics during their childhood/adolescence. Comorbid attention-deficit hyperactivity disorder (ADHD), obsessive-compulsive disorder, depressive, phobia and panic symptoms/syndromes comprised the selected indicators. The resultant classes were characterized by psychosocial correlates. In LCA, four latent classes provided the best fit to the data. We identified two male-related classes. The first class exhibited both ADHD and depression. The second class comprised males with only depression. Class three was a female-related class depicting obsessive thoughts/compulsive acts, phobias and panic attacks. This class manifested high psychosocial impairment. Class four had a balanced sex proportion and comorbid symptoms/syndromes such as phobias and panic attacks. The complementary occurrence of comorbid obsessive thoughts/compulsive acts and ADHD impulsivity was remarkable. To the best of our knowledge, this is the first study applying LCA to community data of GTS symptoms/tic disorder-affected persons. Our findings support the utility of differentiating GTS/tic disorder subphenotypes on the basis of comorbid syndromes. © 2013 The Author(s) European Journal of Neurology © 2013 EFNS.
Directory of Open Access Journals (Sweden)
Pei-Ling Hsu
2018-01-01
Full Text Available Ganoderma mushrooms, used in traditional Chinese medicine to promote health and longevity, have become widely accepted as herbal supplements. Ganoderma lucidum (GL, a commonly seen ganoderma species, is commercially cultivated under controlled conditions for more consistent chemical composition. The medicinal properties of GL are attributable to its antioxidant and anti-inflammatory activities. We intended to assess the effect of GL in atherosclerosis, an arterial condition associated with chronic oxidative stress and inflammation, using a carotid-artery-ligation mouse model. Flow turbulence created in the ligated artery induces oxidative stress and neointimal hyperplasia, a feature of early atherogenesis. Daily oral GL prevented neointimal thickening 2 weeks after ligation. Moreover, the ganoderma triterpenoid (GT crude extract isolated from GL abolished ligation-induced neointima formation. Mechanistically, endothelial dysfunction was observed 3 days after ligation before any structural changes could be detected. GTs alleviated the oxidative stress and restored the atheroresistent status of endothelium by inhibiting the induction of a series of atherogenic factors, including endothelin-1, von Willebrand factor, and monocyte chemoattractant protein-1 after 3-day ligation. The anti-inflammatory activity of GTs was tested in cultured human umbilical vein endothelial cells (HUVECs exposed to disturbed flow in an in vitro perfusion system. GTs abolished the induction of proinflammatory VCAM-1, TNF-α, and IL-6 by oscillatory shear stress. Moreover, the antioxidant activity of GTs was tested in HUVECs against the insult of H2O2. GTs dissipated the cellular superoxide accumulation imposed by H2O2, thereby mitigating H2O2-induced cell damage and proatherogenic response. Our results revealed the atheroprotective properties of ganoderma mushrooms and identified triterpenoids as the critical constituents for those effects. GTs prevent atherogenesis by
International Nuclear Information System (INIS)
Reinson, E.; Harvey, K.; Brooks, N.; Burton, K.; Reinson, K.; Cropley, K.
2010-05-01
This document described the second phase of an environmental site assessment (ESA) at a parking lot in front of the Flare and Derrik on Main Street in Turner Valley, Alberta. The objective of this ESA was to confirm the presence of any substances of concern. The site has been occupied by an outdoor ice rink, and there is pipeline right-of-way along the east portion of the site. There is also an abandoned crude oil pipeline along the east portion of the property and an abandoned natural gas pipeline on the west side of the property. This ESA investigated the impact of the pipelines, the underground storage tanks on the adjacent sites, and the oil and gas lease on the adjacent site. Seven exploratory testholes were drilled and 3 monitoring wells were installed. The study involved soil inspection and field VOC measurements every 60 centimeters, or as required. Groundwater sampling and surveying was also performed. Groundwater and soil samples were analyzed for hydrocarbons, polycyclic aromatic hydrocarbons (PAHs), salinity and metals. All the results for soil were below Tier 1 guidelines. There appeared to be a layer of clay fill which had some hydrocarbons, PAHs and barium present, but they were below the applicable criteria. In terms of groundwater, PAHs and selenium exceeded the Tier 1 guidelines in monitoring well no. 4 (MW4). In another well, manganese exceeded the Tier 1 guidelines. Copper exceeded the Tier 1 guidelines in all three wells. All the results were below the Tier 2 guidelines in all 3 wells with the exception of carcinogenic PAHs (B(a)P TPE) in MW4. Due to the minor presence of hydrocarbons (below criteria) located in the surficial soil layer, Ballast Environmental Consultants recommended that an environmental professional be present during the excavation and that further soil samples be taken from the suspect layer to confirm all the soils in the area of the library are below the applicable criteria. refs., tabs., figs.
Energy Technology Data Exchange (ETDEWEB)
Reinson, E.; Harvey, K.; Brooks, N.; Burton, K.; Reinson, K.; Cropley, K. [Ballast Environmental Consultants Ltd., Calgary, AB (Canada)
2010-05-15
This document described the second phase of an environmental site assessment (ESA) at a parking lot in front of the Flare and Derrik on Main Street in Turner Valley, Alberta. The objective of this ESA was to confirm the presence of any substances of concern. The site has been occupied by an outdoor ice rink, and there is pipeline right-of-way along the east portion of the site. There is also an abandoned crude oil pipeline along the east portion of the property and an abandoned natural gas pipeline on the west side of the property. This ESA investigated the impact of the pipelines, the underground storage tanks on the adjacent sites, and the oil and gas lease on the adjacent site. Seven exploratory testholes were drilled and 3 monitoring wells were installed. The study involved soil inspection and field VOC measurements every 60 centimeters, or as required. Groundwater sampling and surveying was also performed. Groundwater and soil samples were analyzed for hydrocarbons, polycyclic aromatic hydrocarbons (PAHs), salinity and metals. All the results for soil were below Tier 1 guidelines. There appeared to be a layer of clay fill which had some hydrocarbons, PAHs and barium present, but they were below the applicable criteria. In terms of groundwater, PAHs and selenium exceeded the Tier 1 guidelines in monitoring well no. 4 (MW4). In another well, manganese exceeded the Tier 1 guidelines. Copper exceeded the Tier 1 guidelines in all three wells. All the results were below the Tier 2 guidelines in all 3 wells with the exception of carcinogenic PAHs (B(a)P TPE) in MW4. Due to the minor presence of hydrocarbons (below criteria) located in the surficial soil layer, Ballast Environmental Consultants recommended that an environmental professional be present during the excavation and that further soil samples be taken from the suspect layer to confirm all the soils in the area of the library are below the applicable criteria. refs., tabs., figs.
Kinetics of two-site immunoradiometric ('sandwich') assays
International Nuclear Information System (INIS)
Rodbard, D.; Feldman, Y.; Jaffe, M.L.; Miles, L.E.M.
1978-01-01
The mathematical model of the ideal two-site IRMA developed in the accompanying report, which assumes that both the first (solid phase) and second (labeled) antisera are 'homogeneous', fails to provide an explanation for the frequent occurrence of a paradoxical fall in the dose-response curve in the high-dose region ('high-dose hook effect'). Accordingly, the model has been extended in an attempt to provide a theoretical basis for these phenomena. Two mechanisms were considered: (A) heterogeneity of the first antiserum (which is bound to the solid phase), i.e. presence of two or more classes of sites with moderately to widely differing affinity constants; and (B) incomplete washing of the solid phase after the first reaction. This leads to an expanded system of five differential equations, five equations for conservation of mass, and fourteen rate constants. In the presence of a heterogeneous first antiserum, a high dose 'hook effect' will occur. Rapid dissociation of the ligand from the low affinity class of sites during the second 'wash' procedure will accentuate this effect. Thus, heterogeneity of binding sites is a sufficient explanation for the high-dose hook effect and is a likely mechanism in practice, since the antisera which are coupled to the solid phase have usually not been fractionated. The present studies also show that, even if dealing with homogeneous first antibody, one may still observe a high-dose hook effect if washing is incomplete after the first incubation with the antigen. Using computer simulation studies, factors affecting the magnitude of the 'high-dose hook effect' have been explored. (author)
Phase diagrams of site diluted ferromagnetic thin film
International Nuclear Information System (INIS)
Hamedoun, M.; Bouslykhane, K.; Bakrim, H.; Hourmatallah, A.; Benzakour, N.; Masrour, R.
2006-01-01
The phase transition properties of Ising, classical XY and Heisenberg of diluted ferromagnetic thin film are studied by the method of exact high-temperature series expansions extrapolated with the Pade approximants method. The reduced critical temperature τ c of the diluted ferromagnetic thin films is studied as a function of film thickness L and the exchange interactions in the bulk J b , in the surface J s and between surface and nearest-neighbour layer J - bar . It is found that τ c increases with the exchange interactions of surface and L. The magnetic phase diagram (τ c versus dilution x) is obtained. A critical value of the surface exchange interaction above which the surface magnetism appears is obtained. The dependence of the critical parameter of surface reduced coupling R 2 c as a function of the dilution x and the ratio of the exchange interaction between the surface and nearest-neighbour layer to the bulk one R 1 for the three studied models has been investigated. The percolation threshold is defined as the concentration x p at which τ c =0. The obtained values are x p ∼0.2 in the bulk and x p ∼0.4 at the surface
Directory of Open Access Journals (Sweden)
Andreas Hartmann
2016-09-01
Full Text Available In patients with severe, treatment-refractory Gilles de la Tourette syndrome (GTS, deep brain stimulation (DBS of various targets has been increasingly explored over the past 15 years. The multiplicity of surgical targets is intriguing and may be partly due to the complexity of GTS, specifically the various and frequent associated psychiatric comorbidities in this disorder. Thus, the target choice may not only be aimed at reducing tics but also comorbidities. While this approach is laudable, it also carries the risk to increase confounding factors in DBS trials and patient evaluation. Moreover, I question whether DBS should really be expected to alleviate multiple symptoms at a time. Rather, I argue that tic reduction should remain our primary objective in severe GTS patients and that this intervention may subsequently allow an improved psychotherapeutic and/or pharmacological treatment of comorbidities. Thus, I consider DBS in GTS not as a single solution for all our patients’ ailments but as a stepping stone to improved holistic care made possible by tic reduction.
Deep brain stimulation in Gilles de la Tourette syndrome: killing several birds with one stone?
Hartmann, Andreas
2016-01-01
In patients with severe, treatment-refractory Gilles de la Tourette syndrome (GTS), deep brain stimulation (DBS) of various targets has been increasingly explored over the past 15 years. The multiplicity of surgical targets is intriguing and may be partly due to the complexity of GTS, specifically the various and frequent associated psychiatric comorbidities in this disorder. Thus, the target choice may not only be aimed at reducing tics but also comorbidities. While this approach is laudable, it also carries the risk to increase confounding factors in DBS trials and patient evaluation. Moreover, I question whether DBS should really be expected to alleviate multiple symptoms at a time. Rather, I argue that tic reduction should remain our primary objective in severe GTS patients and that this intervention may subsequently allow an improved psychotherapeutic and/or pharmacological treatment of comorbidities. Thus, I consider DBS in GTS not as a single solution for all our patients’ ailments but as a stepping stone to improved holistic care made possible by tic reduction. PMID:27746910
Formation of target-specific binding sites in enzymes: solid-phase molecular imprinting of HRP
Czulak, J.; Guerreiro, A.; Metran, K.; Canfarotta, F.; Goddard, A.; Cowan, R. H.; Trochimczuk, A. W.; Piletsky, S.
2016-05-01
Here we introduce a new concept for synthesising molecularly imprinted nanoparticles by using proteins as macro-functional monomers. For a proof-of-concept, a model enzyme (HRP) was cross-linked using glutaraldehyde in the presence of glass beads (solid-phase) bearing immobilized templates such as vancomycin and ampicillin. The cross-linking process links together proteins and protein chains, which in the presence of templates leads to the formation of permanent target-specific recognition sites without adverse effects on the enzymatic activity. Unlike complex protein engineering approaches commonly employed to generate affinity proteins, the method proposed can be used to produce protein-based ligands in a short time period using native protein molecules. These affinity materials are potentially useful tools especially for assays since they combine the catalytic properties of enzymes (for signaling) and molecular recognition properties of antibodies. We demonstrate this concept in an ELISA-format assay where HRP imprinted with vancomycin and ampicillin replaced traditional enzyme-antibody conjugates for selective detection of templates at micromolar concentrations. This approach can potentially provide a fast alternative to raising antibodies for targets that do not require high assay sensitivities; it can also find uses as a biochemical research tool, as a possible replacement for immunoperoxidase-conjugates.Here we introduce a new concept for synthesising molecularly imprinted nanoparticles by using proteins as macro-functional monomers. For a proof-of-concept, a model enzyme (HRP) was cross-linked using glutaraldehyde in the presence of glass beads (solid-phase) bearing immobilized templates such as vancomycin and ampicillin. The cross-linking process links together proteins and protein chains, which in the presence of templates leads to the formation of permanent target-specific recognition sites without adverse effects on the enzymatic activity. Unlike
Directory of Open Access Journals (Sweden)
Miguel Ramos
2010-10-01
Full Text Available We describe the parameters that drive the design and modeling of the Rover Environmental Monitoring Station (REMS Ground Temperature Sensor (GTS, an instrument aboard NASA’s Mars Science Laboratory, and report preliminary test results. REMS GTS is a lightweight, low-power, and low cost pyrometer for measuring the Martian surface kinematic temperature. The sensor’s main feature is its innovative design, based on a simple mechanical structure with no moving parts. It includes an in-flight calibration system that permits sensor recalibration when sensor sensitivity has been degraded by deposition of dust over the optics. This paper provides the first results of a GTS engineering model working in a Martian-like, extreme environment.
Lavoie, Marc E; Leclerc, Julie; O'Connor, Kieron P
2013-02-01
Cognitive neuroscience and clinical psychology have long been considered to be separate disciplines. However, the phenomenon of brain plasticity in the context of a psychological intervention highlights the mechanisms of brain compensation and requires linking both clinical cognition and cognitive psychophysiology. A quantifiable normalization of brain activity seems to be correlated with an improvement of the tic symptoms after cognitive behavioral therapy in patients with Gilles de la Tourette syndrome (GTS). This article presents broad outlines of the state of the current literature in the field of GTS. We present our clinical research model and methodology for the integration of cognitive neuroscience in the psychological evaluation and treatment of GTS to manage chronic tic symptoms.
International Nuclear Information System (INIS)
1977-10-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at the two millsites in Slick Rock, Colorado. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals residing nearby, the investigation of site hydrology and meteorology, and the evaluation and costing of alternative corrective actions. The Union Carbide site has 350,000 tons of tailings and the North Continent site now owned by Union Carbide has 37,000 tons of tailings. Both tailings piles have been stabilized in accordance with regulations of the State of Colorado. Radon gas release from the tailings on the sites constitute the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The sparse population and relatively low radiation levels yield minimal immediate environmental impact. Hence the three alternative actions presented are directed towards restricting access to the sites (Option I), and returning the windblown tailings to the piles and stabilizing the piles with cover material (Option II), and consolidating the two piles on the UC site and stabilizing with 2 ft of cover (Option III). Fencing around the tailings piles is included in all options. Options II and III provide 2 ft of cover material on the tailings. Costs of the options range from $370,000 to $1,100,000. Reprocessing the tailings for uranium is not economically feasible
Effects of O in a binary-phase TiAl-Ti3Al alloy: from site occupancy to interfacial energetics
International Nuclear Information System (INIS)
Wei Ye; Xu Huibin; Zhou Hongbo; Zhang Ying; Lu Guanghong
2011-01-01
We have investigated site occupancy and interfacial energetics of a TiAl-Ti 3 Al binary-phase system with O using a first-principles method. Oxygen is shown to energetically occupy the Ti-rich octahedral interstitial site, because O prefers to bond with Ti rather than Al. The occupancy tendency of O in TiAl alloy from high to low is α 2 -Ti 3 Al to the γ-α 2 interface and γ-TiAl. We demonstrate that O can largely affect the mechanical properties of the TiAl-Ti 3 Al system. Oxygen at the TiAl-Ti 3 Al interface reduces both the cleavage energy and the interface energy, and thus weakens the interface strength but strongly stabilizes the TiAl/Ti 3 Al interface with the O 2 molecule as a reference. Consequently, the mechanical property variation of TiAl alloy due to the presence of O not only depends on the number of TiAl/Ti 3 Al interfaces but also is related to the O concentration in the alloy.
International Nuclear Information System (INIS)
1977-01-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at the Mexican Hat millsite in Utah. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals residing nearby, the investigation of site hydrology and meteorology, and the evaluation and costing of alternative corrective actions. Radon gas release from the 2,200,000 tons of tailings on the site constitutes the most significant environmental impact. The six alternative actions presented are directed towards restricting access to the site (Option I), returning the windblown tailings to the piles and stabilizing the piles with cover material (Options II, III, and IV), and consolidating the two piles into one pile and stabilizing it with cover material (Options V and VI). Fencing around the site or the tailings and the decontamination of mill buildings is included in all options. Options II and V provide 2 ft of cover material on the tailings, Options III, IV, and VI provide 4 ft, 13 ft, and 10 ft of cover, respectively. Costs of the options range from $370,000 to $4,390,000. Reprocessing the tailings for uranium is not feasible at present
DEFF Research Database (Denmark)
Saturnino, Guilherme Bicalho; Madsen, Kristoffer Hougaard; Siebner, Hartwig Roman
2017-01-01
oscillations in two connected cortical areas. While the frequency of ds-TACS is matched, the phase of stimulation is either identical (in-phase stimulation) or opposite (anti-phase stimulation) in the two cortical target areas. In-phase stimulation is thought to synchronize the endogenous oscillations...... and hereby to improve behavioral performance. Conversely, anti-phase stimulation is thought to desynchronize neural oscillations in the two areas, which is expected to decrease performance. Critically, in- and anti-phase ds-TACS should only differ with respect to temporal phase, while all other stimulation...... unambiguously the causal contribution of phase coupling to specific cognitive processes in the human brain....
Zheng, Ting; Jiang, Zhenggen; Wu, Jiagang
2016-07-28
Site engineering has been employed to modulate the piezoelectric activity of high temperature (1 -x)Bi1.05Fe1-yScyO3-xBaTiO3 lead-free ceramics fabricated by a conventional solid-state method together with a quenching technique. The effects of x and y content on the phase structure, microstructure, and electrical properties have been investigated in detail. A wide rhombohedral (R) to pseudo-cubic (C) phase boundary was formed in the ceramics with x = 0.30 and 0 ≤y≤ 0.07, thus leading to enhanced piezoelectricity (d33 = 120-180 pC N(-1)), ferroelectricity (Pr = 19-22 μC cm(-2)) and a high Curie temperature (TC = 478-520 °C). In addition, the influence of different element substitutions for Fe(3+) on phase structure and electrical behavior was also investigated. Improved piezoelectricity (d33 = 160-180 pC N(-1)) and saturated P-E loops can be simultaneously achieved in the ceramics with A = Sc, Ga, and Al due to the R-C phase boundary. As a result, site engineering may be an efficient way to modulate the piezoelectricity of BiFeO3-BaTiO3 lead-free ceramics.
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-09-01
The decision document presents the selected remedial action for the Southern Maryland Wood Treating Site (`the Site`), in Hollywood, Maryland. This is the second and final phase of remedial action for the Site. This phase addresses soil and sediment contamination and non-aqueous phase liquids (`NAPLs`) which are the principal threats remaining at the Site and are a source of contamination to the ground water and surface water.
Psychiatrists' and Psychiatry Residents' Attitudes Toward Transgender People.
Ali, Nareesa; Fleisher, William; Erickson, Julie
2016-04-01
Gender minority groups, such as transgender individuals, frequently encounter stigma, discrimination, and negative mental health outcomes, which can result in contact with mental health professionals. Recent studies suggest that negative attitudes toward transgender individuals are prevalent and measurable within the general population. The Genderism and Transphobia scale (GTS) measures anti-transgender feelings, thoughts, and behaviors. The purpose of this study was to use the GTS to conduct an investigation of psychiatrists' attitudes toward transgender individuals. A cross-sectional survey of n = 142 faculty members and residents from the Department of Psychiatry at the University of Manitoba was conducted. Respondents completed an online survey consisting of demographic questions and the GTS. Responses were analyzed descriptively and compared to previously published data on the GTS. There was a trend for psychiatrists and psychiatry residents within this sample to endorse less negative attitudes toward transgender people compared to other published data using a sample of undergraduate students. Descriptive analyses suggest that psychiatrists' and psychiatry residents' GTS scores may be related to gender identity, political ideology, religiosity, and levels of both professional and personal contact. These data evoke optimism regarding psychiatrists' and psychiatry residents' attitudes toward transgender individuals. Additional larger-scale studies comparing this medical specialty group with other specialty groups will further elucidate factors that modify physician attitudes toward this patient population. These findings may contribute to the development of educational strategies to ensure that the transgender population receives medical treatment without stigma or attitudinal compromise.
Program criteria for subseabed disposal of radioactive waste: site qualification plan
International Nuclear Information System (INIS)
Laine, E.P.; Anderson, D.R.; Hollister, C.D.
1982-05-01
This document describes the evolving methodology which is being used to identify, and study sites in subseabed geological formations which may be candidates for use as repositories for high-level nuclear waste. Two primary criteria guide all phases of this work: the stability and barrier criteria. The stability criterion defines areas of the seabed that are unlikely to be disturbed by tectonic forces and oceanographic changes durig the lifetime of a waste repository. The barrier criterion defines those subseabed geological formations most likely to form an effective barrier to the release of radionuclides. Because of the large area of the oceans, a phased approach has been adopted through which successively smaller areas of the sea floor are studied in ever greater detail. The first phase, which is complete, has identified abyssal clay deposits that are remote from tectonic boundaries and continental margins as being the regions (>10 5 km 2 ) on the sea floor within which acceptable sites might be most readily identified. The second phase involves downgrading less desirable areas (>10 4 km 2 ) within these regions, using archived seismic reflection profiling, sediment cores, and oceanographic data. This winnowing process identifies locations about one degree square (greater than or equal to 10 4 km 2 ) for more detailed field studies during the first part of the third phase. From these locations candidate sites (less than or equal to 10 4 km 2 ) will be chosen based on detailed geological and geophysical surveying. In the second part of the third phase, detailed monitoring of the candidate sites will begin to determine long-term baseline conditions. After monitoring is underway, a pilot repository will be established using waste canisters. Based on this work, a site selection/rejection report will be written. The fourth and last phase will involve extended monitoring of oceanographic conditions at each repository
Soil and groundwater remediation using dual-phase extraction technology
International Nuclear Information System (INIS)
Miller, A.W.; Gan, D.R.
1995-01-01
A gasoline underground storage tank (UST) was formerly used to fuel vehicles for a hospital in Madison, Wisconsin. Elevated concentrations of gasoline range organics (GRO) were observed in soils and groundwater at the site during the tank removal and a subsequent site investigation. Based on the extent of soil and groundwater contamination, a dual-phase extraction technology was selected as the most cost effective alternative to remediate the site. The dual-phase extraction system includes one extraction well functioning both as a soil vapor extraction (SVE) and groundwater recovery well. After six months of operation, samples collected from the groundwater monitoring wells indicated that the groundwater has been cleaned up to levels below the Wisconsin preventative action limits. The dual-phase extraction system effectively remediated the site in a short period of time, saving both operation and maintenance costs and overall project cost
Phase analysis in gated blood pool tomography. Detection of accessory conduction pathway
Energy Technology Data Exchange (ETDEWEB)
Nakajima, Kenichi; Bunko, Hisashi; Tada, Akira; Taki, Junichi; Nanbu, Ichiro (Kanazawa Univ. (Japan). School of Medicine)
1984-02-01
Phase analysis of gated blood pool study has been applied to detect the site of accessory conduction pathway (ACP) in the Wolff-Parkinson-White (WPW) syndrome; however, there was a limitation to detect the precise location of ACP by phase analysis alone. In this study, we applied phase analysis to gated blood pool tomography using seven pin hole tomography (7PT) and gated emission computed tomography (GECT) in 21 patients with WPW syndrome and 3 normal subjects. In 17 patients, the sites of ACPs were confirmed by epicardial mapping and the result of the surgical division of ACP. In 7PT, the site of ACP grossly agreed to the abnormal initial phase in phase image in 5 out of 6 patients with left cardiac type. In GECT, phase images were generated in short axial, vertical and horizontal long axial sections. In 8 out of 9 patients, the site of ACP was correctly identified by phase images, and in a patient who had two ACPs, initial phase corresponded to one of the two locations. Phase analysis of gated blood pool tomography has advantages for avoiding overlap of blood pools and for estimating three-dimensional propagation of the contraction, and can be a good adjunctive method in patients with WPW syndrome.
The SKI SITE-94 project approach to analyzing confidence in site-specific data
International Nuclear Information System (INIS)
Dverstorp, B.; Andersson, J.
1995-01-01
The ongoing SKI SITE-94 project is a fully integrated performance assessment based on a hypothetical repository at 500 m depth in crystalline rock. One main objective of the project is to develop a methodology for incorporating data from a site characterization into the performance assessment. The hypothetical repository is located at SKB's Hard Rock Laboratory at Aspo in south-eastern Sweden. The site evaluation in SITE-94 uses data from the pre-excavation phase that comprised measurements performed on the ground and in boreholes, including cross-hole hydraulic and tracer experiments. Uncertainties related to measurement technique, equipment and methods for interpretation were evaluated through a critical review of geohydraulic measurement methods and a complete re-evaluation of the hydraulic packer tests using the generalised radial flow (GRF) theory. Groundwater chemistry samples were analyzed for representativeness and sampling errors. A wide range of site models within geology, hydrogeology, geochemistry and rock mechanics has been developed and tested with the site characterization data. (authors). 10 refs., 3 figs., 2 tabs
E-FUSRAP: AUTOMATING THE CASE FILE FOR THE FORMERLY UTILIZED SITES REMEDIAL ACTION PROGRAM
International Nuclear Information System (INIS)
Mackenzie, D.; Marshall, K.
2003-01-01
The Department of Energy's (DOE) Office of Site Closure, EM-30, houses the document library pertaining to sites that are related to the Formerly Utilized Sites Remedial Action Program (FUSRAP) and regularly addresses ongoing information demands, primarily from Freedom of Information Act (FOIA) requests, interested members of the public, the DOE, and other Federal Agencies. To address these demands more efficiently, DOE has begun to implement a new multi-phase, information management process known as e-FUSRAP. The first phase of e-FUSRAP, the development of the Considered Sites Database, summarizes and allows public access to complex information on over 600 sites considered as candidates for FUSRAP. The second phase of e-FUSRAP, the development of the Document Indexing Database, will create an internal index of more than 10,000 documents in the FUSRAP library's case file, allowing more effective management and retrieval of case file documents. Together, the phases of e-FUSRAP will allow EM-30 to become an innovative leader in enhancing public information sources
Can I solve my structure by SAD phasing? Anomalous signal in SAD phasing.
Terwilliger, Thomas C; Bunkóczi, Gábor; Hung, Li Wei; Zwart, Peter H; Smith, Janet L; Akey, David L; Adams, Paul D
2016-03-01
A key challenge in the SAD phasing method is solving a structure when the anomalous signal-to-noise ratio is low. A simple theoretical framework for describing measurements of anomalous differences and the resulting useful anomalous correlation and anomalous signal in a SAD experiment is presented. Here, the useful anomalous correlation is defined as the correlation of anomalous differences with ideal anomalous differences from the anomalous substructure. The useful anomalous correlation reflects the accuracy of the data and the absence of minor sites. The useful anomalous correlation also reflects the information available for estimating crystallographic phases once the substructure has been determined. In contrast, the anomalous signal (the peak height in a model-phased anomalous difference Fourier at the coordinates of atoms in the anomalous substructure) reflects the information available about each site in the substructure and is related to the ability to find the substructure. A theoretical analysis shows that the expected value of the anomalous signal is the product of the useful anomalous correlation, the square root of the ratio of the number of unique reflections in the data set to the number of sites in the substructure, and a function that decreases with increasing values of the atomic displacement factor for the atoms in the substructure. This means that the ability to find the substructure in a SAD experiment is increased by high data quality and by a high ratio of reflections to sites in the substructure, and is decreased by high atomic displacement factors for the substructure.
Geothermal Well Site Restoration and Plug and Abandonment of Wells
Energy Technology Data Exchange (ETDEWEB)
Rinehart, Ben N.
1994-08-01
A report is presented on the final phase of an energy research program conducted by the U.S. Department of Energy (DOE) involving two geothermal well sites in the State of Louisiana-the Gladys McCall site and the Willis Hulin site. The research program was intended to improve geothermal technology and to determine the efficacy of producing electricity commercially from geopressured resource sites. The final phase of the program consisted of plug and abandonment (P&A) of the wells and restoration of the well sites. Restoration involved (a) initial soil and water sampling and analysis; (b) removal and disposal of well pads, concrete, utility poles, and trash; (c) plugging of monitor and freshwater wells; and (d) site leveling and general cleanup. Restoration of the McCall site required removal of naturally occurring radioactive material (NORM), which was costly and time-consuming. Exhibits are included that provide copies of work permits and authorizations, P&A reports and procedures, daily workover and current conditions report, and cost and salvage reports. Site locations, grid maps, and photographs are provided.
Characterisation of Radioactive Waste located at Shelter Industrial Site
International Nuclear Information System (INIS)
Brown, T.D.; Billon, F.; Rudko, V.M.; Batiy, V.G.; Panasyuk, N.I.
2001-04-01
As a result of the accident at the unit 4 reactor at the Chernobyl Nuclear Power Plant on the 26 April 1986 there was widespread radioactive contamination of the surrounding area. The area immediately surrounding Unit 4, referred to as the Industrial Site, was very heavily contaminated with fuel and core debris ejected from the reactor. Immediate action was undertaken to reduce the local radiation hazard and mitigate the potential of secondary contamination of the environment. This action involved (a) the removal and collection of fuel fragments (b) removal of the top layer of soil around unit 4 and (c) preparation of a new surface over the Industrial Site. This new surface is referred to colloquially as the Techno-genic Layer. This report provides an overview of a project undertaken for DG-Environment of European Commission by a Consortium consisting of SGN (France) and AEA Technology (UK) working in collaboration with the Organisation, National Academy of Sciences of Ukraine; the Interdisciplinary Scientific and Technical Centre Shelter''. The project consisted of 3 Phases and a total of 14 Tasks. The main purpose of Phase 1 was to review previous work and available information and data on the contamination of the Industrial Site, construction of the Techno-genic Layer, Buttress and Pioneer Walls. Phase 2 was directed at additional measurements being carried out on existing boreholes and core samples to improve and/or substantiate existing information and data. Estimation of likely radioactive waste arisings, recovery procedures and a generalised strategy with indicative costs for the management of the waste was also covered by Phase 2. In Phase 3 new boreholes (3 off) were drilled and subsequently investigated. The justification behind Phase 3 was the desire/need to obtain more reliable information on the so-called high-active waste buried in the Industrial Site. (author)
Early Site Permit Demonstration Program: Plant parameters envelope report
International Nuclear Information System (INIS)
1993-03-01
The Early Site Permit (ESP) Demonstration Program is the nuclear industry's initiative for piloting the early resolution of siting-related issues before the detailed design proceedings of the combined operating license review. The ESP Demonstration Program consists of three phases. The plant parameters envelopes task is part of Phase 1, which addresses the generic review of applicable federal regulations and develops criteria for safety and environmental assessment of potential sites. The plant parameters envelopes identify parameters that characterize the interface between an ALWR design and a potential site, and quantify the interface through values selected from the Utility Requirements Documents, vendor design information, or engineering assessments. When augmented with site-specific information, the plant parameters envelopes provide sufficient information to allow ESPs to be granted based on individual ALWR design information or enveloping design information for the evolutionary, passive, or generic ALWR plants. This document is expected to become a living document when used by future applicants
Topical Day on Site Remediation
Energy Technology Data Exchange (ETDEWEB)
Vandenhove, H [ed.
1996-09-18
Ongoing activities at the Belgian Nuclear Research Centre relating to site remediation and restoration are summarized. Special attention has been paid to the different phases of remediation including characterization, impact assessment, evaluation of remediation actions, and execution of remediation actions.
Environmental Survey preliminary report, Hanford Site, Richland, Washington
International Nuclear Information System (INIS)
1987-08-01
This report presents the preliminary findings from the first phase of the Environmental Survey of the United States Department of Energy (DOE) Hanford Site, conducted August 18 through September 5, 1986. The Survey is being conducted by an interdisciplinary team of environmental specialists, led and managed by the Office of Environment, Safety and Health's Office of Environmental Audit. Individual team components are being supplied by a private contractor. The objective of the Survey is to identify environmental problems and areas of environmental risk associated with the Hanford Site. The Survey covers all environmental media and all areas of environmental regulation. It is being performed in accordance with the DOE Environmental Survey Manual. This phase of the Survey involves the review of existing site environmental data, observations of the operations carried on at the Hanford Site, and interviews with site personnel. The Survey team developed a Sampling and Analysis Plan to assist in further assessing certain of the environmental problems identified during its on-site activities. The Sampling and Analysis Plan will be executed by a DOE National Laboratory or a support contractor. When completed, the results will be incorporated into the Environmental Survey Interim Report for the Hanford Site. The Interim Report will reflect the final determinations of the Hanford Site Survey. 44 refs., 88 figs., 74 tabs
Environmental Survey preliminary report, Hanford Site, Richland, Washington
Energy Technology Data Exchange (ETDEWEB)
1987-08-01
This report presents the preliminary findings from the first phase of the Environmental Survey of the United States Department of Energy (DOE) Hanford Site, conducted August 18 through September 5, 1986. The Survey is being conducted by an interdisciplinary team of environmental specialists, led and managed by the Office of Environment, Safety and Health's Office of Environmental Audit. Individual team components are being supplied by a private contractor. The objective of the Survey is to identify environmental problems and areas of environmental risk associated with the Hanford Site. The Survey covers all environmental media and all areas of environmental regulation. It is being performed in accordance with the DOE Environmental Survey Manual. This phase of the Survey involves the review of existing site environmental data, observations of the operations carried on at the Hanford Site, and interviews with site personnel. The Survey team developed a Sampling and Analysis Plan to assist in further assessing certain of the environmental problems identified during its on-site activities. The Sampling and Analysis Plan will be executed by a DOE National Laboratory or a support contractor. When completed, the results will be incorporated into the Environmental Survey Interim Report for the Hanford Site. The Interim Report will reflect the final determinations of the Hanford Site Survey. 44 refs., 88 figs., 74 tabs.
Energy Technology Data Exchange (ETDEWEB)
Brunsting, S.; Pol, M.; Paukovic, M. [ECN Policy Studies, Energy research Centre of the Netherlands ECN, Amsterdam (Netherlands); Kaiser, M.; Zimmer, R. [Unabhaengiges Institut fuer Umweltfragen UfU, Berlin (Germany); Shackley, S.; Mabon, L. [Scottish Carbon Capture and Storage SCCS, Edinburg, Scotland (United Kingdom); Hepplewhite, F.; Loveridge, R. [Energy Markets Unit, Scottish Government, Edinburg, Scotland (United Kingdom); Mazurowski, M.; Polak-Osiniak, D. [Polish Oil and Gas Company PGNiG, Warszawa (Poland); Rybicki, C. [AGH University of Science and Technology, Krakow (Poland)
2012-10-15
At local level, public support has proven crucial to the implementation of CO2 capture and storage (CCS) demonstration projects. Whereas no method exists to guarantee public acceptability of any project, a constructive stakeholder engagement process does increase the likelihood thereof. Social site characterisation can be used as an instrument to explore, plan and evaluate a process of active and constructive local stakeholder engagement in a prospective CCS project as a parallel activity to technical site characterisation. It roughly consists of a formative research phase to get acquainted with the area followed by a series of public information and engagement activities. This deliverable presents results from the first phase for the social site characterisations of a prospective CCS site in Poland (onshore) and the UK (offshore), using qualitative as well as quantitative research methods, as a first step to planning of local public engagement activities and evaluation of these activities that will be undertaken by this consortium at both sites in the near future. Although the term social site characterisation actually refers to the entire process of formative research and subsequent public outreach, and hence to the complete package of awareness work undertaken as part of SiteChar, in the present deliverable the term only refers to the formative research activities as undertaken up to now and as described in this deliverable. The qualitative part of the social site characterisation consisted of (1) a description of relevant social site characteristics such as local history; (2) interviews with relevant local stakeholders; (3) a media analysis of local newspapers. The quantitative part of the social site characterisation consisted of surveys using representative samples to characterise the local population in terms of awareness, knowledge and perceptions of CCS, felt involvement in decision making, extent of local activism, level of trust in representatives and
Structural contributions to the third-law entropy of uranyl phases
International Nuclear Information System (INIS)
Chen, F.; Ewing, R.C.
1999-01-01
Entropies that are used in geochemical calculations are usually based on calorimetric measurements. However, because of the contributions of neglected residual entropies which cannot be determined by calorimetric measurements, the true third-law entropies for many phases may be quite different from those derived from thermal data. The residual entropies are caused by site-mixing, structural disorder and magnetic spin disorder and may result in a considerable contribution to the third-law entropy of solid phases. Magnetic spin-configurational entropy is not expected to be significant in uranyl phases. However, because most uranyl phases are based on sheet or chain structures and usually contain several molecular water groups, site-mixing, vacancies, as well as disorder in the orientation of hydrogen bonds and the polar H 2 O molecules may occur. Calculations of the ideal site-mixing configurational entropy for some uranyl phases indicate that the residual contributions that arise from substitution and vacancies to the third-law entropies of uranyl phases may be large. A brief examination of the crystal chemistry of water molecules in uranyl phases suggests that considerable residual entropy may be caused by the disorder of hydrogen bonds associated with interstitial H 2 O groups
Geoscientific Characterization of the Bruce Site, Tiverton, Ontario
Raven, K.; Jackson, R.; Avis, J.; Clark, I.; Jensen, M.
2009-05-01
Ontario Power Generation is proposing a Deep Geologic Repository (DGR) for the long-term management of its Low and Intermediate Level Radioactive Waste (L&ILW) within a Paleozoic-age sedimentary sequence beneath the Bruce site near Tiverton, Ontario, Canada. The concept envisions that the DGR would be excavated at a depth of approximately 680 m within the Ordovician Cobourg Formation, a massive, dense, low- permeability, argillaceous limestone. Characterization of the Bruce site for waste disposal is being conducted in accordance with a four year multi-phase Geoscientific Site Characterization Plan (GSCP). The GSCP, initially developed in 2006 and later revised in 2008 to account for acquired site knowledge based on successful completion of Phase I investigations, describes the tools and methods selected for geological, hydrogeological and geomechanical site characterization. The GSCP was developed, in part, on an assessment of geoscience data needs and collection methods, review of the results of detailed geoscientific studies completed in the same bedrock formations found off the Bruce site, and recent international experience in geoscientific characterization of similar sedimentary rocks for long-term radioactive waste management purposes. Field and laboratory work related to Phase 1 and Phase 2A are nearing completion and have focused on the drilling, testing and monitoring of four continuously cored vertical boreholes through Devonian, Silurian, Ordovician and Cambrian bedrock to depths of about 860 mBGS. Work in 2009 will focus on drilling and testing of inclined boreholes to assess presence of vertical structure. The available geological, hydrogeological and hydrogeochemical data indicate the presence of remarkably uniform and predictable geology, physical hydrogeologic and geochemical properties over well separation distances exceeding 1 km. The current data set including 2-D seismic reflection surveys, field and lab hydraulic testing, lab petrophysical and
Angsten, Thomas; Asta, Mark
2018-04-01
Ground-state epitaxial phase diagrams are calculated by density functional theory (DFT) for SrTiO3, CaTiO3, and SrHfO3 perovskite-based compounds, accounting for the effects of antiferrodistortive and A -site displacement modes. Biaxial strain states corresponding to epitaxial growth of (001)-oriented films are considered, with misfit strains ranging between -4 % and 4%. Ground-state structures are determined using a computational procedure in which input structures for DFT optimizations are identified as local minima in expansions of the total energy with respect to strain and soft-mode degrees of freedom. Comparison to results of previous DFT studies demonstrates the effectiveness of the computational approach in predicting ground-state phases. The calculated results show that antiferrodistortive octahedral rotations and associated A -site displacement modes act to suppress polarization and reduce the epitaxial strain energy. A projection of calculated atomic displacements in the ground-state epitaxial structures onto soft-mode eigenvectors shows that three ferroelectric and six antiferrodistortive displacement modes are dominant at all misfit strains considered, with the relative contributions from each varying systematically with the strain. Additional A -site displacement modes contribute to the atomic displacements in CaTiO3 and SrHfO3, which serve to optimize the coordination of the undersized A -site cation.
The siting guidelines, 10 CFR Part 960
International Nuclear Information System (INIS)
Hanlon, C.L.
1991-01-01
The Siting Guidelines, 10 CFR Part 960, have played a major role in the U.S. Department of Energy's (the Department) Office of Civilian Radioactive Waste Management siting program since their development and implementation in response to the Nuclear Waste Policy Act of 1982. According to the Act, the Siting Guidelines were applicable to the selection of sites for characterization. The Nuclear Waste Policy Amendments Act of 1987 (the Amendments Act) has selected the Yucca Mountain, Nevada, site for characterization from among those nominated according to the Siting Guidelines. Thus, the Amendments Act has taken the repository program beyond the phase of Siting Guidelines applicability, making the U.S. Nuclear Regulatory Commission's 10 CFR Part 60 the applicable regulation. However, the Department has chosen to make use of aspects of the Siting Guidelines in the Site Characterization Plan for the Yucca Mountain Site. (author) 4 figs., 11 refs
International Nuclear Information System (INIS)
1977-01-01
Ford, Bacon and Davis Utah Inc. has performed an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at the Monument Valley millsite in Arizona. The Phase II, Title I services include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals residing nearby, the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the tailings on the site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The sparse population and relatively low radiation levels yield minimal immediate environmental impact; hence, the two alternative actions presented are directed towards restricting access to the site (Options I and II), and returning the windblown tailings to the pile and stabilizing the pile with 2 ft of cover material (Option II). Both options include remedial action costs for offsite locations where tailings have been placed. Cost estimates for the two options are $585,000 and $1,165,000. Reprocessing the tailings for uranium is not economically feasible
Directory of Open Access Journals (Sweden)
Cirbus Ján
2001-03-01
Full Text Available The paper is devoted to testing electrooptical distance measuring devices (EDM built in total stations, than can be used for various tasks in the contemporary geodetic works. A rich market offer and availability of these universal measuring systems with satisfying distance range, excellent accuracy and other parameters, make total stations as dominant terrestrial geodetic instruments.For succesfully applying these instruments, above all for relliable distance measurements, the stability of the modulation frequency is the most important pre-condition. In the article, therefore, there are given some methods to verify the modulation frequency stability. In addition, some ways for determining the EDM distance constant and periodical corrections of the phase measuring unit are introduced for 4 types of EDM : LEICA 1700L, TOPCON GTS6A, TOPCON GTS2, C.ZEISS ELTA50. It were also investigated their possibilities for precise distance survey. Values of the determined constants and periodical corrections are presented in Tab. 2.Based on the investigation results of the 4 EDM types and using the values m obtained for different distances S, equations of the a posteriori standard deviations in form : m = (a+b.S were derived too.
Double tracks test site characterization report
International Nuclear Information System (INIS)
1996-05-01
This report presents the results of site characterization activities performed at the Double Tracks Test Site, located on Range 71 North, of the Nellis Air Force Range (NAFR) in southern Nevada. Site characterization activities included reviewing historical data from the Double Tracks experiment, previous site investigation efforts, and recent site characterization data. The most recent site characterization activities were conducted in support of an interim corrective action to remediate the Double Tracks Test Site to an acceptable risk to human health and the environment. Site characterization was performed using a phased approach. First, previously collected data and historical records sere compiled and reviewed. Generalized scopes of work were then prepared to fill known data gaps. Field activities were conducted and the collected data were then reviewed to determine whether data gaps were filled and whether other areas needed to be investigated. Additional field efforts were then conducted, as required, to adequately characterize the site. Characterization of the Double Tracks Test Site was conducted in accordance with the US Department of Energy's (DOE) Streamlined Approach for Environmental Restoration (SAFER)
A study in usability: redesigning a health sciences library's mobile site.
Rosario, Jovy-Anne; Ascher, Marie T; Cunningham, Diana J
2012-01-01
A mobile site redesign was conducted at a medium-sized academic health sciences library with the goal of creating a site that meets the mobile information needs of its users. The redesign phases included (1) needs assessment, (2) usability testing, and (3) site design. The survey results showed that Apple devices were the most prevalent; the most desirable activities performed on a mobile site were searching for articles, accessing full-text articles and e-books, searching databases, and searching the catalog. These activities guided the development of the usability testing tasks and the redesign. All phases were completed within six months, and the total project cost was $50 for incentive purchases. Copyright © Taylor & Francis Group, LLC
Execution programme for the initial site investigations at Forsmark
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-05-01
In the feasibility studies that were completed in 2001, eight sites were identified as potentially suitable for hosting a repository. All the identified sites meet the safety requirements with respect to bedrock conditions that could be checked at that time. The feasibility studies have revealed good potential when it comes to the technical and environmental aspects as well. Based on an integrated evaluation SKB proposed to start site investigations with test drillings at three sites; Forsmark, Simpevarp and Tierp. Site investigations have started at Forsmark and Simpevarp. The municipal council of Tierp voted no to a site investigation in April 2002. The site investigations are divided into two main phases; initial and complete investigations. Initial site investigations are performed to identify the site within a specified area that is deemed to be most suitable for a deep repository and to determine whether the feasibility study's judgement of the suitability of the area holds up in the light of borehole data from repository depth. The initial site investigations are expected to take 1.5-2 years. If the assessment shows that the site has good potential to host a repository, complete site investigations will follow for an expected duration of 3.5-4 years. The purpose of the complete site investigations is to gather all information required to select one of the sites as the main alternative and to apply for a permit for construction of the deep repository at that site. A general programme in which the results from feasibility studies are summarized, the candidate sites presented and the framework of programme for the site investigation phase presented has been published. The general programme, and main references to the programme, specifies which data are required in order to design the repository and carry out a safety assessment, how the investigations should be carried out in order to provide these data, criteria with which the site must comply, as well as
Execution programme for the initial site investigations at Forsmark
International Nuclear Information System (INIS)
2002-05-01
In the feasibility studies that were completed in 2001, eight sites were identified as potentially suitable for hosting a repository. All the identified sites meet the safety requirements with respect to bedrock conditions that could be checked at that time. The feasibility studies have revealed good potential when it comes to the technical and environmental aspects as well. Based on an integrated evaluation SKB proposed to start site investigations with test drillings at three sites; Forsmark, Simpevarp and Tierp. Site investigations have started at Forsmark and Simpevarp. The municipal council of Tierp voted no to a site investigation in April 2002. The site investigations are divided into two main phases; initial and complete investigations. Initial site investigations are performed to identify the site within a specified area that is deemed to be most suitable for a deep repository and to determine whether the feasibility study's judgement of the suitability of the area holds up in the light of borehole data from repository depth. The initial site investigations are expected to take 1.5-2 years. If the assessment shows that the site has good potential to host a repository, complete site investigations will follow for an expected duration of 3.5-4 years. The purpose of the complete site investigations is to gather all information required to select one of the sites as the main alternative and to apply for a permit for construction of the deep repository at that site. A general programme in which the results from feasibility studies are summarized, the candidate sites presented and the framework of programme for the site investigation phase presented has been published. The general programme, and main references to the programme, specifies which data are required in order to design the repository and carry out a safety assessment, how the investigations should be carried out in order to provide these data, criteria with which the site must comply, as well as
Lorenz, K.; Alves, E.; Roqan, Iman S.; O’ Donnell, K. P.; Nishikawa, A.; Fujiwara, Y.; Boćkowski, M.
2010-01-01
Eu-doped GaN was grown by organometallic vapor phase epitaxy at temperatures from 900 to 1100 °C. Eu incorporation is influenced by temperature with the highest concentration found for growth at 1000 °C. In all samples, Eu is incorporated entirely on substitutional Ga sites with a slight displacement which is highest (∼0.2 Å) in the sample grown at 900 °C and mainly directed along the c-axis. The major optical Eu3+ centers are identical for in situdoped and ion-implanted samples after high temperature and pressure annealing. The dominant Eu3+luminescence lines are attributed to isolated, substitutional Eu.
Lorenz, K.
2010-09-16
Eu-doped GaN was grown by organometallic vapor phase epitaxy at temperatures from 900 to 1100 °C. Eu incorporation is influenced by temperature with the highest concentration found for growth at 1000 °C. In all samples, Eu is incorporated entirely on substitutional Ga sites with a slight displacement which is highest (∼0.2 Å) in the sample grown at 900 °C and mainly directed along the c-axis. The major optical Eu3+ centers are identical for in situdoped and ion-implanted samples after high temperature and pressure annealing. The dominant Eu3+luminescence lines are attributed to isolated, substitutional Eu.
Kuhn, Brittany N; Klumpner, Marin S; Covelo, Ignacio R; Campus, Paolo; Flagel, Shelly B
2018-04-01
The paraventricular nucleus of the thalamus (PVT) has been shown to mediate cue-motivated behaviors, such as sign- and goal-tracking, as well as reinstatement of drug-seeking behavior. However, the role of the PVT in mediating individual variation in cue-induced drug-seeking behavior remains unknown. This study aimed to determine if inactivation of the PVT differentially mediates cue-induced drug-seeking behavior in sign-trackers and goal-trackers. Rats were characterized as sign-trackers (STs) or goal-trackers (GTs) based on their Pavlovian conditioned approach behavior. Rats were then exposed to 15 days of cocaine self-administration, followed by a 2-week forced abstinence period and then extinction training. Rats then underwent tests for cue-induced reinstatement and general locomotor activity, prior to which they received an infusion of either saline (control) or baclofen/muscimol (B/M) to inactivate the PVT. Relative to control animals of the same phenotype, GTs show a robust increase in cue-induced drug-seeking behavior following PVT inactivation, whereas the behavior of STs was not affected. PVT inactivation did not affect locomotor activity in either phenotype. In GTs, the PVT appears to inhibit the expression of drug-seeking, presumably by attenuating the incentive value of the drug cue. Thus, inactivation of the PVT releases this inhibition in GTs, resulting in an increase in cue-induced drug-seeking behavior. PVT inactivation did not affect cue-induced drug-seeking behavior in STs, suggesting that the role of the PVT in encoding the incentive motivational value of drug cues differs between STs and GTs.
Symbiont dynamics during thermal acclimation using cnidarian-dinoflagellate model holobionts.
Núñez-Pons, Laura; Bertocci, Iacopo; Baghdasarian, Garen
2017-09-01
Warming oceans menace reef ecosystems by disrupting symbiosis between cnidarians and Symbiodinium zooxanthellae, thus triggering bleach episodes. Temperature fluctuations promote adjustments in physiological variables and symbiont composition, which can cause stress responses, but can also yield adaptation if fitter host-symbiont homeostasis are achieved. To understand such processes manipulative studies are required, but many reef-building cnidarians pose limitations to experimental prospects. We exposed Exaiptasia anemones to Gradual Thermal Stress (GTS) and Heat Shock (HS) exposures and monitored chlorophyll and symbiont dynamics to test the phenotypic plasticity of these photosynthetic holobionts. GTS enhanced chlorophyll concentrations and decreased Symbiodinium proliferation. A recovery period after GTS returned chlorophyll to lower concentrations and symbiont divisions to higher rates. HS triggered a stress response characterized by intense symbiont declines through degradation and expulsion, algal compensatory proliferation, and chlorophyll accumulation. Anemones pre-exposed to GTS displayed more acute signs of symbiont paucity after HS, demonstrating that recurrent stress does not always induce bleaching-resistance. Our study is the first documenting Symbiodinium C and D, along with the predominant Clade B1 in Exaiptasia anemones. C subclades found in outdoor specimens faded under laboratory exposures. Clade D emerged after HS treatments, and especially after GTS pre-exposure. This highlights the thermotolerance of D subclades found in E. pallida and shows that bleaching-recovery can involve shifts of background symbiont phylotypes. This study enlightens the capability of Exaiptasia anemones to acclimate to gradually increased temperatures, and explores into how thermal history influences in subsequent stress tolerance in symbiotic cnidarians. Copyright © 2017 Elsevier Ltd. All rights reserved.
Off-Site Radiation Exposure Review Project: Phase 2 soils program
Energy Technology Data Exchange (ETDEWEB)
McArthur, R.D.; Miller, F.L. Jr.
1989-12-01
To help estimate population doses of radiation from fallout originating at the Nevada Test Site, soil samples were collected throughout the western United States. Each sample was prepared by drying and ball-milling, then analyzed by gamma-spectrometry to determine the amount of {sup 137}Cs it contained. Most samples were also analyzed by chemical separation and alpha-spectrometry to determine {sup 239 + 240}Pu and by isotope mass spectroscopy to determine the ratios of {sup 240}Pu to {sup 239}Pu and {sup 241}Pu to {sup 239}Pu. The total inventories of cesium and plutonium at 171 sites were computed from the results. This report describes the sample collection, processing, and analysis, presents the analytical results, and assesses the quality of the data. 10 refs., 9 figs., 12 tabs.
Phase diagram of a bosonic ladder with two coupled chains
International Nuclear Information System (INIS)
Luthra, Meetu Sethi; Mishra, Tapan; Pai, Ramesh V.; Das, B. P.
2008-01-01
We study a bosonic ladder with two coupled chains using the finite-size density-matrix renormalization group method. We show that in a commensurate bosonic ladder the critical on-site interaction (U C ) for the superfluid to Mott insulator transition gets larger as the interchain hopping (t perpendicular ) increases. We analyze this quantum phase transition and obtain the phase diagram in the t perpendicular -U plane. We also consider the asymmetric case where the on-site interactions are different in the two chains and have shown that the system as a whole will not be in the Mott insulator phase unless both the chains have on-site interactions greater than the critical value
International Nuclear Information System (INIS)
Kerkhoff, Lee; Williams, Kenneth H.; Long, Philip E.; McGuinness, L.
2011-01-01
Uranium contaminated groundwaters are a legacy concern for the U.S. Department of Energy. Previous experiments at the Rifle, Colorado Integrated Field Challenge (IFC) site have demonstrated that field-scale addition of acetate to groundwater reduces the ambient soluable uranium concentration, sequestering the radionuclide as uraninite. However, questions remain regarding which microorganism(s) are consuming this acetate and if active groundwater microorganisms are different from active particle-associated bacteria. In this report, 13-C acetate was used to assess the active microbes that synthesize DNA on 3 size fractions (coarse sand, fines (8-approximately 150 micron), groundwater (0.2-8 micron)) over a 24 -day time frame. Results indicated a stronger signal from 13-C acetate associated with the 'fines' fraction compared with smaller amounts of 13-C uptake on the sand fraction and groundwater samples during the SIP incubations. TRFLP analysis of this 13-C-labeled DNA, indicated 31+ 9 OTU's with 6 peaks dominating the active profiles (166, 187, 210, 212, and 277 bp peaks using MnlI). Cloning/sequencing of the amplification products indicated a Geobacter-like group (187, 210, 212 bp) primarily synthesized DNA from acetate in the groundwater phase, an alpha Proteobacterium (166 bp) primarily grew on the fines/sands, and an Acinetobacter sp. (277 bp) utilized much of the 13C acetate in both groundwater and particle-associated phases. These findings will help to delineate the acetate utilization patterns of bacteria during field-scale acetate addition and can lead to improved methods for stimulating distinct microbial populations in situ.
International Nuclear Information System (INIS)
Staykov, Lazar
2012-10-01
High brightness electron beams with charge of 1 nC and low transverse emittance are necessary for the functioning of advanced light sources such as the Free-electron Laser in Hamburg (FLASH) and the European X-ray FEL (XFEL). The photo-injector test facility at DESY, Zeuthen site (PITZ) is dedicated to the optimization of such electron beams. At PITZ the electrons are produced using an RF gun cavity operated at accelerating gradients of up to 60 MV/m. The gun is equipped with a pair of solenoids for the compensation of the emittance growth due to linear space charge forces. This solenoid compensation scheme is enhanced with a properly matched TESLA type normal conducting booster cavity. The main tool for the characterization of the transverse phase space of the electron beam at PITZ is the emittance measurement system (EMSY). It employs the single slit method for the measurement of the transverse phase space distribution of the electron beam. In this thesis, the performance of the EMSY was optimized for measurement of low emittances in a wide range of photo-injector parameters including such that result in electron beams close to the XFEL specifications. First results on the characterization of the PITZ photo-injector with a gun operated at maximum accelerating gradient of 60 MV/m are presented. This includes scans of the solenoid focusing strength, the initial beam size and the booster gradient. A comparison between results obtained at lower accelerating gradients is made with emphasize on the benefit of higher accelerating gradient.
Energy Technology Data Exchange (ETDEWEB)
Staykov, Lazar
2012-10-15
High brightness electron beams with charge of 1 nC and low transverse emittance are necessary for the functioning of advanced light sources such as the Free-electron Laser in Hamburg (FLASH) and the European X-ray FEL (XFEL). The photo-injector test facility at DESY, Zeuthen site (PITZ) is dedicated to the optimization of such electron beams. At PITZ the electrons are produced using an RF gun cavity operated at accelerating gradients of up to 60 MV/m. The gun is equipped with a pair of solenoids for the compensation of the emittance growth due to linear space charge forces. This solenoid compensation scheme is enhanced with a properly matched TESLA type normal conducting booster cavity. The main tool for the characterization of the transverse phase space of the electron beam at PITZ is the emittance measurement system (EMSY). It employs the single slit method for the measurement of the transverse phase space distribution of the electron beam. In this thesis, the performance of the EMSY was optimized for measurement of low emittances in a wide range of photo-injector parameters including such that result in electron beams close to the XFEL specifications. First results on the characterization of the PITZ photo-injector with a gun operated at maximum accelerating gradient of 60 MV/m are presented. This includes scans of the solenoid focusing strength, the initial beam size and the booster gradient. A comparison between results obtained at lower accelerating gradients is made with emphasize on the benefit of higher accelerating gradient.
E-FUSRAP: AUTOMATING THE CASE FILE FOR THE FORMERLY UTILIZED SITES REMEDIAL ACTION PROGRAM
Energy Technology Data Exchange (ETDEWEB)
Mackenzie, D.; Marshall, K.
2003-02-27
The Department of Energy's (DOE) Office of Site Closure, EM-30, houses the document library pertaining to sites that are related to the Formerly Utilized Sites Remedial Action Program (FUSRAP) and regularly addresses ongoing information demands, primarily from Freedom of Information Act (FOIA) requests, interested members of the public, the DOE, and other Federal Agencies. To address these demands more efficiently, DOE has begun to implement a new multi-phase, information management process known as e-FUSRAP. The first phase of e-FUSRAP, the development of the Considered Sites Database, summarizes and allows public access to complex information on over 600 sites considered as candidates for FUSRAP. The second phase of e-FUSRAP, the development of the Document Indexing Database, will create an internal index of more than 10,000 documents in the FUSRAP library's case file, allowing more effective management and retrieval of case file documents. Together, the phases of e-FUSRAP will allow EM-30 to become an innovative leader in enhancing public information sources.
Lidar to lidar calibration phase 2
DEFF Research Database (Denmark)
Yordanova, Ginka; Courtney, Michael
This report presents the results from phase 2 of a lidar to lidar (L2L) calibration procedure. Phase two of the project included two measurement campaigns conducted at given sites. The purpose was to find out if the lidar-to-lidar calibration procedure can be conducted with similar results...
Summary report of the experiences from TVO's site investigations
International Nuclear Information System (INIS)
Oehberg, A.; Saksa, P.; Ahokas, H.; Ruotsalainen, P.; Snellman, M.
1994-05-01
Teollisuuden Voima Oy (TVO) has completed preliminary site investigations at five sites in Finland. At the end of 1992 TVO presented the final report to the authorities. The preliminary site investigation phase 1986-1992 was conducted according to the investigation programme compiled by TVO. The aim of this report was to compile a report on experiences from TVOs site investigations. The main interest was focused on investigation strategies and the most important investigation methods for the conceptual modelling. The objective of the preliminary site investigations was to obtain data on the bedrock properties in order to evaluate the areas. The programme was divided into four stages, each stage having its own sub-objective. The site-specific investigation programme for each site included a large common part and a small site-specific part. The strategies (objectives) and experiences from different disciplines, geology, hydrogeochemistry, geophysics and geohydrology, are presented in the report. The conceptual modelling work procedure including both bedrock and groundwater modelling is described briefly using the Olkiluoto site as an example. Each of the other areas has undergone similar phases of work. The uncertainties associated with conceptual modelling are also discussed. The usefulness of the investigation strategy and the investigation methods for conceptual modelling is discussed in the report. Some new equipment, methods or enhancements that have not yet been used in TVOs site investigations have become new tools in site characterisation and are briefly presented in the report. 52 refs, 35 figs, 1 tab
DECISION ANALYSIS OF INCINERATION COSTS IN SUPERFUND SITE REMEDIATION
This study examines the decision-making process of the remedial design (RD) phase of on-site incineration projects conducted at Superfund sites. Decisions made during RD affect the cost and schedule of remedial action (RA). Decision analysis techniques are used to determine the...
Archaeometric studies on the Hatahara archaeological site
International Nuclear Information System (INIS)
Nunes, Kelly Placa
2009-01-01
The reconstruction of the past and the understanding of historical and cultural aspects of societies that developed at archaeological sites have been enabled by archaeometric studies undertaken on ceramics located at these areas. This study aims to be a contribution to the elucidation of these aspects with the application of three physical methods of analysis: neutron activation analysis (NAA), thermoluminescence dating (TL) an electronic paramagnetic resonance (EPR) to ceramic fragments from the Hatahara archaeological site, located at central Amazon. The elemental concentrations obtained by NAA for 120 ceramic fragments were interpreted by means of cluster analysis and discriminant analysis. The results showed the existence of five distinct ceramic groups. This information, supported by archaeological interpretation, confirm the existence of four distinct occupation Phases at Hatahara site. In order to establish a chronology for the occupations, the ages of three ceramic fragments were determined by TL. The dating of two fragments did not confirm the archaeological interpretation about their occupation Phases. However, the dating of the third fragment allowed the confirmation that it belongs to the Manacapuru Phase. The determination of the burning temperatures of four ceramic fragments was performed by EPR. It was observed that although the analyzed ceramic samples belong to three distinct groups, there was no significant variation on their burning temperatures. (author)
French uranium mining sites remediation
International Nuclear Information System (INIS)
Roche, M.
2002-01-01
Following a presentation of the COGEMA's general policy for the remediation of uranium mining sites and the regulatory requirements, the current phases of site remediation operations are described. Specific operations for underground mines, open pits, milling facilities and confining the milled residues to meet long term public health concerns are detailed and discussed in relation to the communication strategies to show and explain the actions of COGEMA. A brief review of the current remediation situation at the various French facilities is finally presented. (author)
Development and Application of SITES
International Nuclear Information System (INIS)
Park, Jo Wan; Yoon; Yoon, Jeong Hyoun; Kim, Chank Lak; Cho, Sung IL
2008-01-01
SITES (Site Information and Total Environmental Data Management System) has been developed for the purpose of systematically managing site characteristics and environmental data produced during the pre-operational, operational, and post-closure phases of a radioactive waste disposal facility. SITES is an integration system, which consists of 4 modules, to be available for maintenance of site characteristics data, for safety assessment, and for site/environment monitoring; site environmental data management module (SECURE), integrated safety assessment module (SAINT), site/environment monitoring module (SUDAL) and geological information module for geological data management (SITES-GIS). Each module has its database with the functions of browsing, storing, and reporting data and information. Data from SECURE and SUDAL are interconnected to be utilized as inputs to SAINT. SAINT has the functions that multi-user can access simultaneously via client-server system, and the safety assessment results can be managed with its embedded Quality Assurance feature. Comparison between assessment results and environmental monitoring data can be made and visualized in SUDAL and SITES-GIS. Also, SUDAL is designed that the periodic monitoring data and information could be opened to the public via internet homepage. SITES has applied to the Wolsong low- and intermediate-level radioactive waste disposal center in Korea, and is expected to enhance the function of site/environment monitoring in other nuclear-related facilities and also in industrial facilities handling hazardous materials.
Sample Exchange Evaluation (SEE) Report - Phase II
International Nuclear Information System (INIS)
Winters, W.I.
1994-01-01
This report describes the results from Phase II of the Sample Exchange Evaluation (SEE) Program, a joint effort to compare analytical laboratory performance on samples from the Hanford Site's high-level waste tanks. In Phase II, the program has been expanded to include inorganic constituents in addition to radionuclides. Results from Phase II that exceeded 20% relative percent difference criteria are identified
Pawliszyn, J
2001-01-01
Solid Phase Microextraction (SPME) uses a small volume of sorbent dispersed typically on the surface of small fibres, to isolate and concentrate analytes from sample matrix. After contact with sample, analytes are absorbed or adsorbed by the fibre phase (depending on the nature of the coating) until an equilibrium is reached in the system. The amount of an analyte extracted by the coating at equilibrium is determined by the magnitude of the partition coefficient of the analyte between the sample matrix and the coating material. After the extraction step, the fibres are transferred, with the help of a syringe-like handling device, to analytical instrument, for separation and quantitation of target analytes. This technique integrates sampling, extraction and sample introduction and is a simple way of facilitating on-site monitoring. Applications of this technique include environmental monitoring, industrial hygiene, process monitoring, clinical, forensic, food, flavour, fragrance and drug analyses, in laboratory and on-site analysis.
Martino, D; Draganski, B; Cavanna, A; Church, A; Defazio, G; Robertson, M M; Frackowiak, R S J; Giovannoni, G; Critchley, H D
2008-07-01
Anti-basal ganglia antibodies (ABGAs) have been suggested to be a hallmark of autoimmunity in Gilles de la Tourette's syndrome (GTS), possibly related to prior exposure to streptococcal infection. In order to detect whether the presence of ABGAs was associated with subtle structural changes in GTS, whole-brain analysis using independent sets of T(1) and diffusion tensor imaging MRI-based methods were performed on 22 adults with GTS with (n = 9) and without (n = 13) detectable ABGAs in the serum. Voxel-based morphometry analysis failed to detect any significant difference in grey matter density between ABGA-positive and ABGA-negative groups in caudate nuclei, putamina, thalami and frontal lobes. These results suggest that ABGA synthesis is not related to structural changes in grey and white matter (detectable with these methods) within frontostriatal circuits.
Castellano, Immacolata; Merlino, Antonello
2012-10-01
γ-Glutamyltranspeptidases (γ-GTs) are ubiquitous enzymes that catalyze the hydrolysis of γ-glutamyl bonds in glutathione and glutamine and the transfer of the released γ-glutamyl group to amino acids or short peptides. These enzymes are involved in glutathione metabolism and play critical roles in antioxidant defense, detoxification, and inflammation processes. Moreover, γ-GTs have been recently found to be involved in many physiological disorders, such as Parkinson's disease and diabetes. In this review, the main biochemical and structural properties of γ-GTs isolated from different sources, as well as their conformational stability and mechanism of catalysis, are described and examined with the aim of contributing to the discussion on their structure-function relationships. Possible applications of γ-glutamyltranspeptidases in different fields of biotechnology and medicine are also discussed.
When is there sufficient information from the Site Investigations?
International Nuclear Information System (INIS)
Andersson, Johan; Munier, Raymond; Stroem, Anders; Soederbaeck, Bjoern; Almen, Karl-Erik; Olsson, Lars
2004-04-01
SKB has started site investigations for a deep repository for spent nuclear fuel at two different sites in Sweden. The investigations should provide necessary information for a licence application aimed at starting underground exploration. The investigations and analyses of them are supposed to provide the broad knowledge base that is required to achieve the overall goals of the site investigation phase. The knowledge will be utilized to evaluate the suitability of investigated sites for the deep repository and must be comprehensive enough to: Show whether the selected site satisfies requirements on safety and technical aspects. Serve as a basis for adaptation of the deep repository to the characteristics of the site with an acceptable impact on society and the environment. Permit comparisons with other investigated sites. Furthermore, the investigations are discontinued when the reliability of the site description has reached such a level that the body of data for safety assessment and design is sufficient, or until the body of data shows that the rock does not satisfy the requirements. These objectives are valid, but do not provide sufficient and concrete guidance. For this reason SKB has conducted this project which should acquire concrete guidance on how to judge when the surface based Site Investigation Phase does not need to continue. After a general assessment of the problem, the following specific objectives of the current work were identified: Demonstrate concretely how the assessed uncertainties in a Site Description based on a specific level of investigations, together with expected feedback from Safety Assessment and Engineering, can be used to decide whether the site investigations are sufficient - or need to continue. This demonstration will be based on a practical application of relevant aspects of decision analysis tools. Highlight and make concrete the type of feedback to be expected from Safety Assessment and Engineering and show how this feedback
When is there sufficient information from the Site Investigations?
Energy Technology Data Exchange (ETDEWEB)
Andersson, Johan [JA Streamflow AB, Aelvsjoe (Sweden); Munier, Raymond; Stroem, Anders; Soederbaeck, Bjoern [Swedish Nuclear Fuel and Waste Management Co., Stockholm (Sweden); Almen, Karl-Erik [KEA Geo-konsult (Sweden); Olsson, Lars [Geostatistik AB, Tumba (Sweden)
2004-04-01
SKB has started site investigations for a deep repository for spent nuclear fuel at two different sites in Sweden. The investigations should provide necessary information for a licence application aimed at starting underground exploration. The investigations and analyses of them are supposed to provide the broad knowledge base that is required to achieve the overall goals of the site investigation phase. The knowledge will be utilized to evaluate the suitability of investigated sites for the deep repository and must be comprehensive enough to: Show whether the selected site satisfies requirements on safety and technical aspects. Serve as a basis for adaptation of the deep repository to the characteristics of the site with an acceptable impact on society and the environment. Permit comparisons with other investigated sites. Furthermore, the investigations are discontinued when the reliability of the site description has reached such a level that the body of data for safety assessment and design is sufficient, or until the body of data shows that the rock does not satisfy the requirements. These objectives are valid, but do not provide sufficient and concrete guidance. For this reason SKB has conducted this project which should acquire concrete guidance on how to judge when the surface based Site Investigation Phase does not need to continue. After a general assessment of the problem, the following specific objectives of the current work were identified: Demonstrate concretely how the assessed uncertainties in a Site Description based on a specific level of investigations, together with expected feedback from Safety Assessment and Engineering, can be used to decide whether the site investigations are sufficient - or need to continue. This demonstration will be based on a practical application of relevant aspects of decision analysis tools. Highlight and make concrete the type of feedback to be expected from Safety Assessment and Engineering and show how this feedback
Elliott, Doug; Allen, Emily; McKinley, Sharon; Perry, Lin; Duffield, Christine; Fry, Margaret; Gallagher, Robyn; Iedema, Rick; Roche, Michael
2017-12-01
To examine user compliance and completeness of documentation with a newly designed observation and response chart and whether a rapid response system call was triggered when clinically indicated. Timely recognition and responses to patient deterioration in hospital general wards remain a challenge for healthcare systems globally. Evaluating practice initiatives to improve recognition and response are required. Two-phase audit. Following introduction of the charts in ten health service sites in Australia, an audit of chart completion was conducted during a short trial for initial usability (Phase 1; 2011). After chart adoption as routine use in practice, retrospective and prospective chart audits were conducted (Phase 2; 2012). Overall, 818 and 1,058 charts were audited during the two phases respectively. Compliance was mixed but improved with the new chart (4%-14%). Contrary to chart guidelines, numbers rather than dots were written in the graphing section in 60% of cases. Rates of recognition of abnormal vital signs improved slightly with new charts in use, particularly for higher levels of surveillance and clinical review. Based on local calling criteria, an emergency call was initiated in 33% of cases during the retrospective audit and in 41% of cases with the new chart. User compliance was less than optimal, limiting full function of the chart sections and compliance with local calling criteria. Overcoming apparent behavioural and work culture barriers may improve chart completion, aiding identification of abnormal vital signs and triggering a rapid response system activation when clinical deterioration is detected. © 2017 The Authors. Journal of Advanced Nursing Published by John Wiley & Sons Ltd.
Nuclear site selection studies
International Nuclear Information System (INIS)
Gharib, A.; Zohoorian Izadpanah, A.A.; Iranmanesh, H.
2000-01-01
It is of special importance, especially from the nuclear safety viewpoint, to select suitable sites for different nuclear structures with the considered future activities. Site selection sometimes involves high costs not necessarily for merely selecting of site but for some preliminary measures to be taken so as the site may have the necessary characteristics. The more suitable the natural characteristics of the site for the considered project, the more successful and efficient the project, the lower the project costs and the longer the project operation period. If so, the project will cause the growth of public culture and sustainable socioeconomic development. This paper is the result of the conclusion of numerous massive reports of this activity in the preliminary phase based on theories, practices and the related safety principles on this ground as well as the application of data and information of the past and a glance to the future. The conception of need for a site for medium structures and nuclear research projects and how to perform this process are presented step by step here with a scientific approach to its selection during the investigations. In this study, it is practically described how the site is selected, by determining and defining the characteristics of research and nuclear projects with medium structures and also its fitting to the optimum site. The discovered sites typically involve the best advantages in technical and economic aspects and no particular contrast with the concerned structures
Control of phase synchronization of neuronal activity in the rat hippocampus.
Lian, Jun; Shuai, Jianwei; Durand, Dominique M
2004-03-01
Analysis of the synchronization mechanisms of neural activity is crucial to the understanding of the generation, propagation and control of epileptiform activity. Recently, phase synchronization (PS) analysis was applied to quantify the partial synchrony that exists in complex chaotic or noisy systems. In a previous study, we have shown that neural activity between two remotely located sites can be synchronized through a complete cut of the tissue by endogenous non-synaptic signals. Therefore, it should be possible to apply signals to control PS. In this study, we test the hypothesis that stimulation amplitudes below excitation level (sub-threshold) can be used to control phase synchronization of two neural signals and we investigate the underlying mechanisms. PS of neuronal activity is first analysed in two coupled Rossler neuron models. Both synchronization and desynchronization could be generated with sub-threshold sinusoidal stimulation. Phase synchronization was then studied in in vitro brain slices. Neuronal activity between two sites was modulated by the application of small sinusoidal electric fields. PS between two remote sites could be achieved by the application of two identical waveforms while phase desynchronization of two close sites was generated by the application of a stimulus at a single site. These results show that sub-threshold stimuli are able to phase synchronize or desynchronize two networks and suggest that small signals could play an important role in normal neural activity and epilepsy.
Dynamic Phases of Vortices in Superconductors with Periodic Pinning
International Nuclear Information System (INIS)
Reichhardt, C.; Olson, C.; Nori, F.
1997-01-01
We present results from extensive simulations of driven vortex lattices interacting with periodic arrays of pinning sites. Changing an applied driving force produces a rich variety of novel dynamical plastic flow phases which are very distinct from those observed in systems with random pinning arrays. Signatures of the transition between these different dynamical phases include sudden jumps in the current-voltage curves as well as marked changes in the vortex trajectories and vortex lattice order. Several dynamical phase diagrams are obtained as a function of commensurability, pinning strength, and spatial order of the pinning sites. copyright 1997 The American Physical Society
Pratt, G. C.; Herbrandson, C.; Krause, M. J.; Schmitt, C.; Lippert, C. J.; McMahon, C. R.; Ellickson, K. M.
2018-04-01
We measured polycyclic aromatic hydrocarbons (PAHs) in gas and particle phases over two years using high volume samplers equipped with quartz fiber filters and XAD-4 at a rural site, an urban site, and a site adjacent to a heavily trafficked roadway. Overall results were generally as expected, in that concentrations increased from rural to urban to near-roadway sites, and PAHs with high vapor pressures (liquid subcooled, PoL) and low octanol-air partition coefficients (Koa) were mainly in the gas phase, while those with low PoL and high Koa were predominantly in the particle phase. Intermediate PAHs existed in both phases with the phase distribution following a seasonal pattern of higher gas phase concentrations in summer due to temperature effects. The overall pattern of phase distribution was consistent with PAH properties and ambient conditions and was similar at all three sites. The particle-bound fraction (ϕ) was well-described empirically by nonlinear regressions with log Koa and log PoL as predictors. Adsorption and absorption models underestimated the particle-bound fraction for most PAHs. The dual aerosol-air/soot-air model generally represented the gas-particle partitioning better than the other models across all PAHs, but there was a tendency to underestimate the range in the particle-bound fraction seen in measurements. There was a statistically insignificant tendency for higher PAHs in the particle phase at the near roadway site, and one piece of evidence that PAHs may be enriched on ultrafine particles at the near roadway site. Understanding the phase and particle size distributions of PAHs in highly polluted, high exposure microenvironments near traffic sources will help shed light on potential health effects.
Quantum phases of AB2 fermionic chains
International Nuclear Information System (INIS)
Murcia-Correa, L S; Franco, R; Silva-Valencia, J
2016-01-01
A fermionic chain is a one-dimensional system with fermions that interact locally and can jump between sites in the lattice, in particular an AB n chain type, where A and B are sites that exhibit a difference in energy level of Δ and site B is repeated n-times, such that the unit cell has n +1 sites. A limit case of this model, called the ionic Hubbard model (n = 1), has been widely studied due to its interesting physics and applications. In this paper, we study the ground state of an AB 2 chain, which describes the material R 4 [Pt 2 (P 2 O 5 H 2 ) 4 X] · nH 2 O. Specifically, we consider a filling with two electrons per unit cell, and using the density matrix renormalization group method we found that the system exhibits the band insulator and Mott correlated insulator phases, as well as an intermediate phase between them. For couplings of Δ = 2,10 and 20, we estimate the critical points that separate these phases through the structure factor and the energy gap in the sector of charge and spin, finding that the position of the critical point rises as a function of Δ. (paper)
The Cigeo project: an industrial storage site for radioactive wastes in deep underground
International Nuclear Information System (INIS)
Krieguer, Jean-Marie
2017-01-01
In 2006, France has decided to store its high-level and long-lived radioactive wastes, mostly issued from the nuclear industry, in a deep geological underground disposal site. This document presents the Cigeo project, a deep underground disposal site (located in the East of France) for such radioactive wastes, which construction is to be started in 2021 (subject to authorization in 2018). After a brief historical review of the project, started 20 years ago, the document presents the radioactive waste disposal context, the ethical choice of underground storage (in France and elsewhere) for these types of radioactive wastes, the disposal site safety and financing aspects, the progressive development of the underground facilities and, of most importance, its reversibility. In a second part, the various works around the site are presented (transport, buildings, water and power supply, etc.) together with a description of the various radioactive wastes (high and intermediate level and long-lived wastes and their packaging) that will be disposed in the site. The different steps of the project are then reviewed (the initial design and initial construction phases, the pilot industrial phase (expected in 2030), the operating phase, and the ultimate phases that will consist in the definitive closure of the site and its monitoring), followed by an extensive description of the various installations of surface and underground facilities, their architecture and their equipment
International Nuclear Information System (INIS)
Hume, H.
1987-12-01
This site study plan describes seismic reflection surveys to run north-south and east-west across the Deaf Smith County site, and intersecting near the Engineering Design Boreholes (EDBH). Both conventional and shallow high-resolution surveys will be run. The field program has been designed to acquire subsurface geologic and stratigraphic data to address information/data needs resulting from Federal and State regulations and Repository program requirements. The data acquired by the conventional surveys will be common-depth- point, seismic reflection data optimized for reflection events that indicate geologic structure near the repository horizon. The data will also resolve the basement structure and shallow reflection events up to about the top of the evaporite sequence. Field acquisition includes a testing phase to check/select parameters and a production phase. The field data will be subjected immediately to conventional data processing and interpretation to determine if there are any anamolous structural for stratigraphic conditions that could affect the choice of the EDBH sites. After the EDBH's have been drilled and logged, including vertical seismic profiling, the data will be reprocessed and reinterpreted for detailed structural and stratigraphic information to guide shaft development. The shallow high-resulition seismic reflection lines will be run along the same alignments, but the lines will be shorter and limited to immediate vicinity of the EDBH sites. These lines are planned to detect faults or thick channel sands that may be present at the EDBH sites. 23 refs. , 7 figs., 5 tabs
The Early Neolithic phases of Beidha in a regional context
DEFF Research Database (Denmark)
Jensen, Charlott Hoffmann
2007-01-01
The paper is a preliminary account of the new analyses of the Beidha material and concentrates on the earliest levels from the site: the pre-architectural levels as well as a sample of material from Phase A1 buildings. A contextual analysis of some of the phase A1 buildings is introduced and the ......The paper is a preliminary account of the new analyses of the Beidha material and concentrates on the earliest levels from the site: the pre-architectural levels as well as a sample of material from Phase A1 buildings. A contextual analysis of some of the phase A1 buildings is introduced...
Yang, Liu; Han, Qiang; Cao, Shuya; Yang, Jie; Yang, Junchao; Ding, Mingyu
2014-01-01
On-site analysis is an efficient approach to facilitate analysis at the location of the system under investigation as it can result in more accurate, more precise and quickly available analytical data. In our work, a novel self-made thermal desorption based interface was fabricated to couple solid-phase microextraction with ion mobility spectrometry for on-site water analysis. The portable interface can be connected with the front-end of an ion mobility spectrometer directly without other modifications. The analytical performance was evaluated via the extraction of chemical warfare agents and simulants in water samples. Several parameters including ionic strength and extraction time have been investigated in detail. The application of the developed method afforded satisfactory recoveries ranging from 72.9% to 114.4% when applied to the analysis of real water samples. PMID:25384006
Decommissioning the Jason Argonaut research reactor at a world heritage site
Energy Technology Data Exchange (ETDEWEB)
Lockwood, R.J.S.; Beeley, P.A. [HMS Sultan, Gosport, Hampshire (United Kingdom)
2001-07-01
The Jason low power Argonaut type, water and graphite moderated reactor was located in King William Building, which is a Grade 1 listed building within the Royal Naval College, Greenwich, London. The College itself is a Scheduled Ancient Monument with World Heritage Site status and is situated about a mile from the Greenwich Dome. The decision to decommission Jason to International Atomic Energy Agency Stage 3 status (unrestricted site use) was taken in 1996. All physical decommissioning work was completed by October 1999, site radiological clearance was obtained in November 1999, the site license was withdrawn and the site was handed over for future unrestricted use on 9 December 1999. The Jason decommissioning project was safely completed to time, cost and quality by the Millennium [2] without any adverse effects on World Heritage aspects of the site. In this paper details are provided about the Jason fuel removal phase and an outline of the other phases of the project.
Interhemispheric motor networks are abnormal in patients with Gilles de la Tourette syndrome
DEFF Research Database (Denmark)
Bäumer, Tobias; Thomalla, Götz; Kroeger, Johan
2010-01-01
Brain imaging has shown altered corpus callosum (CC) morphology in patients with Gilles de la Tourette syndrome (GTS). Yet it is unclear whether these morphological changes are associated with altered interhemispheric interactions. Here, we combined transcranial magnetic stimulation (TMS) with di...... in control subjects but not in patients. Our combined TMS-DTI approach demonstrates abnormal functional interhemispheric connectivity in GTS accompanied by an altered structure-function relationship in the motor CC....
International Nuclear Information System (INIS)
Gorber, D.M.; Story, V.A.
1995-01-01
After public opposition to the plans for a low-level radioactive waste facility at one of two candidate areas at Port Hope, Canada the Environmental Assessment process was postponed, and an independent Siting Process Task Force was set-up to assess the most suitable technologies for LLRW disposal, the areas with the best potential in the province to use these technologies, and the most promising approaches to site selection. The Task Force recommended a five-phased siting process known as the 'Co-operative Siting Process', which was based on the voluntary participation of local communities and a collaborative, joint-planning style of decision making. An independent Siting Task Force was to be established to ensure that the principles of the recommended process was upheld. This siting process is still underway, and problems and successes that have been encountered are summarized in this contribution
Energy Technology Data Exchange (ETDEWEB)
Gregg Ruskuaff
2010-01-01
This document, the Phase II Frenchman Flat transport report, presents the results of radionuclide transport simulations that incorporate groundwater radionuclide transport model statistical and structural uncertainty, and lead to forecasts of the contaminant boundary (CB) for a set of representative models from an ensemble of possible models. This work, as described in the Federal Facility Agreement and Consent Order (FFACO) Underground Test Area (UGTA) strategy (FFACO, 1996; amended 2010), forms an essential part of the technical basis for subsequent negotiation of the compliance boundary of the Frenchman Flat corrective action unit (CAU) by Nevada Division of Environmental Protection (NDEP) and National Nuclear Security Administration Nevada Site Office (NNSA/NSO). Underground nuclear testing via deep vertical shafts was conducted at the Nevada Test Site (NTS) from 1951 until 1992. The Frenchman Flat area, the subject of this report, was used for seven years, with 10 underground nuclear tests being conducted. The U.S. Department of Energy (DOE), NNSA/NSO initiated the UGTA Project to assess and evaluate the effects of underground nuclear tests on groundwater at the NTS and vicinity through the FFACO (1996, amended 2010). The processes that will be used to complete UGTA corrective actions are described in the “Corrective Action Strategy” in the FFACO Appendix VI, Revision No. 2 (February 20, 2008).
Boschmans, Jasper; Jacobs, Sam; Williams, Jonathan P; Palmer, Martin; Richardson, Keith; Giles, Kevin; Lapthorn, Cris; Herrebout, Wouter A; Lemière, Filip; Sobott, Frank
2016-06-20
Electrospray ion mobility-mass spectrometry (IM-MS) data show that for some small molecules, two (or even more) ions with identical sum formula and mass, but distinct drift times are observed. In spite of showing their own unique and characteristic fragmentation spectra in MS/MS, no configurational or constitutional isomers are found to be present in solution. Instead the observation and separation of such ions appears to be inherent to their gas-phase behaviour during ion mobility experiments. The origin of multiple drift times is thought to be the result of protonation site isomers ('protomers'). Although some important properties of protomers have been highlighted by other studies, correlating the experimental collision cross-sections (CCSs) with calculated values has proven to be a major difficulty. As a model, this study uses the pharmaceutical compound melphalan and a number of related molecules with alternative (gas-phase) protonation sites. Our study combines density functional theory (DFT) calculations with modified MobCal methods (e.g. nitrogen-based Trajectory Method algorithm) for the calculation of theoretical CCS values. Calculated structures can be linked to experimentally observed signals, and a strong correlation is found between the difference of the calculated dipole moments of the protomer pairs and their experimental CCS separation.
Uncommon Applications of Deep Brain Stimulation in Hyperkinetic Movement Disorders
Directory of Open Access Journals (Sweden)
Kara M. Smith
2015-02-01
Full Text Available Background: In addition to the established indications of tremor and dystonia, deep brain stimulation (DBS has been utilized less commonly for several hyperkinetic movement disorders, including medication-refractory myoclonus, ballism, chorea, and Gilles de la Tourette (GTS and tardive syndromes. Given the lack of adequate controlled trials, it is difficult to translate published reports into clinical use. We summarize the literature, draw conclusions regarding efficacy when possible, and highlight concerns and areas for future study.Methods: A Pubmed search was performed for English-language articles between January 1980 and June 2014. Studies were selected if they focused primarily on DBS to treat the conditions of focus. Results: We identified 49 cases of DBS for myoclonus-dystonia, 21 for Huntington's disease, 15 for choreacanthocytosis, 129 for GTS, and 73 for tardive syndromes. Bilateral globus pallidus interna (GPi DBS was the most frequently utilized procedure for all conditions except GTS, in which medial thalamic DBS was more common. While the majority of cases demonstrate some improvement, there are also reports of no improvement or even worsening of symptoms in each condition. The few studies including functional or quality of life outcomes suggest benefit. A limited number of studies included blinded on/off testing. There have been two double-blind controlled trials performed in GTS and a single prospective double-blind, uncontrolled trial in tardive syndromes. Patient characteristics, surgical target, stimulation parameters, and duration of follow-up varied among studies.Discussion: Despite these extensive limitations, the literature overall supports the efficacy of DBS in these conditions, in particular GTS and tardive syndromes. For other conditions, the preliminary evidence from small studies is promising and encourages further study.
Proposed Site Treatment Plan (PSTP). STP reference document
International Nuclear Information System (INIS)
1995-01-01
The Department of Energy (DOE) is required by Section 3021(b) of the Resource Conservation and Recovery Act (RCRA), as amended by the Federal Facility Compliance Act (FFCAct), to prepare a plan describing the development of treatment capacities and technologies for treating mixed waste (hazardous/radioactive waste). DOE decided to prepare its site treatment plan in a three phased approach. The first phase, called the Conceptual Site Treatment Plan (CSTP), was issued in October 1993. At the Savannah River Site (SRS) the CSTP described mixed waste streams generated at SRS and listed treatment scenarios for each waste stream utilizing an onsite, offsite DOE, and offsite or onsite commercial or vendor treatment option. The CSTP is followed by the Draft Site Treatment Plan (DSTP), due to be issued in August 1994. The DSTP, the current activity., will narrow the options discussed in the CSTP to a preferred treatment option, if possible, and will include waste streams proposed to be shipped to SRS from other DOE facilities as well as waste streams SRS may send offsite for treatment. The SRS DSTP process has been designed to address treatment options for each of the site's mixed waste streams. The SRS Proposed Site Treatment Plan (PSTP) is due to be issued in February 1995. The compliance order would be derived from the PSTP
Site characterization design and techniques used at the Southern Shipbuilding Corporation site
International Nuclear Information System (INIS)
Mueller, J.P.; Geraghty, C.A.; Moore, G.W.; Mullins, J.R.
1995-01-01
The Southern Shipbuilding Corporation (SSC) site is an inactive barge/ship manufacturing and repair facility situated on approximately 54 acres in Slidell, St. Tammany Parish, Louisiana. Two unlined surface impoundments (North and South impoundments) are situated on the northwest portion of the site and are surrounded on three sides by Bayou Bonfouca. These impoundments are the sources of carcinogenic polynuclear aromatic hydrocarbon (CPAH) contamination at the site. Inadequate containment has resulted in the release of impoundment wastes into the bayou. To evaluate potential response alternatives for the site, an Engineering Evaluation/Cost Analysis (EE/CA) field investigation was conducted from July through October 1994. A two phase sampling approach was used in combination with innovative and traditional sampling techniques, field screening technologies, and exploitation of the visual characteristics of the waste to determine the extent of waste migration with limited off-site laboratory confirmation. A skid-mounted mobile drilling unit, secured to a specialized sampling platform designed for multiple applications, was used for collection of sediment cores from the bayou as well as tarry sludge cores from the impoundments. Field screening of core samples was accomplished on site using an organic vapor analyzer and a total petroleum hydrocarbon (TPH) field analyzer. Pollutants of concern include metals, cyanide, dioxin, and organic compounds. This paper presents details on the sampling design and characterization techniques used to accomplish the EE/CA field investigation
Non-Invasive Seismic Methods for Earthquake Site Classification Applied to Ontario Bridge Sites
Bilson Darko, A.; Molnar, S.; Sadrekarimi, A.
2017-12-01
How a site responds to earthquake shaking and its corresponding damage is largely influenced by the underlying ground conditions through which it propagates. The effects of site conditions on propagating seismic waves can be predicted from measurements of the shear wave velocity (Vs) of the soil layer(s) and the impedance ratio between bedrock and soil. Currently the seismic design of new buildings and bridges (2015 Canadian building and bridge codes) requires determination of the time-averaged shear-wave velocity of the upper 30 metres (Vs30) of a given site. In this study, two in situ Vs profiling methods; Multichannel Analysis of Surface Waves (MASW) and Ambient Vibration Array (AVA) methods are used to determine Vs30 at chosen bridge sites in Ontario, Canada. Both active-source (MASW) and passive-source (AVA) surface wave methods are used at each bridge site to obtain Rayleigh-wave phase velocities over a wide frequency bandwidth. The dispersion curve is jointly inverted with each site's amplification function (microtremor horizontal-to-vertical spectral ratio) to obtain shear-wave velocity profile(s). We apply our non-invasive testing at three major infrastructure projects, e.g., five bridge sites along the Rt. Hon. Herb Gray Parkway in Windsor, Ontario. Our non-invasive testing is co-located with previous invasive testing, including Standard Penetration Test (SPT), Cone Penetration Test and downhole Vs data. Correlations between SPT blowcount and Vs are developed for the different soil types sampled at our Ontario bridge sites. A robust earthquake site classification procedure (reliable Vs30 estimates) for bridge sites across Ontario is evaluated from available combinations of invasive and non-invasive site characterization methods.
International Nuclear Information System (INIS)
Tawara, Y.; Mori, K.; Tada, K.; Shimura, T.; Sato, S.; Yamamoto, S.; Asano, H.; Namiki, K.
2012-01-01
Document available in extended abstract form only. After the completion of field-scaled Gas Migration Test (GMT) at the Grimsel Test Site (GTS Phase V Project, 1996-2004), an advanced gas migration modelling study has been implemented to increase the accuracy and reliability as a part of the R and D programs by the Radioactive Waste Management funding and research Center (RWMC) in Japan. The multiple gas migration modes which consist of diffusive transport of dissolved gas, conventional two phase flow, pore failure induced microscopic fissuring and macroscopic fracturing flow, were identified in GMT bentonite. However the required parameters and constitutive models governing those modes are still uncertain. To tackle this issue, an extended validation and scoping study aiming to generalize such gas migration behavior has been performed in the advanced gas migration modelling study. One of the main objectives of the validation study is to identify gas migration modes using laboratory test data and to qualify the alternative models and parameters. In the scoping study, we have extracted the specific THMC (Thermal, Hydrological, Mechanical and Chemical) coupled processes which have impacts on the performance measures such as the pressure built-up in EBS (Engineered Barrier System) and expelled water to the geosphere by gas generation and transport. The measured data of hydration tests and gas injection tests using bentonite specimens with different water contents were reproduced. Two phase flow parameters were estimated using the observed data of both types of tests, independently. The simulated results of the conventional two phase flow model were well-matched with the hydration test data. In the gas injection test, the extended two phase flow model which simulates the pressure-induced pore failure (pathway dilation), was able to reproduce observed data reasonably. However, we found that the identified parameters obtained from the hydration test data were
Schmitter, E. D.
2013-04-01
Remote sensing of the ionosphere bottom using long wave radio signal propagation is a still going strong and inexpensive method for continuous monitoring purposes. We present a propagation model describing the time development of solar flare effects. Based on monitored amplitude and phase data from VLF/LF transmitters gained at a mid-latitude site during the currently increasing solar cycle no. 24 a parameterized electron density profile is calculated as a function of time and fed into propagation calculations using the LWPC (Long Wave Propagation Capability). The model allows to include lower ionosphere recombination and attachment coefficients, as well as to identify the relevant forcing X-ray wavelength band, and is intended to be a small step forward to a better understanding of the solar-lower ionosphere interaction mechanisms within a consistent framework.
Directory of Open Access Journals (Sweden)
Liu Yang
2014-11-01
Full Text Available On-site analysis is an efficient approach to facilitate analysis at the location of the system under investigation as it can result in more accurate, more precise and quickly available analytical data. In our work, a novel self-made thermal desorption based interface was fabricated to couple solid-phase microextraction with ion mobility spectrometry for on-site water analysis. The portable interface can be connected with the front-end of an ion mobility spectrometer directly without other modifications. The analytical performance was evaluated via the extraction of chemical warfare agents and simulants in water samples. Several parameters including ionic strength and extraction time have been investigated in detail. The application of the developed method afforded satisfactory recoveries ranging from 72.9% to 114.4% when applied to the analysis of real water samples.
A new approach to the LILW repository site selection
International Nuclear Information System (INIS)
Mele, I.; Zeleznik, N.
1998-01-01
After the failure of site selection, which was performed between 1990-1993, the Agency for Radwaste Management was urged to start a new site selection process for low and intermediate level waste (LILW). Since this is the most sensitive and delicate phase of the whole disposal project extensive analyses of foreign and domestic experiences in siting were performed. Three different models were studied and discussed at a workshop on preparation of the siting procedure for LILW repository. The participants invited to the workshop supported the combined approach, to the site selection, which is presented in this paper.(author)
Use of a web site to increase knowledge and awareness of hunger-related issues.
Jennings, Sharla; Cotugna, Nancy; Vickery, Connie E.
2003-01-01
The purpose of this study was to determine the current level of knowledge and awareness of hunger-related issues among a convenience sample of Delawareans. We also assessed whether raising knowledge and awareness of the hunger problem through the FBD's newly designed web site would encourage participation in antihunger activities. Via e-mail, 1,719 individuals were invited to participate in a three-phase, online survey, and 392 agreed. Phase-I questions were answered prior to viewing the web site, phase II (n=217) immediately afterward, and phase III (n=61) six weeks later. Responses indicated a high level of awareness about general hunger issues but specific knowledge proved to be at a lower level. No statistically significant differences were noted when data were collapsed across gender, age, educational level, or work setting. In a six-week post-survey, 41% of subjects were motivated by the web site to engage in an antihunger activity; 34% had told others about the web site and indicated it may be a useful tool in antihunger outreach efforts for the FBD. PMID:14651376
Use of a web site to increase knowledge and awareness of hunger-related issues.
Jennings, Sharla; Cotugna, Nancy; Vickery, Connie E
2003-11-01
The purpose of this study was to determine the current level of knowledge and awareness of hunger-related issues among a convenience sample of Delawareans. We also assessed whether raising knowledge and awareness of the hunger problem through the FBD's newly designed web site would encourage participation in antihunger activities. Via e-mail, 1,719 individuals were invited to participate in a three-phase, online survey, and 392 agreed. Phase-I questions were answered prior to viewing the web site, phase II (n=217) immediately afterward, and phase III (n=61) six weeks later. Responses indicated a high level of awareness about general hunger issues but specific knowledge proved to be at a lower level. No statistically significant differences were noted when data were collapsed across gender, age, educational level, or work setting. In a six-week post-survey, 41% of subjects were motivated by the web site to engage in an antihunger activity; 34% had told others about the web site and indicated it may be a useful tool in antihunger outreach efforts for the FBD.
Environmental monitoring considerations for low-level waste disposal sites
International Nuclear Information System (INIS)
Sedlet, J.
1982-01-01
All waste disposal sites are required to monitor the environment. The proposed NRC licensing rule, 10 CFR Part 61, requires that such monitoring be conducted before, during, and after a site is operated. An adequate monitoring program consists of measuring concentrations of radionuclides, chemically-toxic substances, and leachate indicators in environmental media and of evaluating specific physical properties of the site. In addition, the composition of the buried waste must be known. Methods for obtaining this information are discussed and monitoring programs are presented for the preoperational, operational, and postclosure phases of a disposal site. Environmental monitoring is considered in a broad context, since it includes monitoring burial trenches onsite, as well as surveillance in the offsite environment. Postclosure monitoring programs will be strongly influenced by the operational monitoring results. In some respects, this phase will be easier since the migration pathways should be well known and the number of radionuclides of concern reduced by radioactive decay. The results of the environmental monitoring program will be vital to successful site operation. These results should be used to determine if operational changes are needed and to predict future environmental impacts
Rodosta, T.D.; Litynski, J.T.; Plasynski, S.I.; Hickman, S.; Frailey, S.; Myer, L.
2011-01-01
The U.S. Department of Energy (DOE) is the lead Federal agency for the development and deployment of carbon sequestration technologies. As part of its mission to facilitate technology transfer and develop guidelines from lessons learned, DOE is developing a series of best practice manuals (BPMs) for carbon capture and storage (CCS). The "Site Screening, Site Selection, and Initial Characterization for Storage of CO2 in Deep Geological Formations" BPM is a compilation of best practices and includes flowchart diagrams illustrating the general decision making process for Site Screening, Site Selection, and Initial Characterization. The BPM integrates the knowledge gained from various programmatic efforts, with particular emphasis on the Characterization Phase through pilot-scale CO2 injection testing of the Validation Phase of the Regional Carbon Sequestration Partnership (RCSP) Initiative. Key geologic and surface elements that suitable candidate storage sites should possess are identified, along with example Site Screening, Site Selection, and Initial Characterization protocols for large-scale geologic storage projects located across diverse geologic and regional settings. This manual has been written as a working document, establishing a framework and methodology for proper site selection for CO2 geologic storage. This will be useful for future CO2 emitters, transporters, and storage providers. It will also be of use in informing local, regional, state, and national governmental agencies of best practices in proper sequestration site selection. Furthermore, it will educate the inquisitive general public on options and processes for geologic CO2 storage. In addition to providing best practices, the manual presents a geologic storage resource and capacity classification system. The system provides a "standard" to communicate storage and capacity estimates, uncertainty and project development risk, data guidelines and analyses for adequate site characterization, and
Effect of electrostatic interactions on phase stability of cubic phases of biomembranes.
Li, Shu Jie; Masum, Shah Md; Yamashita, Yuko; Tamba, Yukihiro; Yamazaki, Masahito
2002-06-01
We investigated effect of electrostatic interactions due to surfacecharges on structures and stability of cubic phases of monoolein (MO)membrane using the small-angle X-ray scattering method. Firstly, wechanged the surface charge density of the membrane by usingdioleoylphosphatidic acid (DOPA). As increasing DOPA concentration in themembrane at 30 wt % lipid concentration, a Q(224) to Q(229) phasetransition occurred at 0.6 mol % DOPA, and at and above 25 mol %, DOPA/MOmembranes were in the L(α) phase. NaCl in the bulk phase reduced theeffect of DOPA. These results indicate that as the electrostaticinteractions increase, the most stable phase changes as follows: Q(224)⇒ Q(229) ⇒ L(α). The increase in DOPAconcentration reduced the absolute value of spontaneous curvature of themembrane, | H(0) |. Secondly, we changed the surface charge of themembrane by adding a de novo designed peptide, which has netpositive charges and a binding site on the electrically neutral membraneinterface. The peptide-1 (WLFLLKKK) induced a Q(224) to Q(229)phase transition in the MO membrane at low peptide concentration. As NaClconcentration increases, the MO/peptide-1 membrane changed from Q(229)to Q(224) phase. The increase in peptide-1 concentration reduced |H(0) |. Based on these results, the stability of the cubic phases and themechanism of phase transition between cubic phase and L(α) phase arediscussed.
Early Site Permit Demonstration Program: Plant parameters envelope report. Volume 1
Energy Technology Data Exchange (ETDEWEB)
1993-03-01
The Early Site Permit (ESP) Demonstration Program is the nuclear industry`s initiative for piloting the early resolution of siting-related issues before the detailed design proceedings of the combined operating license review. The ESP Demonstration Program consists of three phases. The plant parameters envelopes task is part of Phase 1, which addresses the generic review of applicable federal regulations and develops criteria for safety and environmental assessment of potential sites. The plant parameters envelopes identify parameters that characterize the interface between an ALWR design and a potential site, and quantify the interface through values selected from the Utility Requirements Documents, vendor design information, or engineering assessments. When augmented with site-specific information, the plant parameters envelopes provide sufficient information to allow ESPs to be granted based on individual ALWR design information or enveloping design information for the evolutionary, passive, or generic ALWR plants. This document is expected to become a living document when used by future applicants.
Transcranial magnetic stimulation in Gilles de la Tourette syndrome.
Orth, Michael
2009-12-01
The cause of Gilles de la Tourette syndrome (GTS), a chronic motor and vocal tic disorder of childhood onset, remains unknown. Abnormalities in basal ganglia-thalamo-cortical circuits presumably play an important role in the pathophysiology underlying the involuntary tics. The use of transcranial magnetic stimulation (TMS), a noninvasive and painless tool to examine the excitability of several different circuits in the human motor cortex has advanced our understanding of the pathophysiology. Motor thresholds are similar in GTS and healthy subjects; in the resting state, recruitment of motor evoked potentials (MEPs) above threshold is more gradual in patients than controls. In contrast, recruitment of MEPs during preactivation is similar in both groups, as is the duration of the cortical silent period. This suggests that the distribution of excitability in the corticospinal system in patients at rest is different to that in healthy individuals. Importantly, correlation analysis showed that reduced levels of excitability at rest relate, in pure GTS patients, to video ratings of complex tics, and hand and finger tics, with less excitability predicting fewer tics. The correlations disappear for measures made during voluntary activation. This suggests that this is an adaptive response to abnormal basal ganglia-motor cortex inputs in an effort to reduce unwanted movements, a notion supported by electroencephalography-coherence studies that show increased cortico-cortical coupling. Compared to the healthy control group, short intracortical inhibition (SICI) thresholds are similar. However, above-threshold SICI recruitment and sensory afferent inhibition (SAI), a paradigm to examine sensory motor integration, are reduced in patients. This is consistent with the suggestion that reduced excitability of cortical inhibition is one factor that contributes to the difficulty that patients have in suppressing involuntary tics. In addition the reduced SAI indicates that impaired
Program for the Stripa project phase 3, 1986-1991
International Nuclear Information System (INIS)
1987-05-01
In June 1985, the Joint Technical Committee agreed to proceed with the planning required for the initiation of a Phase 3. The following general objectives of a third phase were agreed upon: To integrate various site characterization techniques and methods of analysis for the prediction and validation of ground-water flow and nuclide transport in an unexplored volume of Stripa granite and to demonstrate and verify the use of different materials and techniques for sealing ground-water flow paths in the Stripa granite. A schedule for the solicitation review of proposals was established. The general areas of investigations were defined as: Site characterization and validation; improvement of site assessment methods and concepts; sealing of fractured rock. (orig./HP)
A description of phases with induced hybridisation at finite temperatures
Golosov, D. I.
2018-05-01
In an extended Falicov-Kimball model, an excitonic insulator phase can be stabilised at zero temperature. With increasing temperature, the excitonic order parameter (interaction-induced hybridisation on-site, characterised by the absolute value and phase) eventually becomes disordered, which involves fluctuations of both its phase and (at higher T) its absolute value. In order to build an adequate mean field description, it is important to clarify the nature of degrees of freedom associated with the phase and absolute value of the induced hybridisation, and the corresponding phase space volume. We show that a possible description is provided by the SU(4) parametrisation on-site. In principle, this allows to describe both the lower-temperature regime where phase fluctuations destroy the long-range order, and the higher temperature crossover corresponding to a decrease of absolute value of the hybridisation relative to the fluctuations level. This picture is also expected to be relevant in other contexts, including the Kondo lattice model.
Closing the Gap: The Challenges of Treating Hepatitis C Virus Genotype 3 Infection.
Martin, Michelle T; Deming, Paulina
2017-06-01
The efficacy of hepatitis C virus (HCV) treatment has increased over the last 5 years to nearly 100% for many patient groups. Patients with genotype (GT) 3 HCV infection, however, and specifically cirrhotic or treatment-experienced patients, have lower sustained virologic response (SVR) rates than patients with other GTs. Because GT 3 presents more clinical challenges than other GTs, this review focuses on the evolution and efficacy of direct-acting antiviral (DAA) treatment options for HCV GT 3 infection after the historical standard of care with pegylated interferon and ribavirin. Our objective was to review the SVR rates with available and late-pipeline DAAs for HCV GT 3 infection and discuss challenges with successful GT 3 treatment. Authors performed a literature search of the PubMed/MEDLINE database (inception to March 27, 2017) and narrowed the field to clinical trials published in English. Trials that evaluated alternative treatments, non-DAA historical treatment, and DAAs not currently indicated for HCV were excluded. Trials only involving patients with human immunodeficiency virus/HCV coinfection were also excluded. Additional trials were identified from a review of the ClinicalTrials.gov database. Authors further identified references from a review of literature citations and reviewed annual meeting abstracts from the American Association for the Study of Liver Diseases and the European Association for the Study of the Liver for pipeline and real-world GT 3 data. Phase III trial data were not available to support all GT 3 treatment recommendations found in the guidelines. The SVR rates were lower in treatment-experienced and cirrhotic patients with GT 3 than other HCV populations. Treatment failure was associated with resistance to current treatment regimens. Clinical studies included patients with various levels of advanced liver disease, but few patients with decompensated cirrhosis were represented. Recent advances in pharmacologic treatment with DAAs
Assessment of social values in thermal plant siting
International Nuclear Information System (INIS)
Anon.
1976-01-01
The objective of the project is to develop a method for combining social values with techno-economic data for better decision making in thermal nuclear power plant siting. Quantified technical impact data which is socially weighted will allow for the optimal choice of site/design alternatives. In this phase, a study of community leadership in energy/environment issues was conducted in a town familiar with a (nuclear) thermal power plant. Secondly, a linear composite analysis of the measurement problems associated with combining diverse scales of impacts was completed. Third, a revision of the social values instrument used in a previous phase of the study was initiated. Finally, liaison activities with utilities were undertaken. Quantification of three of the technical impact factors is currently underway
Simultaneous Ka-Band Site Characterization: Goldstone, CA, White Sands, NM, and Guam, USA
Acosta, Roberto; Morse, Jacquelynne; Zemba, Michael; Nessel, James; Morabito, David; Caroglanian, Armen
2011-01-01
To statistically characterize atmospheric effects on Ka-band links at NASA operational sites, NASA has constructed site test interferometers (STI s) which directly measure the tropospheric phase stability and rain attenuation. These instruments observe an unmodulated beacon signal broadcast from a geostationary satellite (e.g., Anik F2) and measure the phase difference between the signals received by the two antennas and its signal attenuation. Three STI s have been deployed so far: the first one at the NASA Deep Space Network Tracking Complex in Goldstone, California (May 2007); the second at the NASA White Sands Complex, in Las Cruses, New Mexico (February 2009); and the third at the NASA Tracking and Data Relay Satellite (TDRS) Remote Ground Terminal (GRGT) complex in Guam (May 2010). Two station-years of simultaneous atmospheric phase fluctuation data have been collected at Goldstone and White Sands, while one year of data has been collected in Guam. With identical instruments operating simultaneously, we can directly compare the phase stability and rain attenuation at the three sites. Phase stability is analyzed statistically in terms of the root-mean-square (rms) of the tropospheric induced time delay fluctuations over 10 minute blocks. For two years, the time delay fluctuations at the DSN site in Goldstone, CA, have been better than 2.5 picoseconds (ps) for 90% of the time (with reference to zenith), meanwhile at the White Sands, New Mexico site, the time delay fluctuations have been better than 2.2 ps with reference to zenith) for 90% of time. For Guam, the time delay fluctuations have been better than 12 ps (reference to zenith) at 90% of the time, the higher fluctuations are as expected from a high humidity tropical rain zone. This type of data analysis, as well as many other site quality characteristics (e.g., rain attenuation, infrastructure, etc.) will be used to determine the suitability of all the sites for NASA s future communication services at Ka-band.
Initial source and site characterization studies for the U.C. Santa Barbara campus
Energy Technology Data Exchange (ETDEWEB)
Archuleta, R.; Nicholson, C.; Steidl, J.; Gurrola, L.; Alex, C.; Cochran, E.; Ely, G.; Tyler, T. [University of California, Santa Barbara (United States)
1997-12-01
The University of California Campus-Laboratory Collaboration (CLC) project is an integrated 3 year effort involving Lawrence Livermore National Laboratory (LLNL) and four UC campuses - Los Angeles (UCLA), Riverside (UCR), Santa Barbara (UCSB), and San Diego (UCSD) - plus additional collaborators at San Diego State University (SDSU), at Los Alamos National Laboratory and in industry. The primary purpose of the project is to estimate potential ground motions from large earthquakes and to predict site-specific ground motions for one critical structure on each campus. This project thus combines the disciplines of geology, seismology, geodesy, soil dynamics, and earthquake engineering into a fully integrated approach. Once completed, the CLC project will provide a template to evaluate other buildings at each of the four UC campuses, as well as provide a methodology for evaluating seismic hazards at other critical sites in California, including other UC locations at risk from large earthquakes. Another important objective of the CLC project is the education of students and other professional in the application of this integrated, multidisciplinary, state-of-the-art approach to the assessment of earthquake hazard. For each campus targeted by the CLC project, the seismic hazard study will consist of four phases: Phase I - Initial source and site characterization, Phase II - Drilling, logging, seismic monitoring, and laboratory dynamic soil testing, Phase III - Modeling of predicted site-specific earthquake ground motions, and Phase IV - Calculations of 3D building response. This report cover Phase I for the UCSB campus and incudes results up through March 1997.
Notes on implementation of IAEA Convention on Early Notification of a Nuclear Accident (CENNA)
International Nuclear Information System (INIS)
Camilleri, A.
1989-01-01
The communication arrangements adopted to implement the Convention on Early Notification of a Nuclear Accident (CENNA) are discussed. Central to these is the global Telecommunications system (GTS) of the World Meteorological Organisation (WMO). The GTS has a global structure and proven reliability and it operates 24 hours a day and the WMO has agreed to its being used to disseminate the information specified in CENNA relevant to minimising the radiological consequences of an accident. It has been necessary for individual states to arrange for a Telecommunications link between the nearest GTS entry point (normally at a national meteorological office) and the national authority responsible for receiving and issuing notifications under the international nuclear safety conventions. A telecommunications link is in place between the IAEA's Vienna headquarters and the WMO in Vienna. The system was tested with a series of five trial transmissions conducted in January - February 1988. 3 figs
Study of Allocation Guaranteed Time Slot Wireless Body Area Networks Based on IEEE 802.15.4
Yundra, E.; Harsono, G. D.
2018-04-01
This paper aims to determine the size of the Guaranteed Time Slot (GTS) on the super frame structure required for each sensor as well as to know the performance of the GTS resized system compared to the GTS standard on IEEE 802.15.4. This article proposes a scheme to improve IEEE 802.15.4 medium access control, called allocation Guaranteed Time Slot (ALGATIS). ALGATIS is expected to effectively allocate guaranteed time slot to the requested sensors, it adjusts the length of the slot in super frame duration based on the length of the packet data. This article presents a simulation experiment of IEEE 802.15.4, especially for star network, to predict the throughput of networks and average energy consumption. The simulation experiments show that the performance of ALGATIS is better than that of IEEE 802.15.4 standard in term of the throughput of networks and average energy consumption
Niagara Falls Storage Site, Lewiston, New York: geologic report
International Nuclear Information System (INIS)
1984-06-01
This report is one of a series of engineering and environmental reports planned for the US Department of Energy's properties at Niagara Falls, New York. It describes the essential geologic features of the Niagara Falls Storage Site. It is not intended to be a definitive statement of the engineering methods and designs required to obtain desired performance features for any permanent waste disposal at the site. Results are presented of a geological investigation that consisted of two phases. Phase 1 occurred during July 1982 and included geologic mapping, geophysical surveys, and a limited drilling program in the vicinity of the R-10 Dike, planned for interim storage of radioactive materials. Phase 2, initiated in December 1982, included excavation of test pits, geophysical surveys, drilling, observation well installation, and field permeability testing in the South Dike Area, the Northern Disposal Area, and the K-65 Tower Area
Niagara Falls Storage Site, Lewiston, New York: geologic report
Energy Technology Data Exchange (ETDEWEB)
1984-06-01
This report is one of a series of engineering and environmental reports planned for the US Department of Energy's properties at Niagara Falls, New York. It describes the essential geologic features of the Niagara Falls Storage Site. It is not intended to be a definitive statement of the engineering methods and designs required to obtain desired performance features for any permanent waste disposal at the site. Results are presented of a geological investigation that consisted of two phases. Phase 1 occurred during July 1982 and included geologic mapping, geophysical surveys, and a limited drilling program in the vicinity of the R-10 Dike, planned for interim storage of radioactive materials. Phase 2, initiated in December 1982, included excavation of test pits, geophysical surveys, drilling, observation well installation, and field permeability testing in the South Dike Area, the Northern Disposal Area, and the K-65 Tower Area.
Distribution and molecular evolution of bacillus anthracis genotypes in Namibia.
Directory of Open Access Journals (Sweden)
Wolfgang Beyer
Full Text Available The recent development of genetic markers for Bacillus anthracis has made it possible to monitor the spread and distribution of this pathogen during and between anthrax outbreaks. In Namibia, anthrax outbreaks occur annually in the Etosha National Park (ENP and on private game and livestock farms. We genotyped 384 B. anthracis isolates collected between 1983-2010 to identify the possible epidemiological correlations of anthrax outbreaks within and outside the ENP and to analyze genetic relationships between isolates from domestic and wild animals. The isolates came from 20 animal species and from the environment and were genotyped using a 31-marker multi-locus-VNTR-analysis (MLVA and, in part, by twelve single nucleotide polymorphism (SNP markers and four single nucleotide repeat (SNR markers. A total of 37 genotypes (GT were identified by MLVA, belonging to four SNP-groups. All GTs belonged to the A-branch in the cluster- and SNP-analyses. Thirteen GTs were found only outside the ENP, 18 only within the ENP and 6 both inside and outside. Genetic distances between isolates increased with increasing time between isolations. However, genetic distance between isolates at the beginning and end of the study period was relatively small, indicating that while the majority of GTs were only found sporadically, three genetically close GTs, accounting for more than four fifths of all the ENP isolates, appeared dominant throughout the study period. Genetic distances among isolates were significantly greater for isolates from different host species, but this effect was small, suggesting that while species-specific ecological factors may affect exposure processes, transmission cycles in different host species are still highly interrelated. The MLVA data were further used to establish a model of the probable evolution of GTs within the endemic region of the ENP. SNR-analysis was helpful in correlating an isolate with its source but did not elucidate
Döring, Barbara; Petzinger, Ernst
2014-08-01
The historical phasing concept of drug metabolism and elimination was introduced to comprise the two phases of metabolism: phase I metabolism for oxidations, reductions and hydrolyses, and phase II metabolism for synthesis. With this concept, biological membrane barriers obstructing the accessibility of metabolism sites in the cells for drugs were not considered. The concept of two phases was extended to a concept of four phases when drug transporters were detected that guided drugs and drug metabolites in and out of the cells. In particular, water soluble or charged drugs are virtually not able to overcome the phospholipid membrane barrier. Drug transporters belong to two main clusters of transporter families: the solute carrier (SLC) families and the ATP binding cassette (ABC) carriers. The ABC transporters comprise seven families with about 20 carriers involved in drug transport. All of them operate as pumps at the expense of ATP splitting. Embedded in the former phase concept, the term "phase III" was introduced by Ishikawa in 1992 for drug export by ABC efflux pumps. SLC comprise 52 families, from which many carriers are drug uptake transporters. Later on, this uptake process was referred to as the "phase 0 transport" of drugs. Transporters for xenobiotics in man and animal are most expressed in liver, but they are also present in extra-hepatic tissues such as in the kidney, the adrenal gland and lung. This review deals with the function of drug carriers in various organs and their impact on drug metabolism and elimination.
Solomon, Daniel H; Lu, Bing; Yu, Zhi; Corrigan, Cassandra; Harrold, Leslie R; Smolen, Josef S; Fraenkel, Liana; Katz, Jeffrey N; Losina, Elena
2018-01-05
We conducted a two-phase randomized controlled trial of a Learning Collaborative (LC) to facilitate implementation of treat to target (TTT) to manage rheumatoid arthritis (RA). We found substantial improvement in implementation of TTT in Phase I. Herein, we report on a second 9 months (Phase II) where we examined maintenance of response in Phase I and predictors of greater improvement in TTT adherence. We recruited 11 rheumatology sites and randomized them to either receive the LC during Phase I or to a wait-list control group that received the LC intervention during Phase II. The outcome was change in TTT implementation score (0 to 100, 100 is best) from pre- to post-intervention. TTT implementation score is defined as a percent of components documented in visit notes. Analyses examined: 1) the extent that the Phase I intervention teams sustained improvement in TTT; and, 2) predictors of TTT improvement. The analysis included 636 RA patients. At baseline, mean TTT implementation score was 11% in Phase I intervention sites and 13% in Phase II sites. After the intervention, TTT implementation score improved to 57% in the Phase I intervention sites and to 58% in the Phase II sites. Intervention sites from Phase I sustained the improvement during the Phase II (52%). Predictors of greater TTT improvement included only having rheumatologist providers at the site, academic affiliation of the site, fewer providers per site, and the rheumatologist provider being a trainee. Improvement in TTT remained relatively stable over a post-intervention period. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.
Bönisch, Friedericke; Frotscher, Johanna; Stanitzek, Sarah; Rühl, Ernst; Wüst, Matthias; Bitz, Oliver; Schwab, Wilfried
2014-01-01
Terpenoids represent one of the major classes of natural products and serve different biological functions. In grape (Vitis vinifera), a large fraction of these compounds is present as nonvolatile terpene glycosides. We have extracted putative glycosyltransferase (GT) sequences from the grape genome database that show similarity to Arabidopsis (Arabidopsis thaliana) GTs whose encoded proteins glucosylate a diversity of terpenes. Spatial and temporal expression levels of the potential VvGT genes were determined in five different grapevine varieties. Heterologous expression and biochemical assays of candidate genes led to the identification of a UDP-glucose:monoterpenol β-d-glucosyltransferase (VvGT7). The VvGT7 gene was expressed in various tissues in accordance with monoterpenyl glucoside accumulation in grape cultivars. Twelve allelic VvGT7 genes were isolated from five cultivars, and their encoded proteins were biochemically analyzed. They varied in substrate preference and catalytic activity. Three amino acids, which corresponded to none of the determinants previously identified for other plant GTs, were found to be important for enzymatic catalysis. Site-specific mutagenesis along with the analysis of allelic proteins also revealed amino acids that impact catalytic activity and substrate tolerance. These results demonstrate that VvGT7 may contribute to the production of geranyl and neryl glucoside during grape ripening. PMID:24784757
Methods for the analysis and remediation of contaminated sites
International Nuclear Information System (INIS)
Mariani, M.; Bemporad, E.; Berardi, S.; Marino, A.; Paglietti, F.
2008-01-01
In Italy, in recent years, the number of contaminated sites has multiplied disproportionately. In essence, contamination is caused by accidental spills or intentional discharge of pollutants into the soils or waters from industrial activities, or non-controlled deposits of urban and/or industrial waste, mostly part toxic and harmful. Contaminated sites clearly pose risks to human health and the environment; hence the need to remediate these sites. The remediation of soil and water and the restoration of degraded areas are complex operations requiring specific technical and scientific know-how, including knowledge of the methodologies and tools required to tackle problems arising during the different phases of the remediation process. These include, in particular: - health and environmental risk assessment procedures for the quantification of risks to human health (general population and workers) and the environment from a contaminated site; - remote sensing and the Geographical Information Systems (GIS), which are a fundamentally important IT support for each phase of planning and management of remediation interventions; - criteria for the management of sites contaminated by asbestos, a highly carcinogenic and therefore hazardous substance that was widely used in the past due to its particular mechanical and thermal characteristics; - analysis of the issues relating to waste management in contaminated sites; - relationship between safety procedures for workers and the general population. Identification of the best available techniques for an efficient, integrated management of contaminated sites, which will also take into account the health protection of workers and of the general population living near such sites
Burwick, Thomas; Bouras, Alexandros
2017-03-01
The communication-through-coherence (CTC) hypothesis states that a sending group of neurons will have a particularly strong effect on a receiving group if both groups oscillate in a phase-locked ("coherent") manner (Fries, 2005 , 2015 ). Here, we consider a situation with two visual stimuli, one in the focus of attention and the other distracting, resulting in two sites of excitation at an early cortical area that project to a common site in a next area. Taking a modeler's perspective, we confirm the workings of a mechanism that was proposed by Bosman et al. ( 2012 ) in the context of providing experimental evidence for the CTC hypothesis: a slightly higher gamma frequency of the attended sending site compared to the distracting site may cause selective interareal synchronization with the receiving site if combined with a slow-rhythm gamma phase reset. We also demonstrate the relevance of a slightly lower intrinsic frequency of the receiving site for this scenario. Moreover, we discuss conditions for a transition from bottom-up to top-down driven phase locking.
History of Hanford Site Defense Production (Brief)
Energy Technology Data Exchange (ETDEWEB)
GERBER, M S
2001-02-01
This paper acquaints the audience with the history of the Hanford Site, America's first full-scale defense plutonium production site. The paper includes the founding and basic operating history of the Hanford Site, including World War II construction and operations, three major postwar expansions (1947-55), the peak years of production (1956-63), production phase downs (1964-the present), a brief production spurt from 1984-86, the end of the Cold War, and the beginning of the waste cleanup mission. The paper also delineates historical waste practices and policies as they changed over the years at the Hanford Site, past efforts to chemically treat, ''fractionate,'' and/or immobilize Hanford's wastes, and resulting major waste legacies that remain today. This paper presents original, primary-source research into the waste history of the Hanford Site. Finally, the paper places the current Hanford Site waste remediation endeavors in the broad context of American and world history.
History of Hanford Site Defense Production (Brief)
International Nuclear Information System (INIS)
GERBER, M.S.
2001-01-01
This paper acquaints the audience with the history of the Hanford Site, America's first full-scale defense plutonium production site. The paper includes the founding and basic operating history of the Hanford Site, including World War II construction and operations, three major postwar expansions (1947-55), the peak years of production (1956-63), production phase downs (1964-the present), a brief production spurt from 1984-86, the end of the Cold War, and the beginning of the waste cleanup mission. The paper also delineates historical waste practices and policies as they changed over the years at the Hanford Site, past efforts to chemically treat, ''fractionate,'' and/or immobilize Hanford's wastes, and resulting major waste legacies that remain today. This paper presents original, primary-source research into the waste history of the Hanford Site. Finally, the paper places the current Hanford Site waste remediation endeavors in the broad context of American and world history
Rokkasho: Japanese site for ITER
International Nuclear Information System (INIS)
Ohtake, S.; Yamaguchi, V.; Matsuda, S.; Kishimoto, H.
2003-01-01
The Atomic Energy Commission of Japan authorized ITER as the core machine of the Third Phase Basic Program of Fusion Energy Development. After a series of discussions in the Atomic Energy Commission and the Council of Science and Technology Policy, Japanese Government concluded formally with the Cabinet Agreement on 31 May 2002 that Japan should participate in the ITER Project and offer the Rokkasho-Mura site for construction of ITER to the Negotiations among Canada (CA), the European Union (EU), Japan (JA), and the Russian Federation (RF). The JA site proposal is now under the international assessment in the framework of the ITER Negotiations. (author)
Phase I ResonantSonic CRADA report
International Nuclear Information System (INIS)
Richterich, L.R.; Amos, L.O.; Fancher, J.D.; McLellan, G.W.; Setzer, W.V.; Tuttle, B.G.; Hockey, R.L.; Ferris, R.H.; Riechers, D.M.; Pitman, S.G.
1994-01-01
This test report describes the Phase 1 testing and results of the ResonantSonic drilling method. This effort was conducted as part of a Cooperative Research and Development Agreement (CRADA) between the US Department of Energy, Pacific Northwest Laboratory, Westinghouse Hanford Company and Water Development Corporation. The purpose of this demonstration was to evaluate the Water Development Corporation's ResonantSonic drilling system, modify components as necessary and determine compatible drilling applications for the ResonantSonic drilling method for use at facilities in the DOE complex and private industry. Initially, the ResonantSonic drill was used to drill several test holes at the Drilling Technology Test Site to assess the feasibility of drilling vertical and angle holes. After this initial phase, a 45 degree angle vapor extraction well was drilled to a depth of 168 feet at the 200 West Carbon Tetrachloride Site. This well was drilled and completed in nine days. Extensive geologic and vapor sampling were conducted while drilling this well. In addition, testing was also conducted at the test site to evaluated drilling with larger diameter casing (8 5/8 inch). Evaluation of the Resonant Sonic drilling method will be continued during the Phase 2 portion of testing to determine if improvements to the ResonantSonic system will make it a more viable method for drilling and sampling
The Swedish approach to siting of a deep geological repository and interaction with the public
International Nuclear Information System (INIS)
Thegerstroem, C.
1993-01-01
The planned process for siting of a deep geological repository for encapsulated spent nuclear fuel in Sweden was presented in the 1992 SKB R and D programme. A first phase of the repository operation will be limited to disposal of a small amount of encapsulated spent nuclear fuel (approximately 800 tons). This phase will be followed by an evaluation of experiences as well as alternative options before deciding if, when and how to proceed with disposal of the remaining amounts of spent fuel. During the first phase it will be possible to retrieve the waste. Siting is planned to be done in stages. The field studies and safety assessments performed strongly indicate that it is possible to find geological suitable sites within many regions of Sweden. The potential for fulfilling safety requirements will be a crucial factor in site-selection. Local interest in, and attitude to a repository siting will play an important role in the siting process. It is important that an atmosphere of trust and openness can be established. Extensive geological site characterization work will be carried out at the sites selected and studies of other technical, social, economical or political matters will be equally important. Public communication and local participation will form an essential part of the siting programme from the outset. 3 refs., 3 figs
Directory of Open Access Journals (Sweden)
Woosik Jang
2015-08-01
Full Text Available Numerous countries have established policies for reducing greenhouse gas emissions and have suggested goals pertaining to these reductions. To reach the target reduction amounts, studies on the reduction of carbon emissions have been conducted with regard to all stages and processes in construction projects. According to a study on carbon emissions, the carbon emissions generated during the construction stage of road projects account for approximately 76 to 86% of the total carbon emissions, far exceeding the other stages, such as maintenance or demolition. Therefore, this study aims to develop a quantitative decision making model that supports the application of green technologies (GTs to reduce carbon emissions during the construction stage of road construction projects. First, the authors selected environmental soundness, economic feasibility and constructability as the key assessment indices for evaluating 20 GTs. Second, a fuzzy set/qualitative comparative analysis (FS/QCA was used to establish an objective decision-making model for the assessment of both the quantitative and qualitative characteristics of the key indices. To support the developed model, an expert survey was performed to assess the applicability of each GT from a practical perspective, which was verified with a case study using two additional GTs. The proposed model is expected to support practitioners in the application of suitable GTs to road projects and reduce carbon emissions, resulting in better decision making during road construction projects.
Huisman-van Dijk, Hilde M.; van de Schoot, Rens; Rijkeboer, Marleen M.; Mathews, Carol A; Cath, Dainelle C
2016-01-01
Gilles de la Tourette’s syndrome (GTS) is a disorder in which co-morbid obsessive-compulsive (OC), Attention Deficit Hyperactivity Disorder (ADHD) and autism symptoms occur in up to 60% of patients, suggesting shared etiology. We aimed to explore the phenotypic structure underlying GTS, taking tic, OC, ADHD, and autism symptoms into account as measured by various symptom scales (YGTSS, Y-BOCS, CAARS and AQ) in 225 GTS patients and 371 family members. First, Confirmatory Factor Analyses (CFA) were performed on the symptom structure of each separate symptom scale. Second, the symptom dimensions derived from each scale were combined in one model, and correlations between them were calculated. Using the correlation matrix, Exploratory Factor Analyses (EFA) were performed on the symptom dimensions across the scales. EFA revealed a five factor structure: tic/aggression/symmetry; OC symptoms/compulsive tics/numbers and patterns; ADHD symptoms; autism symptoms; and hoarding/inattention symptoms. The symptom factors found in this study are partly in line with the traditional categorical boundaries of the symptom scales used, and partly reveal a symptom structure that cuts through the diagnostic categories. This phenotypic structure might more closely reflect underlying etiologies than a structure that classically describes GTS patients according to absence or presence of comorbid OCD, ADHD and autism, and might inform both future genetic and treatment studies. PMID:26826899
Siting of a low-level radioactive waste disposal facility
International Nuclear Information System (INIS)
Alvarado, R.A.
1983-01-01
The Texas Low-Level Radioactive Waste Disposal Authority was established by the 67th Legislature to assure safe and effective disposal of the state's low-level radioactive waste. The Authority operates under provisions of the Texas Low-Level Radioactive Waste Disposal Authority Act, VACS 4590f-1. In Texas, low-level radioactive waste is defined as any radioactive material that has a half-life of 35 years or less or that has less than 10 nanocuries per gram of transuranics, and may include radioactive material not excluded by this definition with a half-life or more than 35 years if special disposal criteria are established. Prior to beginning the siting study, the Authority developed both exclusionary and inclusionary criteria. Major requirements of the siting guidelines are that the site shall be located such that it will not interfere with: (1) existing or near-future industrial use, (2) sensitive environmental and ecological areas, and (3) existing and projected population growth. Therefore, the site should be located away from currently known recoverable mineral, energy and water resources, population centers, and areas of projected growth. This would reduce the potential for inadvertent intruders, increasing the likelihood for stability of the disposal site after closure. The identification of potential sites for disposal of low-level radioactive waste involves a phased progression from statewide screening to site-specific exploration, using a set of exclusionary and preferential criteria to guide the process. This methodology applied the criteria in a sequential manner to focus the analysis on progressively smaller and more favorable areas. The study was divided into three phases: (1) statewide screening; (2) site identification; and (3) preliminary site characterization
Site investigations for the disposal of spent fuel - investigation program
International Nuclear Information System (INIS)
Aeikaes, Timo
1985-11-01
The Industrial Power Company Ltd (TVO) is making preparations for the final disposal of spent nuclear fuel into the Finnish bedrock. The revised site investigation program for the years 1986-2010 is presented in this report. The objectives and activities in the near future are described in more detail. The main objectives and frame programs for the investigations in the more distant future are described. The program planning of these investigations are being developed in the preceding site investigations. The investigations for the site selection are divided into four phases: 1983-1985 selection of the investigation areas, preparations for the field investigations, drilling and investigations in a deep test borehole; 1986-1992 preliminary site investigations in 5-10 investigation areas; 1993-2000 detailed site investigations in 2-3 investigation areas. Site selection in the year 2000; 2001-2010 complementary investigations on the selected site. The first investigation phase will be carried out as planned. In this phase a 1001 m deep test borehole was drilled at Lavia in western Finland. With the investigations in the borehole and related development work, preparations were made for the future field investigations. The equipment and investigation methods are being developed during the site investigations. The equipment for taking groundwater samples and the unit for hydraulic testing have been developed. In the future the emphasis in the work will be in developing equipment for monitoring of the hydraulic head and measuring the volumetric flow. In groundwater sampling the present procedure can be improved by adding the test for the in-situ measurements. The results of the field investigations will be stored and processed in a centralized data base. The data base will transmit the results for the interpretation and then the interpreted results transmitted for model calculations and reporting. The cost estimate for the investigations in 1986-2010 is 110-125 million
Strategy for Meeting the Secretary of Energy and Hanford Site FY 2001 Pollution Prevention Goals
International Nuclear Information System (INIS)
CLARK, D.E.
2000-01-01
The purpose of this strategy is to identify the Fiscal Year (FY) 2001 Hanford Site waste reduction, sanitary recycling and affirmative procurement goals and identify the action required to ensure that the Secretary of Energy's FY 2005 pollution prevention and the FY 2001 Hanford Site goals are met. The strategy and plan to ensure that the Secretary of Energy's routine waste reduction, recycling, cleanup/stabilization waste and affirmative procurement goals are met consists of four phases. The first phase is to ensure that the infrastructure is in place to support planning and organization. This phase involves ensuring that roles and responsibilities are identified; requirement documents are current; goals and successes are communicated; and accurate and current waste information is available. Roles and responsibilities are identified and the RL requirement documents (i.e., the Hanford Site Waste Minimization and Pollution Prevention Awareness Program Plan and Hanford Site Guide for Preparing and Maintaining Generator Group Pollution Prevention Program Documentation) will specify the Secretary of Energy's goals. Goals will be communicated formally and informally via the Hanford Reach, training sessions, meetings and correspondence. Sharing of pollution prevention successes and goal progress are encouraged at the Pollution Prevention/Waste Minimization (PZ/WMin) quarterly meetings. Existing site waste generation databases will be utilized to provide current waste generation data. The second phase of the strategy and plan is to establish and allocate goals by prime contractor (i.e. Fluor Hanford, Inc. (FH), Pacific Northwest National Laboratory (PNNL), Bechtel Hanford Inc. (BHI), and CH2MHill Hanford Group (CHG)). This requires determining current status toward meeting the Secretary of Energy's goals; establishing the Hanford Site FY goals, and allocating waste reduction goals by prime contractor. The third phase of the strategy and plan is goal implementation. This
The siting of UK nuclear reactors.
Grimston, Malcolm; Nuttall, William J; Vaughan, Geoff
2014-06-01
Choosing a suitable site for a nuclear power station requires the consideration and balancing of several factors. Some 'physical' site characteristics, such as the local climate and the potential for seismic activity, will be generic to all reactors designs, while others, such as the availability of cooling water, the area of land required and geological conditions capable of sustaining the weight of the reactor and other buildings will to an extent be dependent on the particular design of reactor chosen (or alternatively the reactor design chosen may to an extent be dependent on the characteristics of an available site). However, one particularly interesting tension is a human and demographic one. On the one hand it is beneficial to place nuclear stations close to centres of population, to reduce transmission losses and other costs (including to the local environment) of transporting electricity over large distances from generator to consumer. On the other it is advantageous to place nuclear stations some distance away from such population centres in order to minimise the potential human consequences of a major release of radioactive materials in the (extremely unlikely) event of a major nuclear accident, not only in terms of direct exposure but also concerning the management of emergency planning, notably evacuation.This paper considers the emergence of policies aimed at managing this tension in the UK. In the first phase of nuclear development (roughly speaking 1945-1965) there was a highly cautious attitude, with installations being placed in remote rural locations with very low population density. The second phase (1965-1985) saw a more relaxed approach, allowing the development of AGR nuclear power stations (which with concrete pressure vessels were regarded as significantly safer) closer to population centres (in 'semi-urban' locations, notably at Hartlepool and Heysham). In the third phase (1985-2005) there was very little new nuclear development, Sizewell
The MULTIMEDIA exposure model as a risk assessment tool at LUST sites
International Nuclear Information System (INIS)
Bowers, R.B.
1994-01-01
In the course of characterizing Leaking Underground Storage Tank (LUST) sites in the Commonwealth, Virginia Department of Environmental Quality (VDEQ) regulations section 6.5.A.2.b of VR-680-13-02, requires that a risk assessment be performed which must address, among other issues, aqueous phase contaminant exposure levels to critical receptors. often, during the course of conducting such an assessment, the aqueous phase contaminant plume has not yet intercepted the critical down gradient receptor. Thus, the determination of the maximum potential exposure level to this receptor can only be made through the use of an appropriate fate and transport model. This paper focuses on an application of the saturated zone module of the USEPA's MULTIMEDIA Exposure Assessment model. The case study presented involves a LUST site in the Commonwealth, in which four critical receptors of leaded gasoline contaminated groundwater were identified. These receptors included three residential water wells and an intermittent stream. At this particular site, the aqueous phase contaminant plume had not yet reached any of the receptors; and the MULTIMEDIA model was employed to predict the steady-state aqueous phase concentrations with very favorable results
Energy Technology Data Exchange (ETDEWEB)
Geier, J E [Golder Associates AB, Uppsala (Sweden)
1996-12-01
Specific procedures and source data are described for the construction and application of discrete-feature hydrological models for the vicinity of Aespoe. Documentation is given for all major phases of the work, including: Statistical analyses to develop and validate discrete-fracture network models, Preliminary evaluation, construction, and calibration of the site-scale model based on the SITE-94 structural model of Aespoe, Simulation of multiple realizations of the integrated model, and variations, to predict groundwater flow, and Evaluation of near-field and far-field parameters for performance assessment calculations. Procedures are documented in terms of the computer batch files and executable scripts that were used to perform the main steps in these analyses, to provide for traceability of results that are used in the SITE-94 performance assessment calculations. 43 refs.
International Nuclear Information System (INIS)
Geier, J.E.
1996-12-01
Specific procedures and source data are described for the construction and application of discrete-feature hydrological models for the vicinity of Aespoe. Documentation is given for all major phases of the work, including: Statistical analyses to develop and validate discrete-fracture network models, Preliminary evaluation, construction, and calibration of the site-scale model based on the SITE-94 structural model of Aespoe, Simulation of multiple realizations of the integrated model, and variations, to predict groundwater flow, and Evaluation of near-field and far-field parameters for performance assessment calculations. Procedures are documented in terms of the computer batch files and executable scripts that were used to perform the main steps in these analyses, to provide for traceability of results that are used in the SITE-94 performance assessment calculations. 43 refs
SSC [Superconducting Super Collider] site evaluations
International Nuclear Information System (INIS)
1988-11-01
With this report, the SSC Site Task Force forwards to the Director, Office of Energy Research, US Department of Energy (DOE), its evaluation of the technical criteria and life-cycle costs for the proposed SSC sites judged to be the best qualified. The criteria against which each site was evaluated are those set forth in the Invitation for Site Proposals for the Superconducting Super Collider (DOE/ER-0315) (Invitation) which was prepared by the Task Force and issued in April 1987. The methodology followed by the Task Force in this report and in all other phases of the proposal evaluation has been consistent with the SSC site selection process approved by DOE's Energy System Acquisition Advisory Board (ESAAB). The goal of the site selection process is to identify a site that will permit the highest level of research productivity and overall effectiveness of the SSC at a reasonable cost of construction and operation and with minimial impact on the environment. The Task Force acknowledges that all seven sites are, indeed, highly qualified locations for the construction and operation of the SSC on the basis of technical and cost considerations. In performing its evaluation, which is presented in this paper, the Task Force took an in-depth look at each site on the basis of site visits and extensive technical analyses. A consensus rating for each technical evaluation criterion and subcriterion was developed for each site
Flammable gas project expert elicitation results for Hanford Site double-shell tanks
International Nuclear Information System (INIS)
Bratzel, D.R.
1998-01-01
This report documents the results of the second phase of parameter quantification by the flammable gas expert panel. This second phase is focused on the analysis of flammable gas accidents in the Hanford Site double-shell tanks. The first phase of parameter quantification, performed in 1997 was focused on the analysis of Hanford single-shell tanks
Velmurugu, Yogambigai; Vivas, Paula; Connolly, Mitchell; Kuznetsov, Serguei V; Rice, Phoebe A; Ansari, Anjum
2018-02-28
The dynamics and mechanism of how site-specific DNA-bending proteins initially interrogate potential binding sites prior to recognition have remained elusive for most systems. Here we present these dynamics for Integration Host factor (IHF), a nucleoid-associated architectural protein, using a μs-resolved T-jump approach. Our studies show two distinct DNA-bending steps during site recognition by IHF. While the faster (∼100 μs) step is unaffected by changes in DNA or protein sequence that alter affinity by >100-fold, the slower (1-10 ms) step is accelerated ∼5-fold when mismatches are introduced at DNA sites that are sharply kinked in the specific complex. The amplitudes of the fast phase increase when the specific complex is destabilized and decrease with increasing [salt], which increases specificity. Taken together, these results indicate that the fast phase is non-specific DNA bending while the slow phase, which responds only to changes in DNA flexibility at the kink sites, is specific DNA kinking during site recognition. Notably, the timescales for the fast phase overlap with one-dimensional diffusion times measured for several proteins on DNA, suggesting that these dynamics reflect partial DNA bending during interrogation of potential binding sites by IHF as it scans DNA.
Energy Technology Data Exchange (ETDEWEB)
NONE
1995-08-01
The Uranium Mill Tailings Remedial Action (UMTRA) Project consists of the Surface Project (phase I), and the Ground Water Project (phase II). For the UMTRA Project site located near Naturita, Colorado (the Naturita site), phase I involves the removal of radioactively contaminated soils and materials and their transportation to a disposal site at Union Carbide Corporation`s Upper Burbank Repository at Uravan, Colorado, about 13 road miles (mi) (21 kilometers [km]) to the northwest. No uranium mill tailings are involved because the tailings were removed from the Naturita site and placed at Coke Oven, Colorado, during 1977 to 1979. Phase II of the project will evaluate the nature and extent of ground water contamination resulting from uranium processing and its effect on human health or the environment; and will determine site-specific ground water compliance strategies in accordance with the US Environmental Protection Agency (EPA) ground water standards established for the UMTRA Project. Human health risks could occur from drinking water pumped from a hypothetical well drilled in the contaminated ground water area. Environmental risks may result if plants or animals are exposed to contaminated ground water, or surface water that has received contaminated ground water. Therefore, a risk assessment is conducted for the Naturita site. This risk assessment report is the first site-specific document prepared for the Ground Water Project at the Naturita site. What follows is an evaluation of current and possible future impacts to the public and the environment from exposure to contaminated ground water. The results of this evaluation and further site characterization will be used to determine whether any action is needed to protect human health or the environment.
International Nuclear Information System (INIS)
1995-08-01
The Uranium Mill Tailings Remedial Action (UMTRA) Project consists of the Surface Project (phase I), and the Ground Water Project (phase II). For the UMTRA Project site located near Naturita, Colorado (the Naturita site), phase I involves the removal of radioactively contaminated soils and materials and their transportation to a disposal site at Union Carbide Corporation's Upper Burbank Repository at Uravan, Colorado, about 13 road miles (mi) (21 kilometers [km]) to the northwest. No uranium mill tailings are involved because the tailings were removed from the Naturita site and placed at Coke Oven, Colorado, during 1977 to 1979. Phase II of the project will evaluate the nature and extent of ground water contamination resulting from uranium processing and its effect on human health or the environment; and will determine site-specific ground water compliance strategies in accordance with the US Environmental Protection Agency (EPA) ground water standards established for the UMTRA Project. Human health risks could occur from drinking water pumped from a hypothetical well drilled in the contaminated ground water area. Environmental risks may result if plants or animals are exposed to contaminated ground water, or surface water that has received contaminated ground water. Therefore, a risk assessment is conducted for the Naturita site. This risk assessment report is the first site-specific document prepared for the Ground Water Project at the Naturita site. What follows is an evaluation of current and possible future impacts to the public and the environment from exposure to contaminated ground water. The results of this evaluation and further site characterization will be used to determine whether any action is needed to protect human health or the environment
An Enhanced Reservation-Based MAC Protocol for IEEE 802.15.4 Networks
Afonso, José A.; Silva, Helder D.; Macedo, Pedro; Rocha, Luis A.
2011-01-01
The IEEE 802.15.4 Medium Access Control (MAC) protocol is an enabling standard for wireless sensor networks. In order to support applications requiring dedicated bandwidth or bounded delay, it provides a reservation-based scheme named Guaranteed Time Slot (GTS). However, the GTS scheme presents some drawbacks, such as inefficient bandwidth utilization and support to a maximum of only seven devices. This paper presents eLPRT (enhanced Low Power Real Time), a new reservation-based MAC protocol that introduces several performance enhancing features in comparison to the GTS scheme. This MAC protocol builds on top of LPRT (Low Power Real Time) and includes various mechanisms designed to increase data transmission reliability against channel errors, improve bandwidth utilization and increase the number of supported devices. A motion capture system based on inertial and magnetic sensors has been used to validate the protocol. The effectiveness of the performance enhancements introduced by each of the new features is demonstrated through the provision of both simulation and experimental results. PMID:22163826
International Nuclear Information System (INIS)
Eikenberg, J.; Hoehn, E.; Fierz, T.; Frick, U.
1994-09-01
During 1991 four migration experiments with 22 Na (run 50), 24 Na (run 48), 85 Sr (run 50) and 123 I (run 47,49) were carried out in the migration fracture at the Grimsel Test Site (GTS) using a two-well injection -extraction technique (dipole configuration). All tests were accompanied by simultaneous injection of Na-fluorescein (uranine) as a conservative tracer. The dipole flow field was installed between boreholes 86.004 (injection well) and 87.006 (extraction well). The extraction flow rate was always held constant at 150 mL/min, while two different injection flow rates of 50 mL/min (runs 47,48) and 10 mL/min (runs 49, 50) were chosen to vary the flow field geometry. These exercises advance the transport model studies to evaluate important fracture specific parameters. Prior to the field tests with radiotracers of cationic Na + and Sr 2+ , the potential sorption of these elements onto equipment materials such as tubing, pumps, detectors was investigated in the field rock laboratory under identical flow conditions and test arrangements as for the fracture tests. In contrast to Na + , bivalent Sr 2+ sorbed strongly, especially onto stainless steel tubing surrounding the NaI scintillation counters used for on-line γ-detection of the radiotracers. To minimize sorption of Sr 2+ on equipment, all exposed materials were then completely replaced by PRFE (Teflon). Further tests revealed that this material proved to be chemically inert with respect to Na + and Sr 2+ . Calibration of the field data was made by check laboratory analyses of water samples. The detection limits of all tracers were below 0.05 Bp/mL. (author) 38 figs., 13 tabs., refs
International Nuclear Information System (INIS)
Niehoff, Peter; Polgar, Csaba; Ostertag, Horst; Major, Tibor; Sulyok, Zoltan; Kimmig, Bernhard; Kovacs, Gyoergy
2006-01-01
Background and purpose: In a prospective multi-center phase II trial, we investigated the MammoSite[reg] Radiation Therapy System, a new device for delivering intracavitary brachytherapy following breast conserving surgery. The MammoSite[reg] is a dual lumen, closed ended catheter with a small, spherical inflatable balloon and a port for connecting a remote afterloader to the central lumen. We analyzed the surgical procedure and placement of the MammoSite[reg], treatment planning and radiation delivery complications and cosmesis, as well the comfort for the patients. Patients and methods: Between 2002 and 2004 a total of 32 patients (pts) were implanted using the MammoSite[reg]. The reference isodose was defined 1 cm from the balloon surface. We analyzed the post-implant anatomic position of the applicator and the geometric form of the balloon via ultrasound, CT and X-ray, related side effects, cosmetic outcome and patient quality of life. Results: Twenty-three out of 32 patients (72%) were eligible for MammoSite[reg] intracavitary brachytherapy. Twenty-eight percentage had to be excluded because of different reasons. Eleven patients were treated with primary brachytherapy with a total dose of 34 Gy (2x3.4 Gy) and 12 had a boost with a mean dose of 13.3 Gy (range: 7.5-15 Gy; 2x2.5 Gy) combined with EBRT and doses ranged between 46 and 50 Gy. In three cases a balloon rupture occurred. We observed two abscesses within 3 months of implantation and serious seroma development in 10 patients (39%). Skin related side effects were erythema in 21 patients (91%), hyperpigmentation in 13 patients (56%) and teleangiectasia in six patients (26%) after mean follow-up 20 months. Conclusions: The MammoSite[reg] Radiation Therapy System is a feasible treatment modality for intracavitary brachytherapy of breast cancer after breast conserving surgery. The advantage of the system is only one applicator is necessary for the delivery of a fractionated radiotherapy. In addition, patient
Geological techniques used in the siting of South Africa's nuclear facilities
International Nuclear Information System (INIS)
Andersen, N.J.B.
1990-01-01
Nuclear site selection studies begin with an initial screening phase in order to pick regions which could be potentially suitable. When assessing a potential nuclear site from a structural geological point of view, the most important factors are the presence of 'capable faults', the seismicity of the area, and the existence of good foundation rock. A geological evaluation of a potential site involves a literature survey for all existing geological data on the site, geophysical investigations, structural domain analysis and geological mapping
Fusion research at Culham site
International Nuclear Information System (INIS)
Tolonen, P.; Toppila, T.
1998-01-01
One of the many targets on the Finnish Nuclear Society (ATS) excursion to England was the Culham fusion research site. The site has divided into two parts. One of them is UKAEA Fusion with small scale fusion reactors and 200 employees. UKAEA has 3 fusion reactors at Culham site. One of is the START (Small Tight Aspect Ratio Tokamak) which was operational since 1991 but is today already out of operation. UKAEA has been operating a JET-like tokamak fusion reactor COMPASS-D since 1989. The latest of three reactors is MAST (Mega Amp Spherical Tokamak), which is still under construction. The first plasma will take place in the end of 1998. Another part of Culham site is JET (Joint European Torus), an all-European fusion undertaking with 350 employees. 150 of them are from various European countries and the rest 200 are employed by UKAEA. JET is the biggest fusion reactor ever and it represents the latest step in world wide fusion programme. In October 1997 JET achieved a world record in fusion power and energy. JET produced 16,1 MW power for 1 s and totally 21,7 MJ energy. This is the closest attempt to achieve break-even conditions. The next step in world wide fusion programme will be international ITER-reactor. This undertaking has some financial problems, since United States has taken distance to magnetic fusion research and moved closer to inertial fusion with funding of US Department of Defence. The planned reactor, however, is physically twice as big as JET. The step after this phase will be DEMO, which is purposed to produce fusion energy. According to our hosts in Culham this phase is 40 years ahead. (author)
Genetic algorithm optimization for dynamic construction site layout planning
Directory of Open Access Journals (Sweden)
Farmakis Panagiotis M.
2018-02-01
Full Text Available The dynamic construction site layout planning (DCSLP problem refers to the efficient placement and relocation of temporary construction facilities within a dynamically changing construction site environment considering the characteristics of facilities and work interrelationships, the shape and topography of the construction site, and the time-varying project needs. A multi-objective dynamic optimization model is developed for this problem that considers construction and relocation costs of facilities, transportation costs of resources moving from one facility to another or to workplaces, as well as safety and environmental considerations resulting from facilities’ operations and interconnections. The latter considerations are taken into account in the form of preferences or constraints regarding the proximity or remoteness of particular facilities to other facilities or work areas. The analysis of multiple project phases and the dynamic facility relocation from phase to phase highly increases the problem size, which, even in its static form, falls within the NP (for Nondeterministic Polynomial time- hard class of combinatorial optimization problems. For this reason, a genetic algorithm has been implemented for the solution due to its capability to robustly search within a large solution space. Several case studies and operational scenarios have been implemented through the Palisade’s Evolver software for model testing and evaluation. The results indicate satisfactory model response to time-varying input data in terms of solution quality and computation time. The model can provide decision support to site managers, allowing them to examine alternative scenarios and fine-tune optimal solutions according to their experience by introducing desirable preferences or constraints in the decision process.
International Nuclear Information System (INIS)
Spalding, B.P.; Naney, M.T.
1995-06-01
This plan is to be implemented for Phase III ISV operations and post operations sampling. Two previous project phases involving site characterization have been completed and required their own site specific health and safety plans. Project activities will take place at Seepage Pit 1 in Waste Area Grouping 7 at ORNL, Oak Ridge, Tennessee. Purpose of this document is to establish standard health and safety procedures for ORNL project personnel and contractor employees in performance of this work. Site activities shall be performed in accordance with Energy Systems safety and health policies and procedures, DOE orders, Occupational Safety and Health Administration Standards 29 CFR Part 1910 and 1926; applicable United States Environmental Protection Agency requirements; and consensus standards. Where the word ''shall'' is used, the provisions of this plan are mandatory. Specific requirements of regulations and orders have been incorporated into this plan in accordance with applicability. Included from 29 CFR are 1910.120 Hazardous Waste Operations and Emergency Response; 1910.146, Permit Required - Confined Space; 1910.1200, Hazard Communication; DOE Orders requirements of 5480.4, Environmental Protection, Safety and Health Protection Standards; 5480.11, Radiation Protection; and N5480.6, Radiological Control Manual. In addition, guidance and policy will be followed as described in the Environmental Restoration Program Health and Safety Plan. The levels of personal protection and the procedures specified in this plan are based on the best information available from reference documents and site characterization data. Therefore, these recommendations represent the minimum health and safety requirements to be observed by all personnel engaged in this project
Energy Technology Data Exchange (ETDEWEB)
Spalding, B.P.; Naney, M.T.
1995-06-01
This plan is to be implemented for Phase III ISV operations and post operations sampling. Two previous project phases involving site characterization have been completed and required their own site specific health and safety plans. Project activities will take place at Seepage Pit 1 in Waste Area Grouping 7 at ORNL, Oak Ridge, Tennessee. Purpose of this document is to establish standard health and safety procedures for ORNL project personnel and contractor employees in performance of this work. Site activities shall be performed in accordance with Energy Systems safety and health policies and procedures, DOE orders, Occupational Safety and Health Administration Standards 29 CFR Part 1910 and 1926; applicable United States Environmental Protection Agency requirements; and consensus standards. Where the word ``shall`` is used, the provisions of this plan are mandatory. Specific requirements of regulations and orders have been incorporated into this plan in accordance with applicability. Included from 29 CFR are 1910.120 Hazardous Waste Operations and Emergency Response; 1910.146, Permit Required - Confined Space; 1910.1200, Hazard Communication; DOE Orders requirements of 5480.4, Environmental Protection, Safety and Health Protection Standards; 5480.11, Radiation Protection; and N5480.6, Radiological Control Manual. In addition, guidance and policy will be followed as described in the Environmental Restoration Program Health and Safety Plan. The levels of personal protection and the procedures specified in this plan are based on the best information available from reference documents and site characterization data. Therefore, these recommendations represent the minimum health and safety requirements to be observed by all personnel engaged in this project.
Energy Technology Data Exchange (ETDEWEB)
Botvinick, E.H.; Frais, M.A.; Shosa, D.W.; O' Connell, J.W.; Pacheco-Alvarez, J.A.; Scheinman, M.; Hattner, R.S.; Morady, F.; Faulkner, D.B.
1982-08-01
The ability of scintigraphic phase image analysis to characterize patterns of abnormal ventricular activation was investigated. The pattern of phase distribution and sequential phase changes over both right and left ventricular regions of interest were evaluated in 16 patients with normal electrical activation and wall motion and compared with those in 8 patients with an artificial pacemaker and 4 patients with sinus rhythm with the Wolff-Parkinson-White syndrome and delta waves. Normally, the site of earliest phase angle was seen at the base of the interventricular septum, with sequential change affecting the body of the septum and the cardiac apex and then spreading laterally to involve the body of both ventricles. The site of earliest phase angle was located at the apex of the right ventricle in seven patients with a right ventricular endocardial pacemaker and on the lateral left ventricular wall in one patient with a left ventricular epicardial pacemaker. In each case the site corresponded exactly to the position of the pacing electrode as seen on posteroanterior and left lateral chest X-ray films, and sequential phase changes spread from the initial focus to affect both ventricles. In each of the patients with the Wolff-Parkinson-White syndrome, the site of earliest ventricular phase angle was located, and it corresponded exactly to the site of the bypass tract as determined by endocardial mapping. In this way, four bypass pathways, two posterior left paraseptal, one left lateral and one right lateral, were correctly localized scintigraphically. On the basis of the sequence of mechanical contraction, phase image analysis provides an accurate noninvasive method of detecting abnormal foci of ventricular activation.
International Nuclear Information System (INIS)
Botvinick, E.H.; Frais, M.A.; Shosa, D.W.; O'Connell, J.W.; Pacheco-Alvarez, J.A.; Scheinman, M.; Hattner, R.S.; Morady, F.; Faulkner, D.B.
1982-01-01
The ability of scintigraphic phase image analysis to characterize patterns of abnormal ventricular activation was investigated. The pattern of phase distribution and sequential phase changes over both right and left ventricular regions of interest were evaluated in 16 patients with normal electrical activation and wall motion and compared with those in 8 patients with an artificial pacemaker and 4 patients with sinus rhythm with the Wolff-Parkinson-White syndrome and delta waves. Normally, the site of earliest phase angle was seen at the base of the interventricular septum, with sequential change affecting the body of the septum and the cardiac apex and then spreading laterally to involve the body of both ventricles. The site of earliest phase angle was located at the apex of the right ventricle in seven patients with a right ventricular endocardial pacemaker and on the lateral left ventricular wall in one patient with a left ventricular epicardial pacemaker. In each case the site corresponded exactly to the position of the pacing electrode as seen on posteroanterior and left lateral chest X-ray films, and sequential phase changes spread from the initial focus to affect both ventricles. In each of the patients with the Wolff-Parkinson-White syndrome, the site of earliest ventricular phase angle was located, and it corresponded exactly to the site of the bypass tract as determined by endocardial mapping. In this way, four bypass pathways, two posterior left paraseptal, one left lateral and one right lateral, were correctly localized scintigraphically. On the basis of the sequence of mechanical contraction, phase image analysis provides an accurate noninvasive method of detecting abnormal foci of ventricular activation
Quantum Phase Transition and Entanglement in Topological Quantum Wires.
Cho, Jaeyoon; Kim, Kun Woo
2017-06-05
We investigate the quantum phase transition of the Su-Schrieffer-Heeger (SSH) model by inspecting the two-site entanglements in the ground state. It is shown that the topological phase transition of the SSH model is signified by a nonanalyticity of local entanglement, which becomes discontinuous for finite even system sizes, and that this nonanalyticity has a topological origin. Such a peculiar singularity has a universal nature in one-dimensional topological phase transitions of noninteracting fermions. We make this clearer by pointing out that an analogous quantity in the Kitaev chain exhibiting the identical nonanalyticity is the local electron density. As a byproduct, we show that there exists a different type of phase transition, whereby the pattern of the two-site entanglements undergoes a sudden change. This transition is characterised solely by quantum information theory and does not accompany the closure of the spectral gap. We analyse the scaling behaviours of the entanglement in the vicinities of the transition points.
Energy Technology Data Exchange (ETDEWEB)
1994-09-01
This Risk Assessment evaluated potential impacts to public health or the environment caused by ground water contamination at the former uranium mill processing site. In the first phase of the U.S. Department of Energy`s Uranium Mill Tailings Remedial Action (UMTRA) Project, the tailing and other contaminated material at this site were placed in a disposal cell near the Gas Hills Plant in 1990. The second phase of the UMTRA Project is to evaluate ground water contamination. This risk assessment is the first site-specific document to evaluate potential health and environmental risks for the Riverton site under the Ground Water Project; it will help determine whether remedial actions are needed for contaminated ground water at the site.
International Nuclear Information System (INIS)
1994-09-01
This Risk Assessment evaluated potential impacts to public health or the environment caused by ground water contamination at the former uranium mill processing site. In the first phase of the U.S. Department of Energy's Uranium Mill Tailings Remedial Action (UMTRA) Project, the tailing and other contaminated material at this site were placed in a disposal cell near the Gas Hills Plant in 1990. The second phase of the UMTRA Project is to evaluate ground water contamination. This risk assessment is the first site-specific document to evaluate potential health and environmental risks for the Riverton site under the Ground Water Project; it will help determine whether remedial actions are needed for contaminated ground water at the site
International Nuclear Information System (INIS)
1977-12-01
An engineering assessment was performed of the problems resulting from the existence of radioactive uranium mill tailings at the Spook Site, Converse County, Wyoming. Services include the performance of core drillings, soil, water and other sample analyses, radiometric measurements to determine areas with radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site geology, hydrology, and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 187,000 tons of tailings at the Spook Site constitutes the main environmental impact, which is negligible. The two alternative actions presented are better fencing of the site in its present state, and placing tailings and contaminated on-site materials and soil in the open-pit mine and covering the resulting pile with 2 ft of overburden materials. The cost estimates for the options are $81,000 and $142,000, respectively
Wang, Hai Tao; Cho, Sam Young
2015-01-14
In order to investigate the quantum phase transition in the one-dimensional quantum compass model, we numerically calculate non-local string correlations, entanglement entropy and fidelity per lattice site by using the infinite matrix product state representation with the infinite time evolving block decimation method. In the whole range of the interaction parameters, we find that four distinct string orders characterize the four different Haldane phases and the topological quantum phase transition occurs between the Haldane phases. The critical exponents of the string order parameters β = 1/8 and the cental charges c = 1/2 at the critical points show that the topological phase transitions between the phases belong to an Ising type of universality classes. In addition to the string order parameters, the singularities of the second derivative of the ground state energies per site, the continuous and singular behaviors of the Von Neumann entropy and the pinch points of the fidelity per lattice site manifest that the phase transitions between the phases are of the second-order, in contrast to the first-order transition suggested in previous studies.
A method of transferring G.T.S. benchmark value to survey area using electronic total station
Digital Repository Service at National Institute of Oceanography (India)
Ganesan, P.
= the Constant and K = the distance in kilometers. The value of “C” depends upon four criteria namely: 1) Quality of the instrument 2) Observer’s care and skill 3) The character of the site and 4) The atmospheric... distance between the foot of the prism rod and the optical center of the prism should be measured for input. Sufficient care should be taken by the prism rod holder to keep the prism as vertical as possible. 8 3) To maintain high standard of accuracy...
Clean conditions during the erection phase
International Nuclear Information System (INIS)
Koschel, P.
1977-01-01
Following the basic requirements of the Regulatory Guide 1.37 and ANSI 45.2.1 - Standard on Cleaning of Fluid Systems and Associated Components during the Construction Phase of Nuclear Power Plants as a guideline, the implementation of cleaning operations in the pre-installation phase, the installation phase and the maintenance of clean conditions until the operational phase is covered. Specific information will be given from the practical experience point of view with the work execution under clean conditions of piping and components at the semi-finished product manufacturer, the prefabrication workshop and the on-site installation with specific reference to the various detailed procedures required by individual system builders for nuclear power plants in Germany and abroad. (orig.) [de
The development of an on-site container
International Nuclear Information System (INIS)
Glass, R.E.; McAllaster, M.E.; Jones, P.L.; McKinney, A.L.
1993-01-01
This paper describes the results of the development of a packaging designed for on-site transportation of chemical munitions. The criteria for the package were patterned after the requirements for Type B packagings, but were modified to take credit for the operational controls that could be applied on-site. The design phase has been completed and a contract has been placed for fabrication of 165 units. In addition to the tests completed during the design phase, a complete sequence of verification tests will be performed on the first fleet unit. This sequence will consist of: (1) a 22,700-kg load placed on the packaging for 24 hours, (2) the flat side free drop, (3) the center-of-gravity over closure joint puncture test, and (4) a 15-min all-engulfing JP-4 pool-fire test. At the completion of the test sequence, the package will be required to meet the less than 1 x 10 -1 std cc/s leak test. (J.P.N.)
A model for arsenic anti-site incorporation in GaAs grown by hydride vapor phase epitaxy
Energy Technology Data Exchange (ETDEWEB)
Schulte, K. L.; Kuech, T. F. [Department of Chemical and Biological Engineering, University of Wisconsin-Madison, Madison, Wisconsin 53706 (United States)
2014-12-28
GaAs growth by hydride vapor phase epitaxy (HVPE) has regained interest as a potential route to low cost, high efficiency thin film photovoltaics. In order to attain the highest efficiencies, deep level defect incorporation in these materials must be understood and controlled. The arsenic anti-site defect, As{sub Ga} or EL2, is the predominant deep level defect in HVPE-grown GaAs. In the present study, the relationships between HVPE growth conditions and incorporation of EL2 in GaAs epilayers were determined. Epitaxial n-GaAs layers were grown under a wide range of deposition temperatures (T{sub D}) and gallium chloride partial pressures (P{sub GaCl}), and the EL2 concentration, [EL2], was determined by deep level transient spectroscopy. [EL2] agreed with equilibrium thermodynamic predictions in layers grown under conditions in which the growth rate, R{sub G}, was controlled by conditions near thermodynamic equilibrium. [EL2] fell below equilibrium levels when R{sub G} was controlled by surface kinetic processes, with the disparity increasing as R{sub G} decreased. The surface chemical composition during growth was determined to have a strong influence on EL2 incorporation. Under thermodynamically limited growth conditions, e.g., high T{sub D} and/or low P{sub GaCl}, the surface vacancy concentration was high and the bulk crystal was close to equilibrium with the vapor phase. Under kinetically limited growth conditions, e.g., low T{sub D} and/or high P{sub GaCl}, the surface attained a high GaCl coverage, blocking As adsorption. This competitive adsorption process reduced the growth rate and also limited the amount of arsenic that incorporated as As{sub Ga}. A defect incorporation model which accounted for the surface concentration of arsenic as a function of the growth conditions, was developed. This model was used to identify optimal growth parameters for the growth of thin films for photovoltaics, conditions in which a high growth rate and low [EL2] could be
Energy Technology Data Exchange (ETDEWEB)
1977-12-01
An engineering assessment was performed of the problems resulting from the existence of radioactive uranium sand residues at the Lowman, Idaho, site. Services normally include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting investigations of site hydrology and meteorology, and the evaluation and costing of alternative corrective actions. Radon gas release from the 90,000 tons of sand residues at the Lowman site constitutes the most significant environmental impact, although external gamma radiation is also a factor. The two alternative actions presented are dike construction, fencing, and maintenance (Option I); and consolidation of the piles, addition of a 2-ft-thick stabilization cover, and on-site cleanup (Option II). Both options include remedial action at off-site structures. Cost estimates for the two options are $393,000 and $590,000.
International Nuclear Information System (INIS)
1977-12-01
An engineering assessment was performed of the problems resulting from the existence of radioactive uranium sand residues at the Lowman, Idaho, site. Services normally include the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting investigations of site hydrology and meteorology, and the evaluation and costing of alternative corrective actions. Radon gas release from the 90,000 tons of sand residues at the Lowman site constitutes the most significant environmental impact, although external gamma radiation is also a factor. The two alternative actions presented are dike construction, fencing, and maintenance (Option I); and consolidation of the piles, addition of a 2-ft-thick stabilization cover, and on-site cleanup (Option II). Both options include remedial action at off-site structures. Cost estimates for the two options are $393,000 and $590,000
International Nuclear Information System (INIS)
McKenna, S.A.; Wakasugi, Keiichiro; Webb, E.K.; Makino, Hitoshi; Ishihara, Yoshinao; Ijiri, Yuji; Sawada, Atsushi; Baba, Tomoko; Ishiguro, Katsuhiko; Umeki, Hiroyuki
2000-01-01
For the last ten years, the Japanese High-Level Nuclear Waste (HLW) repository program has focused on assessing the feasibility of a basic repository concept, which resulted in the recently published H12 Report. As Japan enters the implementation phase, a new organization must identify, screen and choose potential repository sites. Thus, a rapid mechanism for determining the likelihood of site suitability is critical. The threshold approach, described here, is a simple mechanism for defining the likelihood that a site is suitable given estimates of several critical parameters. We rely on the results of a companion paper, which described a probabilistic performance assessment simulation of the HLW reference case in the H12 report. The most critical two or three input parameters are plotted against each other and treated as spatial variables. Geostatistics is used to interpret the spatial correlation, which in turn is used to simulate multiple realizations of the parameter value maps. By combining an array of realizations, we can look at the probability that a given site, as represented by estimates of this combination of parameters, would be good host for a repository site
Six independent fucose-binding sites in the crystal structure of Aspergillus oryzae lectin
Energy Technology Data Exchange (ETDEWEB)
Makyio, Hisayoshi [Structural Biology Research Center, Photon Factory, Institute of Materials Structure Science, High Energy Accelerator Research Organization (KEK), 1-1 Oho, Tsukuba, Ibaraki, 305-0801 (Japan); Shimabukuro, Junpei; Suzuki, Tatsuya [Department of Applied Bioorganic Chemistry, Gifu University, 1-1 Yanagido, Gifu-shi, Gifu 501-1193 (Japan); Institute for Integrated Cell-Material Sciences (WPI-iCeMS), Kyoto University, Yoshida Ushinomiya-cho, Sakyo-ku, Kyoto 606-8501 (Japan); Imamura, Akihiro; Ishida, Hideharu [Department of Applied Bioorganic Chemistry, Gifu University, 1-1 Yanagido, Gifu-shi, Gifu 501-1193 (Japan); Kiso, Makoto [Department of Applied Bioorganic Chemistry, Gifu University, 1-1 Yanagido, Gifu-shi, Gifu 501-1193 (Japan); Institute for Integrated Cell-Material Sciences (WPI-iCeMS), Kyoto University, Yoshida Ushinomiya-cho, Sakyo-ku, Kyoto 606-8501 (Japan); Ando, Hiromune, E-mail: hando@gifu-u.ac.jp [Department of Applied Bioorganic Chemistry, Gifu University, 1-1 Yanagido, Gifu-shi, Gifu 501-1193 (Japan); Institute for Integrated Cell-Material Sciences (WPI-iCeMS), Kyoto University, Yoshida Ushinomiya-cho, Sakyo-ku, Kyoto 606-8501 (Japan); Kato, Ryuichi, E-mail: ryuichi.kato@kek.jp [Structural Biology Research Center, Photon Factory, Institute of Materials Structure Science, High Energy Accelerator Research Organization (KEK), 1-1 Oho, Tsukuba, Ibaraki, 305-0801 (Japan)
2016-08-26
The crystal structure of AOL (a fucose-specific lectin of Aspergillus oryzae) has been solved by SAD (single-wavelength anomalous diffraction) and MAD (multi-wavelength anomalous diffraction) phasing of seleno-fucosides. The overall structure is a six-bladed β-propeller similar to that of other fucose-specific lectins. The fucose moieties of the seleno-fucosides are located in six fucose-binding sites. Although the Arg and Glu/Gln residues bound to the fucose moiety are common to all fucose-binding sites, the amino-acid residues involved in fucose binding at each site are not identical. The varying peak heights of the seleniums in the electron density map suggest that each fucose-binding site has a different carbohydrate binding affinity. - Highlights: • The six-bladed β-propeller structure of AOL was solved by seleno-sugar phasing. • The mode of fucose binding is essentially conserved at all six binding sites. • The seleno-fucosides exhibit slightly different interactions and electron densities. • These findings suggest that the affinity for fucose is not identical at each site.
Six independent fucose-binding sites in the crystal structure of Aspergillus oryzae lectin
International Nuclear Information System (INIS)
Makyio, Hisayoshi; Shimabukuro, Junpei; Suzuki, Tatsuya; Imamura, Akihiro; Ishida, Hideharu; Kiso, Makoto; Ando, Hiromune; Kato, Ryuichi
2016-01-01
The crystal structure of AOL (a fucose-specific lectin of Aspergillus oryzae) has been solved by SAD (single-wavelength anomalous diffraction) and MAD (multi-wavelength anomalous diffraction) phasing of seleno-fucosides. The overall structure is a six-bladed β-propeller similar to that of other fucose-specific lectins. The fucose moieties of the seleno-fucosides are located in six fucose-binding sites. Although the Arg and Glu/Gln residues bound to the fucose moiety are common to all fucose-binding sites, the amino-acid residues involved in fucose binding at each site are not identical. The varying peak heights of the seleniums in the electron density map suggest that each fucose-binding site has a different carbohydrate binding affinity. - Highlights: • The six-bladed β-propeller structure of AOL was solved by seleno-sugar phasing. • The mode of fucose binding is essentially conserved at all six binding sites. • The seleno-fucosides exhibit slightly different interactions and electron densities. • These findings suggest that the affinity for fucose is not identical at each site.
Development of a site-wide accident management center for the Savannah River Site
International Nuclear Information System (INIS)
Heal, D.W.; Britt, T.E.
1992-01-01
In 1990, the Safety Analysis Group at the Savannah River Site (SRS) began development of an Accident Management program. The program was designed to provide a total system which would meet the Department of Energy (DOE) Safety Performance Criteria, in regard to severe accident management, in the most effective manner. This paper will present two significant changes in the current SRS Accident Management program which will be used to meet these expanded needs. The first and most significant change will be to expand the diversity of the groups involved in the Accident Management process. In the future, organizations such as Environmental Safety, Health ampersand Quality Assurance, Emergency Planning, Site Management, Human Factors, Risk Assessment, and many others will work as an integrated team to solve facility problems. Organizations such as Materials Technology, Equipment Engineering and many of the laboratories on site will be utilized as support groups to increase the technical capability for specific accident analyses. This phase of the program is currently being structured, and should be operational by January of 1993
Graphite-supported platinum catalysts: Effects of gas and aqueous phase treatments
Energy Technology Data Exchange (ETDEWEB)
Vleeming, J.H.; Kuster, B.F.M.; Marin, G.B. [Eindhoven Univ. of Technology (Netherlands)] [and others
1997-03-01
The effects on the platinum particle diameter and the available platinum surface area of a graphite-supported platinum catalyst resulting from pretreatments and from performing a selective oxidation reaction are investigated. In the gas phase considerable catalyst sintering occurs only in the presence of oxygen at 773 K due to extensive carbon burn-off, whereas in an aqueous phase platinum particle growth is limited upon oxidative treatment. A hydrogen treatment in aqueous phase at 363 K causes platinum particle growth, aggregate formation, and covering of metal sites. These phenomena become more important with increasing pH. Platinum particle growth and aggregate formation are attributed to platinum particle rather than platinum adatom mobility and is caused by the destruction of the oxygen-containing surface groups on the graphite support, which serve as anchorage sites for the platinum particles. Site covering is caused by products originating from the graphite support, which are formed as a result of the reductive treatments. When performing the aqueous phase oxidation of methyl {alpha}-D-glucopyranoside at 323 K and a pH of 9, catalyst modifications are small under oxidative conditions. Exposure of the catalyst for several hours to methyl {alpha}-D-glucopyranoside under the same conditions but in the absence of oxygen causes site covering. 50 refs., 9 figs., 1 tab.
2007-08-31
explosions at the former Soviet Semipalatinsk test site (STS). Labeled stations are those for which high resolution digital data are available. 12 8...characteristics of regional phase observations from underground nuclear explosions at the former Soviet Semipalatinsk and Novaya Zemlya test sites , the...various regional phases observed from underground nuclear explosions at the former Soviet Semipalatinsk test site (STS). Labeled stations are those for
Summary report of the experiences from TVO's site investigations
International Nuclear Information System (INIS)
Oehberg, A.; Saksa, P.; Ahokas, H.; Ruotsalainen, P.; Snellman, M.
1994-09-01
In 1992 Teollisuuden Voima Oy (TVO) completed preliminary site investigations for radioactive waste disposal at five sites in Finland. The aim of this report was the compilation of the experiences from TVO's site investigations. The main interest was focused on investigation strategies and the most important investigation methods for the conceptual modelling. The objective of the preliminary site investigations was to obtain data on the bedrock properties in order to evaluate the areas. The programme was divided into four stages, each stage having its own subobjective. The site-specific investigation programme for each site included a large common part and a small site-specific part. The strategies (objectives) and experiences from different disciplines, geology, hydrogeochemistry, geophysics and geohydrology, are presented in the report. The conceptual modelling work procedure including both bedrock and groundwater modelling is described briefly using the Olkiluoto site as an example. Each of the other areas has undergone similar phases of work. (52 refs., 45 figs., 5 tabs.)
Malyavantham, Kishore S; Bhattacharya, Sambit; Barbeitos, Marcos; Mukherjee, Lopamudra; Xu, Jinhui; Fackelmayer, Frank O; Berezney, Ronald
2009-01-01
Higher order chromatin organization in concert with epigenetic regulation is a key process that determines gene expression at the global level. The organization of dynamic chromatin domains and their associated protein factors is intertwined with nuclear function to create higher levels of functional zones within the cell nucleus. As a step towards elucidating the organization and dynamics of these functional zones, we have investigated the spatial proximities among a constellation of functionally related sites that are found within euchromatic regions of the cell nucleus including: HP1γ, nascent transcript sites (TS), active DNA replicating sites in early S phase (PCNA) and RNA polymerase II sites. We report close associations among these different sites with proximity values specific for each combination. Analysis of matrin 3 and SAF-A sites demonstrates that these nuclear matrix proteins are highly proximal with the functionally related sites as well as to each other and display closely aligned and overlapping regions following application of the minimal spanning tree (MST) algorithm to visualize higher order network-like patterns. Our findings suggest that multiple factors within the nuclear microenvironment collectively form higher order combinatorial arrays of function. We propose a model for the organization of these functional neighborhoods which takes into account the proximity values of the individual sites and their spatial organization within the nuclear architecture. PMID:18618731
The Gilles de la Tourette syndrome: the current status.
Robertson, Mary May
2012-10-01
Gilles de la Tourette syndrome (GTS) is characterised by multiple motor and one or more vocal/phonic tics. GTS was once thought to be rare, but many relatively recent studies suggest that the prevalence is about 1% of the worldwide community, apart from in Sub-Saharan Black Africa. Comorbidity and coexistent psychopathology are common, occurring in about 90% of clinical cohorts and individuals in the community. The most common comorbidities are attention deficit hyperactivity disorder, obsessive-compulsive behaviours, and disorder, and autistic spectrum disorders, while the most common coexisting psychopathologies are depression, anxiety and behavioural disorders such as oppositional defiant and conduct disorder. There has been an increasing amount of evidence to show that the quality of life in young people is reduced when compared with normative data or healthy control populations. It is widely accepted that most cases of GTS are inherited, but the genetic mechanisms appear much more complex than previously understood, as evidenced by many recent studies; indeed, there have been suggestions of 'general neurodevelopmental genes' which affect the brain development after which the 'specific GTS gene(s)' may further affect the phenotype. Other aetiopathogenetic suggestions have included environmental factors such as neuro-immunological factors, infections, prenatal and peri-natal difficulties and androgen influences. Few studies have addressed aetiology and phenotype, but initial results are exciting. The search for endophenotypes has followed subsequently. Intriguing neuroanatomical and brain circuitry abnormalities have now been suggested in GTS; the most evidence is for cortical thinning and a reduction in the size of the caudate nucleus. Thorough assessment is imperative and multidisciplinary management is the ideal. Treatment should be 'symptom targeted', and in mild cases, psycho-education and reassurance for the patient and the family may be sufficient
International Nuclear Information System (INIS)
Jewett, M.A.
2011-01-01
This paper explores the role that future land use decisions have played in the establishment of cost-effective cleanup objectives and the setting of environmental media cleanup levels for the three major U.S. Department of Energy (DOE) sites for which cleanup has now been successfully completed: the Rocky Flats, Mound, and Fernald Closure Sites. At each site, there are distinct consensus-building histories throughout the following four phases: (1) the facility shut-down and site investigation phase, which took place at the completion of their Cold War nuclear-material production missions; (2) the decision-making phase, whereby stakeholder and regulatory-agency consensus was achieved for the future land-use-based environmental decisions confronting the sites; (3) the remedy selection phase, whereby appropriate remedial actions were identified to achieve the future land-use-based decisions; and (4) the implementation phase, whereby the selected remedial actions for these high-profile sites were implemented and successfully closed out. At each of the three projects, there were strained relationships and distrust between the local community and the DOE as a result of site contamination and potential health effects to the workers and local residents. To engage citizens and interested stakeholder groups - particularly in the role of final land use in the decision-making process, the site management teams at each respective site developed new public-participation strategies to open stakeholder communication channels with site leadership, technical staff, and the regulatory agencies. This action proved invaluable to the success of the projects and reaching consensus on appropriate levels of cleanup. With the implementation of the cleanup remedies now complete, each of the three DOE sites have become models for future environmental-remediation projects and associated decision making.
Remedial investigation for the 200-BP-1 operable unit, Hanford Site, Richland, Washington
International Nuclear Information System (INIS)
Buckmaster, M.A.
1991-01-01
The Hanford Site, Richland, Washington, contains over 1500 identified waste sites that will be characterized and remediated over the next 30 years. In support of the ''Hanford Federal Facility Agreement and Consent Order,'' the US Department of Energy has initiated a remedial investigation/feasibility study (RI/FS) at the 200-BP-1 operable unit. The 200-BP-1 RI is the first Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) investigation on the Hanford Site that involves drilling into highly radioactive and chemically contaminated soils. The initial phase of the site characterization is oriented toward determining the nature and extent of any contamination present in the vicinity of the 200-BP-1 operable unit. The major focus of the Phase I RI is the drilling and sampling of 10 inactive waste disposal units which received low level radioactive liquid waste
International Nuclear Information System (INIS)
Rawson, S.A.; Walton, J.C.; Baca, R.G.
1989-01-01
Environmental monitoring of a mixed-waste disposal site at the Idaho National Engineering Laboratory has confirmed release and migration into the vadose zone of: (1) chlorinated hydrocarbons in the vapor phase and (2) trace levels of certain transuranic elements. The finding has prompted an evaluation of the potential role of waste petroleum hydrocarbons in mediating or influencing contaminant migration from the disposal site. Disposal records indicate that a large volume of machine oil contaminated with transuranic isotopes was disposed at the site along with the chlorinated solvents and other radioactive wastes. A multiphase flow model was used to assess the possible extent of oil and vapor movement through the 177 m thick vadose zone. One dimensional simulations were performed to estimate the vertical distribution of the vapor phase, the aqueous phase, and immiscible free liquid as a function of time. The simulations indicate that the oil may migrate slowly through the vadose zone, to potentially significant depths. Calculated transport rates support the following ranking with regard to relative mobility: vapor phase > aqueous phase > free liquid. 21 refs., 7 figs., 2 tabs
Goussé, Véronique; Czernecki, Virginie; Denis, Pierre; Stilgenbauer, Jean-Louis; Deniau, Emmanuelle; Hartmann, Andreas
2016-02-01
Previous reports have indicated that raising a child with Gilles de la Tourette syndrome (GTS) could be considered a stressful experience. Thus our study aimed to assess the impact of perceived stress (i.e. parental cognitive perception of their child's disorder) and social support (number of people surrounding the subject providing support) on coping strategies-defined as processes of restoring balance between excessive demands and inadequate resources-of parents having a child with GTS. Twenty-eight parents of 21 patients with GTS (aged 6 to 16years) completed questionnaires on perceived stress (ALE Scale), social support (SSQ6), coping strategies (WCC-R) and anxiety-depression (HAD). Principal component analysis showed a negative correlation between social support on one side and perceived stress and anxiety/depression on the other. Problem- and emotion-focused coping both correlated with social support, all of them being independent from perceived stress and anxiety/depression. Hierarchical ascendant classification showed three clusters of individuals in our parents' groups: i) those having high scores in perceived stress and anxiety-depression; ii) those having high scores in social support associated with low scores in perceived stress; iii) parents having lower than average scores on both problem- and emotion- focused coping and social support. Our results reinforce the need for developing training programs for parents with GTS children to better understand and tolerate the disorder to decrease their stress. Copyright © 2015 Elsevier Inc. All rights reserved.
Disease-specific quality of life in young patients with tourette syndrome.
Cavanna, Andrea E; Luoni, Chiara; Selvini, Claudia; Blangiardo, Rosanna; Eddy, Clare M; Silvestri, Paola R; Calì, Paola V; Gagliardi, Emanuela; Balottin, Umberto; Cardona, Francesco; Rizzo, Renata; Termine, Cristiano
2013-02-01
Tourette syndrome is a neurodevelopmental disorder characterized by multiple tics and is often associated with comorbid behavioral problems. Research with generic instruments in child populations showed that comorbid disorders can have a greater impact on health-related quality of life than tic severity. This study investigated the usefulness of a newly developed disease-specific instrument, the Gilles de la Tourette Syndrome-Quality of Life Scale for Children and Adolescents (GTS-QOL-C&A), in assessing health-related quality of life in young patients with Tourette syndrome with and without behavioral comorbidity. We recruited 75 patients with Tourette syndrome (60 males; age 12.4 ± 3.2 years). All participants were evaluated by a neuropsychiatrist and completed a standardized psychometric battery, including the GTS-QOL-C&A, Child Depression Inventory, and Multidimensional Anxiety Scale for Children. Forty-two patients (56%) fulfilled diagnostic criteria for at least one comorbidity: obsessive-compulsive disorder (n = 25 patients [33.3%]); attention deficit/hyperactivity disorder (n = 6 patients [8%]); both (n = 11 patients [14.7%]). The GTS-QOL-C&A demonstrated usefulness in differentiating "pure" Tourette syndrome from Tourette syndrome "plus" behavioral problems with regard to health-related quality of life scores for the obsessive-compulsive subscale. In addition to focusing on core tic symptoms, the GTS-QOL-C&A showed sensitivity to the impact of behavioral comorbidities on health-related quality of life and can usefully complement existing nonspecific instruments. Copyright © 2013 Elsevier Inc. All rights reserved.
Environmental regulatory compliance plan, Deaf County site, Texas: Draft revision 1
International Nuclear Information System (INIS)
1987-01-01
The DOE is committed to conduct its operation in an environmentally safe and sound manner and comply with the letter and spirit of applicable environmental statues and regulations. These objectives are codified in DOE order N 5400.2, ''Environmental Policy Statement.'' This document, the Deaf Smith County site (Texas) Environmental Regulatory Compliance Plam (ERCP), is one means of implementing that policy. The ERCP describes the environmental regulatory requirements applicable to the Deaf Smith County site (Texas), and presented the framework within which the Salt Repository Project Office (SRPO) will comply with the requirements. The plan also discusses how DOE will address State and local environmental requirements. To achieve this purpose the ERCP will be developed in phases. This version of the ERCP is the first phase in the delopment of the ERCP. It represents the Salt Repository Project Office's understanding of environmental requirements for the site characterization phase of repository development. After consultation with the appropriate federal and state agencies and affected Indian tribes, the ERCP will be updated to reflect the results of consultation with these agencies and affected Indian tribes. 6 refs., 38 figs
Execution programme for the initial site investigations at Simpevarp
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-10-01
In the feasibility studies that were completed in 2001, eight sites were identified as potentially suitable for hosting a repository. All the identified sites meet the safety requirements with respect to bedrock conditions that could be checked at that time. The feasibility studies have revealed good potential when it comes to the technical and environmental aspects as well. Based on an integrated evaluation SKB proposed to start site investigations with test drillings at three sites; Simpevarp, Forsmark, and Tierp north. The site investigations have started at Simpevarp and Forsmark. The municipal council of Tierp rejected a site investigation in April 2002. The site investigations are divided into two main phases; initial and complete investigations. Initial Site Investigation is performed to identify the site within a specified area that is deemed to be most suitable for a deep repository and to determine whether the feasibility study's judgement of the suitability of the area holds up in the light of borehole data from repository depth. The Initial Site Investigation is expected to take about 3 years. If the assessment shows that the site has good potential to host a repository, Complete Site Investigation will follow for an expected duration of another 3 years. The purpose of the Complete Site Investigation is to gather all information required to select one of the sites as the main alternative and to apply for a permit for construction of the deep repository at that site. The site-specific programme gives an overview of the whole site investigation phase as well as a detailed description of the initial stage. The results of the initial investigations will determine whether Simpevarp is appropriate for further investigation, i.e. the Complete Site Investigation. This document summarizes the investigations that will be carried out at Simpevarp during the Initial Site Investigations. The document is a working document, which will be successively updated as
Execution programme for the initial site investigations at Simpevarp
International Nuclear Information System (INIS)
2002-10-01
In the feasibility studies that were completed in 2001, eight sites were identified as potentially suitable for hosting a repository. All the identified sites meet the safety requirements with respect to bedrock conditions that could be checked at that time. The feasibility studies have revealed good potential when it comes to the technical and environmental aspects as well. Based on an integrated evaluation SKB proposed to start site investigations with test drillings at three sites; Simpevarp, Forsmark, and Tierp north. The site investigations have started at Simpevarp and Forsmark. The municipal council of Tierp rejected a site investigation in April 2002. The site investigations are divided into two main phases; initial and complete investigations. Initial Site Investigation is performed to identify the site within a specified area that is deemed to be most suitable for a deep repository and to determine whether the feasibility study's judgement of the suitability of the area holds up in the light of borehole data from repository depth. The Initial Site Investigation is expected to take about 3 years. If the assessment shows that the site has good potential to host a repository, Complete Site Investigation will follow for an expected duration of another 3 years. The purpose of the Complete Site Investigation is to gather all information required to select one of the sites as the main alternative and to apply for a permit for construction of the deep repository at that site. The site-specific programme gives an overview of the whole site investigation phase as well as a detailed description of the initial stage. The results of the initial investigations will determine whether Simpevarp is appropriate for further investigation, i.e. the Complete Site Investigation. This document summarizes the investigations that will be carried out at Simpevarp during the Initial Site Investigations. The document is a working document, which will be successively updated as
Hydrologic and geologic aspects of low-level radioactive-waste site management
International Nuclear Information System (INIS)
Cutshall, N.H.; Vaughan, N.D.; Haase, C.S.; Olsen, C.R.; Huff, D.D.
1982-01-01
Hydrologic and geologic site characterization is a critical phase in development of shallow land-burial sites for low-level radioactive-waste disposal, especially in humid environments. Structural features such as folds, faults, and bedding and textural features such as formation permeability, porosity, and mineralogy all affect the water balance and water movement and, in turn, radionuclide migration. Where these features vary over short distance scales, detailed mapping is required in order to enable accurate model predictions of site performance and to provide the basis for proper design and planning of site-disposal operations
Directory of Open Access Journals (Sweden)
Haggai Cohen-Klonymus
2016-10-01
Full Text Available The very Late Chalcolithic sites of the Fazael Valley exhibit changes in settlement patterns and material culture. This paper presents the analysis of the ground stone tool assemblages of these sites, and includes the combination of attribute analysis, functional typology, and spatial and contextual analyses, allowing comparisons both between the different sites and between different phases within the sites. The assemblages of the late sites of Fazael 2 and Fazael 7 show similar use of raw materials and tool design, which is clearly different from the assemblage of the earlier typical Ghassulian Chalcolithic site of Fazael 1. In Fazael 2, two phases revealed a shift from the use of large grinding tools to mortars and small grinding tools. In both the earlier and the later phases, the separation of activity areas within the site is clear. Grinding activity in both phases is restricted to the western side of the site, while mortars and spindle whorls were found only in the south-eastern part. Finally, a comparison with Fazael 1, as well as with other Late Chalcolithic sites, such as Gilat, 'Ein Hilu and 'En Esur, show that the large number of mortars found in Fazael 2 and Fazael 7 is unique, and may hint at a shift to different subsistence strategies appearing in this region in the latest phases of the Chalcolithic period.
Thomsen, Nanna I.; Binning, Philip J.; McKnight, Ursula S.; Tuxen, Nina; Bjerg, Poul L.; Troldborg, Mads
2016-05-01
A key component in risk assessment of contaminated sites is in the formulation of a conceptual site model (CSM). A CSM is a simplified representation of reality and forms the basis for the mathematical modeling of contaminant fate and transport at the site. The CSM should therefore identify the most important site-specific features and processes that may affect the contaminant transport behavior at the site. However, the development of a CSM will always be associated with uncertainties due to limited data and lack of understanding of the site conditions. CSM uncertainty is often found to be a major source of model error and it should therefore be accounted for when evaluating uncertainties in risk assessments. We present a Bayesian belief network (BBN) approach for constructing CSMs and assessing their uncertainty at contaminated sites. BBNs are graphical probabilistic models that are effective for integrating quantitative and qualitative information, and thus can strengthen decisions when empirical data are lacking. The proposed BBN approach facilitates a systematic construction of multiple CSMs, and then determines the belief in each CSM using a variety of data types and/or expert opinion at different knowledge levels. The developed BBNs combine data from desktop studies and initial site investigations with expert opinion to assess which of the CSMs are more likely to reflect the actual site conditions. The method is demonstrated on a Danish field site, contaminated with chlorinated ethenes. Four different CSMs are developed by combining two contaminant source zone interpretations (presence or absence of a separate phase contamination) and two geological interpretations (fractured or unfractured clay till). The beliefs in each of the CSMs are assessed sequentially based on data from three investigation stages (a screening investigation, a more detailed investigation, and an expert consultation) to demonstrate that the belief can be updated as more information
International Nuclear Information System (INIS)
Hodges, F.N.
1998-01-01
Pacific Northwest National Laboratory (PNNL) conducted a Phase I, Resource Conservation and Recovery Act of 1976 (RCRA) groundwater quality assessment for the Richland Field Office of the U.S. Department of Energy (DOE-RL) under the requirements of the Federal Facility Compliance Agreement. The purpose of the investigation was to determine if the Single-Shell Tank Waste Management Areas (WMAs) T and TX-TY have impacted groundwater quality. Waste Management Areas T and TX-TY, located in the northern part of the 200 West Area of the Hanford Site, contain the 241-T, 241-TX, and 241-TY tank farms and ancillary waste systems. These two units are regulated under RCRA interim-status regulations (under 40 CFR 265.93) and were placed in assessment groundwater monitoring because of elevated specific conductance in downgradient wells. Anomalous concentrations of technetium-99, chromium, nitrate, iodine-129, and cobalt-60 also were observed in some downgradient wells. Phase I assessment, allowed under 40 CFR 265, provides the owner-operator of a facility with the opportunity to show that the observed contamination has a source other than the regulated unit. For this Phase I assessment, PNNL evaluated available information on groundwater chemistry and past waste management practices in the vicinity of WMAs T and TX-TY. Background contaminant concentrations in the vicinity of WMAs T and TX-TY are the result of several overlapping contaminant plumes resulting from past-practice waste disposal operations. This background has been used as baseline for determining potential WMA impacts on groundwater
Environmental Survey preliminary report, Nevada Test Site, Mercury, Nevada
International Nuclear Information System (INIS)
1988-04-01
This report presents the preliminary findings from the first phase of the Environmental Survey of the United States Department of Energy (DOE) Nevada Test Site (NTS), conducted June 22 through July 10, 1987. The Survey is being conducted by a multidisciplinary team of environmental specialists led and managed by the Office of Environment, Safety and Health's Office of Environmental Audit. Individual team members are outside experts being supplied by a private contractor. The objective of the Survey is to identify environmental problems and areas of environmental risk associated with the NTS. The Survey covers all environment media and all areas of environmental regulation. It is being performed in accordance with the DOE Environmental Survey Manual. This phase of the Survey involves the review of existing site environmental data, observations of the operations and activities performed at the NTS, and interviews with site personnel. The Survey team developed a Sampling and Analysis Plan to assist in further assessing certain environmental problems identified during its on-site activities. The Sampling and Analysis Plan is being executed by the Battelle Columbus Division under contract with DOE. When completed, the results will be incorporated into the NTS Environmental Survey Interim Report. The Interim Report will reflect the final determinations of the NTS Survey. 165 refs., 42 figs., 52 tabs
DEFF Research Database (Denmark)
Bertelsen, Birgitte; Melchior, Linea; Jensen, Lars Riff
2015-01-01
Gilles de la Tourette syndrome (GTS) is a neuropsychiatric disorder with a strong genetic etiology; however, finding of candidate genes is hampered by its genetic heterogeneity and the influence of non-genetic factors on disease pathogenesis. We report a case of a male patient with GTS, obsessive...... compulsive disorder, attention-deficit/hyperactivity-disorder, as well as other comorbidities, and a translocation t(3;9)(q25.1;q34.3) inherited from a mother with tics. Mate-pair sequencing revealed that the translocation breakpoints truncated the olfactomedin 1 (OLFM1) gene and two uncharacterized...
2016-11-09
Total Number: Sub Contractors (DD882) Names of Personnel receiving masters degrees Names of personnel receiving PHDs Names of other research staff...Broadcom 5720 QP 1Gb Network Daughter Card (2) Intel Xeon E5-2680 v3 2.5GHz, 30M Cache, 9.60GT/s QPI, Turbo, HT , 12C/24T (120W...Broadcom 5720 QP 1Gb Network Daughter Card (2) Intel Xeon E5-2680 v3 2.5GHz, 30M Cache, 9.60GT/s QPI, Turbo, HT , 12C/24T (120W
BOA: Asbestos pipe insulation removal robot system. Phase 1
Energy Technology Data Exchange (ETDEWEB)
Schempf, H.; Bares, J.E.
1995-02-01
The project described in this report targets the development of a mechanized system for safe, cost-efficient and automated abatement of asbestos containing materials used as pipe insulation. Based on several key design criteria and site visits, a proof-of-concept prototype robot system, dubbed BOA, was designed and built, which automatically strips the lagging and insulation from the pipes, and encapsulates them under complete vacuum operation. The system can operate on straight runs of piping in horizontal or vertical orientations. Currently we are limited to four-inch diameter piping without obstacles as well as a somewhat laborious emplacement and removal procedure -- restrictions to be alleviated through continued development. BOA removed asbestos at a rate of 4-5 ft./h compared to 3 ft./h for manual removal of asbestos with a 3-person crew. The containment and vacuum system on BOA was able to achieve the regulatory requirement for airborne fiber emissions of 0.01 fibers/ccm/ 8-hr. shift. This program consists of two phases. The first phase was completed and a demonstration was given to a review panel, consisting of DOE headquarters and site representatives as well as commercial abatement industry representatives. Based on the technical and programmatic recommendations drafted, presented and discussed during the review meeting, a new plan for the Phase II effort of this project was developed. Phase 11 will consist of a 26-month effort, with an up-front 4-month site-, market-, cost/benefit and regulatory study before the next BOA robot (14 months) is built, and then deployed and demonstrated (3 months) at a DOE site (such as Fernald or Oak Ridge) by the beginning of FY`97.
On-site and off-site forensic analysis capabilities for proliferation and terrorism prevention
International Nuclear Information System (INIS)
Whipple, R.E.; Nunes, P.J.; Reynolds, J.G.; Alcaraz, A.; Hart, B.R.
2004-01-01
Full text: We will present current on-site technologies that can be utilized for the screening of explosives, chemical agents, and environmental contaminants. These techniques must have the capability to detect various hazardous materials at very low levels, since they pose a major challenge for first responders. Specifically, the technology must detect concealed explosives or chemical agents on-site rapidly. Lawrence Livermore National Laboratory (LLNL) is currently developing several different high explosive screening and detection technologies for field use. Two technologies that have demonstrated an ability to screen for explosives at low levels are colorimetric spot tests and thin layer chromatography (TLC). Another technology that has demonstrated usefulness for the on-site analysis of unknowns is portable gas chromatography-mass spectrometry (GC-MS) with solid phase micro-extraction (SPME) sampling. Several examples utilizing these technologies and their usefulness will be presented. In addition to developing on-site screening methods, LLNL is an Organization for the Prohibition of Chemical Weapons (OPCW) designated laboratory and is certified to accept CW suspect samples. Currently, LLNL is expanding its ISO-17025 certification to include nuclear forensics and explosives. These off-site forensic analysis capabilities and certified procedures will support the needs for homeland security. We will highlight some of the ISO-17025 requirements to accredit procedures, handle samples, and reports. Work performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under contract W-7405-ENG-48
On-site and off-site forensic analysis capabilities for proliferation and terrorism prevention
International Nuclear Information System (INIS)
Hart, B.R.; Whipple, R.E.; Nunes, P.J.; Reynolds, J.G.; Alcaraz, A.
2004-01-01
We present current on-site technologies that can be utilized for the screening of explosives, chemical agents, and environmental contaminants. These techniques must have the capability to detect various hazardous materials at very low levels, since they pose a major challenge for first responders. Specifically, the technology must detect concealed explosives or chemical agents on-site rapidly. Lawrence Livermore National Laboratory (LLNL) is currently developing several different high explosive screening and detection technologies for field use. Two technologies that have demonstrated an ability to screen for explosives at low levels are colorimetric spot tests and thin layer chromatography (TLC). Another technology that has demonstrated usefulness for the on-site analysis of unknowns is portable gas chromatography-mass spectrometry (GC-MS) with solid phase micro-extraction (SPME) sampling. Several examples utilizing these technologies and their usefulness will be presented. In addition to developing on-site screening methods, LLNL is an Organization for the Prohibition of Chemical Weapons (OPCW) designated laboratory and is certified to accept CW suspect samples. Currently, LLNL is expanding its ISO-17025 certification to include nuclear forensics and explosives. These off-site forensic analysis capabilities and certified procedures will support the needs for homeland security. We will highlight some of the ISO-17025 requirements to accredit procedures, handle samples, and reports. Work performed under the auspices of the U.S. Department of Energy by Lawrence Livermore National Laboratory under contract W-7405-ENG-48. (author)
Stover, Michele L; Jackson, Virgil E; Matus, Myrna H; Adams, Margaret A; Cassady, Carolyn J; Dixon, David A
2012-03-08
The gas-phase acidities of the 20 L-amino acids have been predicted at the composite G3(MP2) level. A broad range of structures of the neutral and anion were studied to determine the lowest energy conformer. Excellent agreement is found with the available experimental gas-phase deprotonation enthalpies, and the calculated values are within experimental error. We predict that tyrosine is deprotonated at the CO(2)H site. Cysteine is predicted to be deprotonated at the SH but the proton on the CO(2)H is shared with the S(-) site. Self-consistent reaction field (SCRF) calculations with the COSMO parametrization were used to predict the pK(a)'s of the non-zwitterion form in aqueous solution. The differences in the non-zwitterion pK(a) values were used to estimate the free energy difference between the zwitterion and nonzwitterion forms in solution. The heats of formation of the neutral compounds were calculated from atomization energies and isodesmic reactions to provide the first reliable set of these values in the gas phase. Further calculations were performed on five rare amino acids to predict their heats of formation, acidities, and pK(a) values.
Project Rio Blanco: site restoration. Final report
International Nuclear Information System (INIS)
1978-01-01
Project Rio Blanco was a joint Government-industry experiment using nuclear explosives to stimulate the flow of natural gas from low permeability formations which could not be economically produced through conventional methods. The project consisted of the simultaneous detonation of three nuclear explosives on May 17, 1973, in a 7,000 foot well in northwestern Colorado. Gas production testing and project evaluation continued through June 1976. The site cleanup and restoration planning phase began in December 1975 and was concluded with the issuance of an operational plan, Project Rio Blanco Site Cleanup and Restoration Plan, NVO-173, in May 1976. Actual site restoration activities were conducted during the period from July to November 1976. The activities throughout the restoration period are summarized and the final site status, including the disposition of all project facilities and the status of all project related wells after plug and abandonment and recompletion work are described
Gritti, Fabrice; Guiochon, Georges
2009-03-06
The overloaded band profiles of five acido-basic compounds were measured, using weakly buffered mobile phases. Low buffer concentrations were selected to provide a better understanding of the band profiles recorded in LC/MS analyses, which are often carried out at low buffer concentrations. In this work, 10 microL samples of a 50 mM probe solution were injected into C(18)-bonded columns using a series of five buffered mobile phases at (SW)pH between 2 and 12. The retention times and the shapes of the bands were analyzed based on thermodynamic arguments. A new adsorption model that takes into account the simultaneous adsorption of the acidic and the basic species onto the endcapped adsorbent, predicts accurately the complex experimental profiles recorded. The adsorption mechanism of acido-basic compounds onto RPLC phases seems to be consistent with the following microscopic model. No matter whether the acid or the base is the neutral or the basic species, the neutral species adsorbs onto a large number of weak adsorption sites (their saturation capacity is several tens g/L and their equilibrium constant of the order of 0.1 L/g). In contrast, the ionic species adsorbs strongly onto fewer active sites (their saturation capacity is about 1g/L and their equilibrium constant of the order of a few L/g). From a microscopic point of view and in agreement with the adsorption isotherm of the compound measured by frontal analysis (FA) and with the results of Monte-Carlo calculations performed by Schure et al., the first type of adsorption sites are most likely located in between C(18)-bonded chains and the second type of adsorption sites are located deeper in contact with the silica surface. The injected concentration (50 mM) was too low to probe the weakest adsorption sites (saturation capacity of a few hundreds g/L with an equilibrium constant of one hundredth of L/g) that are located at the very interface between the C(18)-bonded layer and the bulk phase.
Organization and duties of the site supervisory staff
International Nuclear Information System (INIS)
Macqueron, J.F.
1976-01-01
There are two distinct phases in building a nuclear power station: The first involves the choice of the site, and the second is building the power station on the site chosen. The decision as to the site requires a long series of studies undertaken by the electricity-producing authority in France (Electricite de France) in close liaison with the government and the public, its elected representatives and municipalities. The building of a power station takes place according to the following procedure: The general, installation and operational studies and the accident-simulation studies are carried out by the planning departments of the Regional Equipment Organizations; the works department of the Regional Equipment Organizations controls and follows up the manufacture of equipment in the factory; coordination of on-site erection, trials on site and start-up of the installations are carried out by the development section of the works department. (orig./HP) [de
Sample exchange/evaluation (SEE) report - Phase III
International Nuclear Information System (INIS)
Winters, W.I.
1996-01-01
This report describes the results from Phase III of the Sample Exchange Evaluation (SEE) program. The SEE program is used to compare analytical laboratory performance on samples from the Hanford Site's high level waste tanks
Saleeon, Thanusin; Siriwong, Wattasit; Maldonado-Pérez, Héctor Luis; Robson, Mark Gregory
2016-01-01
Dry Thai traditional tobacco (Nicotiana Tabacum L.) production involves a unique process: (a) picking tobacco leaves, (b) curing tobacco leaves, (c) removing stems of tobacco leaves, cutting leaves and putting on a bamboo rack, (d) drying in the sun, reversing a rack, spraying a tobacco extract to adjust the tobacco's color, storing dried tobacco and packaging. These processes may lead to adverse health effects caused by dermal absorption of nicotine such as Green Tobacco Sickness (GTS). The aim of this study was to determine the correlation between GTS resulting from dry Thai traditional tobacco production and salivary cotinine levels among Thai traditional tobacco farmers in Nan Province, Thailand. A prospective cohort study was conducted with 20 tobacco farmers and 20 non-tobacco farmers in Praputtabath Sub-District and Phatow Sub-District. The participants were randomly selected and interviewed using in person questionnaires with bi-weekly follow-up for 14 weeks. During each contact, the cotinine concentration was measured by NicAlert(TM) Saliva strip tests (NCTS). Descriptive statistics and Spearman's correlation (Spearman's rho) was used to examine the relationship between the variables at both 0.01 and 0.05 significant probability levels. This study indicated that GTS from dry tobacco production has the potential to be considered a common occupational disease. This study demonstrated the usefulness of salivary cotinine level measurements by NCTS. The levels were well correlated with farmers who were employed in the dry Thai tobacco production industry. Salivary cotinine levels were also significantly correlated with the prevalence of GTS in the group of tobacco farmers at any given time within a crop season. However, the production process of dry Thai traditional tobacco is different from that evaluated in our previous studies where GTS and salivary cotinine level were correlated in workers working in humid conditions. The long-term effects of such exposure
Urban Integrated Industrial Cogeneration Systems Analysis. Phase II final report
Energy Technology Data Exchange (ETDEWEB)
1984-01-01
Through the Urban Integrated Industrial Cogeneration Systems Analysis (UIICSA), the City of Chicago embarked upon an ambitious effort to identify the measure the overall industrial cogeneration market in the city and to evaluate in detail the most promising market opportunities. This report discusses the background of the work completed during Phase II of the UIICSA and presents the results of economic feasibility studies conducted for three potential cogeneration sites in Chicago. Phase II focused on the feasibility of cogeneration at the three most promising sites: the Stockyards and Calumet industrial areas, and the Ford City commercial/industrial complex. Each feasibility case study considered the energy load requirements of the existing facilities at the site and the potential for attracting and serving new growth in the area. Alternative fuels and technologies, and ownership and financing options were also incorporated into the case studies. Finally, site specific considerations such as development incentives, zoning and building code restrictions and environmental requirements were investigated.
Site selection for nuclear power plants and geologic seismologia influence
International Nuclear Information System (INIS)
Castro Feitosa, G. de.
1985-01-01
The site selection for nuclear power plants is analised concerning to the process, methodology and the phases in an overall project efforts. The factors affecting are analised on a general viewpoint, showing the considerations given to every one. The geologic and seismologic factors influence on the foundation design are more detailed analised, with required investigation and procedures accordingly sub-soil conditions in the site [pt
Description of surface systems. Preliminary site description. Forsmark area Version 1.2
Energy Technology Data Exchange (ETDEWEB)
Lindborg, Tobias [ed.
2005-06-01
Swedish Nuclear Fuel and Waste Management Co (SKB) started site investigations for a deep repository for spent nuclear fuel in 2002 at two different sites in Sweden, Forsmark and Oskarshamn. The investigations should provide necessary information for a license application aimed at starting underground exploration. For this reason, ecosystem data need to be interpreted and assessed into site descriptive models, which in turn are used for safety assessment studies and for environmental impact assessment. Descriptions of the surface system are also needed for further planning of the site investigations. This report describes the surface ecosystems of the Forsmark site (e.g. hydrology, Quaternary deposits, chemistry, vegetation, animals and the human land use). The ecosystem description is an integration of the site and its regional setting, covering the current state of the biosphere as well as the ongoing natural processes affecting the longterm development. Improving the descriptions is important during both the initial and the complete site investigation phase. Before starting of the initial phase in Forsmark, version 0 of the site descriptive model was developed. The results of the initial site investigation phase is compiled into a preliminary site description of Forsmark (version 1.2) in June 2005. This report provides the major input and background to the biosphere description, in the 1.2 version of the Forsmark site description. The basis for this interim version is quality-assured field data from the Forsmark sub area and regional area, available in the SKB SICADA, and GIS data bases as of July 31th 2004 as well as version 1.1 of the Site Descriptive Model. To achieve an ecosystem site description there is a need to develop discipline-specific models by interpreting and analysing primary data. The different discipline-specific models are then integrated into a system describing interactions and flows and stocks of matter between and within functional units in
Description of surface systems. Preliminary site description. Forsmark area Version 1.2
International Nuclear Information System (INIS)
Lindborg, Tobias
2005-06-01
Swedish Nuclear Fuel and Waste Management Co (SKB) started site investigations for a deep repository for spent nuclear fuel in 2002 at two different sites in Sweden, Forsmark and Oskarshamn. The investigations should provide necessary information for a license application aimed at starting underground exploration. For this reason, ecosystem data need to be interpreted and assessed into site descriptive models, which in turn are used for safety assessment studies and for environmental impact assessment. Descriptions of the surface system are also needed for further planning of the site investigations. This report describes the surface ecosystems of the Forsmark site (e.g. hydrology, Quaternary deposits, chemistry, vegetation, animals and the human land use). The ecosystem description is an integration of the site and its regional setting, covering the current state of the biosphere as well as the ongoing natural processes affecting the longterm development. Improving the descriptions is important during both the initial and the complete site investigation phase. Before starting of the initial phase in Forsmark, version 0 of the site descriptive model was developed. The results of the initial site investigation phase is compiled into a preliminary site description of Forsmark (version 1.2) in June 2005. This report provides the major input and background to the biosphere description, in the 1.2 version of the Forsmark site description. The basis for this interim version is quality-assured field data from the Forsmark sub area and regional area, available in the SKB SICADA, and GIS data bases as of July 31th 2004 as well as version 1.1 of the Site Descriptive Model. To achieve an ecosystem site description there is a need to develop discipline-specific models by interpreting and analysing primary data. The different discipline-specific models are then integrated into a system describing interactions and flows and stocks of matter between and within functional units in
Tanks focus area site needs assessment FY 1997
International Nuclear Information System (INIS)
1997-04-01
The Tanks Focus Area's (TFA's) mission is to manage an integrated technology development program that results in the application of technology to safely and efficiently accomplish tank waste remediation across the U.S. Department of Energy (DOE) complex. The TFA uses a systematic process for developing its annual program that draws from the tanks technology development needs expressed by four DOE tank waste sites - Hanford Site, Idaho National Engineering and Environmental Laboratory (INEEL), Oak Ridge Reservation (ORR), and Savannah River Site (SRS). The process is iterative and involves six steps: (1) Site needs identification and documentation, (2) Site communication of priority needs, (3) Technical response development, (4) Review technical responses, (5) Develop program planning documents, and (6) Review planning documents. This document describes the outcomes of the first two steps: site needs identification and documentation, and site communication of priority needs. It also describes the initial phases of the third and fourth steps: technical response development and review technical responses. Each site's Site Technology Coordination Group (STCG) was responsible for developing and delivering priority tank waste needs. This was accomplished using a standardized needs template developed by the National STCG. The standard template helped improve the needs submission process this year. The TFA received the site needs during December 1996 and January 1997
Historical genesis of Hanford Site wastes
International Nuclear Information System (INIS)
Gerber, M.S.
1991-01-01
This paper acquaints the audience with historical waste practices and policies as they changed over the years at the Hanford Site, and with the generation of the major waste streams of concern in Hanford Site clean-up today. The paper also describes the founding and basic operating history of the Hanford Site, including World War 11 construction and operations, three major postwar expansions (1947-55), the peak years of production (1956-63), production phase downs (1964-the present), and some past suggestions and efforts to chemically treat, open-quotes fractionate,close quotes and/or immobilize Hanford's wastes. Recent events, including the designation of the Hanford Site as the open-quotes flagshipclose quotes of Department of Energy (DOE) waste remediation efforts and the signing of the landmark Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement), have generated new interest in Hanford's history. Clean-up milestones dictated in this agreement demand information about how, when, in what quantities and mixtures, and under what conditions, Hanford Site wastes were generated and released. This paper presents original, primary-source research into the waste history of the Hanford Site. The earliest, 1940s knowledge base, assumptions and calculations about radioactive and chemical discharges, as discussed in the memos, correspondence and reports of the original Hanford Site (then Hanford Engineer Works) builders and operators, are reviewed. The growth of knowledge, research efforts, and subsequent changes in Site waste disposal policies and practices are traced. Finally, the paper places the current Hanford Site waste remediation endeavors in the broad context of American and world history
Anaerobic bacterial quantitation of Yucca Mountain, Nevada DOE site samples
International Nuclear Information System (INIS)
Clarkson, W.W.; Krumholz, L.R.; Suflita, J.M.
1996-01-01
Anaerobic bacteria were studied from samples of excavated rock material as one phase of the overall Yucca Mountain site characterization effort. An indication of the abundance of important groups of anaerobic bacteria would enable inferences to be made regarding the natural history of the site and allow for more complete risk evaluation of the site as a nuclear repository. Six bacterial groups were investigated including anaerobic heterotrophs, acetogens, methanogens, sulfate-, nitrate-, and iron-reducing bacteria. The purpose of this portion of the study was to detect and quantify the aforementioned bacterial groups
Energy Technology Data Exchange (ETDEWEB)
Brower, M.C. [Brower & Company, Andover, MA (United States); Hurley, P. [RLA Consulting, Bothell, WA (United States); Simon, R. [Consulting Meteorologist, Mill Valley, CA (United States)
1996-12-31
This paper describes the methodology and results of a wide-area wind resource assessment and site selection in Colorado. This was the first phase in a three-part assessment and monitoring program conducted for the State of Colorado Office of Energy Conservation and several collaborating utilities. The objective of this phase was to identify up to 20 candidate sites for evaluation and possible long-term monitoring. This was accomplished using a geographic information system (GIS), which takes into account such factors as topography, existing wind resource data, locations of transmission lines, land cover, and land use. The resulting list of sites recommended for evaluation in Phase 2 of the study includes locations throughout Colorado, but most are in the eastern plains. The GIS wind siting model may be modified and updated in the future as additional information becomes available. 3 figs., 1 tab.
Selection criteria for a radioactive waste disposal site in the Republic of South Africa
International Nuclear Information System (INIS)
Toens, P.D.; Hambleton-Jones, B.B.
1986-01-01
A program commenced in 1978 to select a suitable site for the disposal of nuclear waste in South Africa. This entailed the examination of a variety of socio-economic and earthscience related parameters over large parts of South Africa. The site selection program, for which the Geology Department of the Atomic Energy Corporation of South Africa Ltd (AEC) (previously the Nuclear Development Corporation (NUCOR)) accepted responsibility, commenced with an initial screening phase and led to the identification of potentially suitable areas by mid 1980. A site suitability phase involving regional, and subsequently detailed socio-economic, geological, geohydrological and geophysical studies in the areas identified by the screening phase was completed in December 1982. As a result of very positive indications that the district of Namaqualand was the most suitable candidate area it was possible, after further detailed investigations, to identify and purchase a site judged to be suitable for the disposal of low- and intermediate-level waste by February 1983. The area acquired measures some 10 000ha in extent and is situated 100km southeast of Springbok in the northwestern Cape and 600km north of the Koeberg nuclear power station near Cape Town
International Nuclear Information System (INIS)
1977-12-01
Results are reported from an engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings at the Lakeview, Oregon site. Results are included from the analyses of soil, water, and other samples; radiometric measurements to determine areas with radium-contaminated materials; evaluation of resulting radiation exposures of individuals and nearby populations; investigation of site geology, hydrology, and meteorology; and evaluation and costing of alternative corrective actions. Radon gas release from the 130,000 tons of tailings at the Lakeview site constitutes the main environmental impact, which is minimal. The two alternative actions presented are maintenance of the site now that the ARCO reclamation program has been completed (Option I); and addition of stabilization cover to a minimum depth of 2 ft, improved fencing, and removal of a few isolated spots of contamination (Option II). The cost estimates for these options are $40,000 and $290,000, respectively
Unit soil loss rate from various construction sites during a storm.
Maniquiz, Marla C; Lee, Soyoung; Lee, Eunju; Kong, Dong-Soo; Kim, Lee-Hyung
2009-01-01
The Korean Ministry of Environment (MOE) opts to establish an ordinance having a standard specifying an allowable soil loss rate applicable to construction projects. The predicted amount of soil loss from a construction site exceeding the standard can be used to calculate the percent reduction necessary to comply with the ordinance. This research was conducted to provide a basis to establish a standard by investigating the unit soil loss rates in the three phases of development: pre-construction, active construction and post construction based from 1,036 Environmental Impact Assessment (EIA) reports within the six-year period (2000-2005). Based on the findings, several factors affect the magnitude of soil loss rates particularly storm characteristics, site slope, soil type, location from rivers, as well as the type of construction activity. In general, the unit soil loss rates during the active construction phase are extremely higher in comparison to undisturbed areas; in magnitude of 7 to 80 times larger in urban areas and 18 to 585 times in rural areas. Only between 20 to 40 percent of the soil loss rates was contributed at pre- and post- construction phases indicating that the active construction phase is the most important phase to control.
Kundu, Ashis; Ghosh, Subhradip
2017-11-14
A delicate balance between various factors such as site occupancy, composition and magnetic ordering seems to affect the stability of the martensitic phase in Mn2Ni1+xSn1-x. Using first-principles DFT calculations, we explore the impacts of each one of these factors on the martensitic stability of this system. Our results on total energies, magnetic moments and electronic structures upon changes in the composition, the magnetic configurations and the site occupancies show that the occupancies at the 4d sites in the Inverse Heusler crystal structure play the most crucial role. The presence of Mn at the 4d sites originally occupied by Sn and its interaction with the Mn atoms at other sites decide the stability of the martensitic phases. This explains the discrepancy between the experiments and earlier DFT calculations regarding phase stability in Mn2NiSn. Our results qualitatively explain the trends observed experimentally with regard to martensitic phase stability and the magnetisations in Ni-excess, Sn-deficient Mn2NiSn system. © 2017 IOP Publishing Ltd.
Directory of Open Access Journals (Sweden)
Adeline eDerouaux
2013-03-01
Full Text Available Peptidoglycan (PG is an essential net-like macromolecule that surrounds bacteria, gives them their shape, and protects them against their own high osmotic pressure. PG synthesis inhibition leads to bacterial cell lysis, making it an important target for many antibiotics. The final two reactions in PG synthesis are performed by penicillin-binding proteins (PBPs. Their glycosyltransferase (GT activity uses the lipid II precursor to synthesize glycan chains and their transpeptidase (TP activity catalyzes the cross-linking of two glycan chains via the peptide side chains. Inhibition of either of these two reactions leads to bacterial cell death. β-Lactam antibiotics target the transpeptidation reaction while antibiotic therapy based on inhibition of the GTs remains to be developed. Ongoing research is trying to fill this gap by studying the interactions of GTs with inhibitors and substrate mimics and utilizing the latter as templates for the design of new antibiotics. In this mini review we present an updated overview on the GTs and describe the structure-activity relationship of recently developed synthetic ligands.
Linkage studies on Gilles de la Tourette syndrome: What is the strategy of choice?
Energy Technology Data Exchange (ETDEWEB)
Heutink, P.; Wetering, J.M. van de; Oostra, B.A. [Erasmus Univ. Rotterdam (Netherlands)] [and others
1995-08-01
For a linkage study it is important to ascertain family material that is sufficiently informative. The statistical power of linkage sample can be determined via computer simulation. For complex traits uncertain parameters such as incomplete penetrance, frequency of phenocopies, gene frequency and variable expression have to be taken into account. One can either include only the most severe phenotype in the analysis or apply multiple linkage tests for a gradually broadened disease phenotype. Gilles de la Tourette syndrome (GTS) is a chronic neurological disorder characterized by multiple, intermittent motor and vocal tics. Segregation analyses suggests that GTS and milder phenotypes are caused by a single dominant gene. We report here the results of an extensive simulation study on a large set of families. We compared the effectiveness of linkage tests with only the GTS phenotype versus multiple tests that included various milder phenotypes and different gene frequencies. The scenario of multiple tests yielded superior power. Our results show that computer simulation can indicate the strategy of choice in linkage studies of multiple, complex phenotypes. 33 refs., 2 figs., 3 tabs.
Olson, Robert; Karam, Irene; Wilson, Gavin; Bowman, Angela; Lee, Christopher; Wong, Frances
2013-12-01
The purpose of this study is to compare patient outcomes between a therapeutic versus a prophylactic gastrostomy tube (GT) placement approach in patients treated with concurrent systemic and radiation (SRT) therapy for head and neck cancer (HNC). Outcomes were compared between all HNC patients treated with concurrent SRT from January 2001 to June 2009 from a center that only places GTs therapeutically when clinically necessary (center A) versus a center that generally places them prophylactically (center B). A total of 445 patients with HNC were identified, with 63 % from center A. As anticipated, GTs were placed less commonly in center A compared to B (31 versus 88 %; p approach results in exposing higher number of patients to GT complications. The higher rate of hospitalizations using a therapeutic approach suggests that patients are sicker when GTs are required. Given the similar weight loss and survival, a therapeutic approach at an earlier stage of need may be a preferable approach, when access to prompt GT placement is available.
Usefulness of tomographic phase image in ventricular conduction abnormalities
International Nuclear Information System (INIS)
Sakurai, Mitsuru; Watanabe, Yoshihiko; Kondo, Takeshi
1985-01-01
In order to evaluate three-dimensional phase changes in ventricular conduction abnormalities, tomographic phase images were constructed in 7 normal subjects, 12 patients with ventricular pacing, 21 patients with bundle branch block and 12 patients with Wolff-Parkinson-White syndrome. Eight to 12 slices of the short-axis ventricular tomographic phase image (TPI) were derived using a 7-pinhole collimator, and compared with planar phase images (PPIs) in left anterior oblique (LAO) and right anterior oblique (RAO) projections. TPIs were excellent for observing biventricular phase changes in the long-axis direction. In 6 cases of complete right bundle branch block with left axis deviation (beyond -30 0 ), the phase delay in the left ventricular anterior wall was recognized in 5 cases by TPI, although it was difficult to be detected by PPIs. The site of the pacing electrode was identified by TPI in 11 out of 12 cases, compared to 8 cases by PPIs in LAO and RAO projections. The site of the accessory pathway in Wolff-Parkinson-White syndrome was detected in the basal slice of TPIs in 10 out of 12 cases, compared to 8 cases by PPI in the LAO projection. Therefore, it is obvious that TPIs offer more valid information than PPIs. In conclusion, TPI is useful for investigation of ventricular conduction abnormalities. (author)
Nevada Test Site Site Treatment Plan. Revision 2
International Nuclear Information System (INIS)
1996-03-01
Treatment Plans (STPS) are required for facilities at which the US Department of Energy (DOE) or stores mixed waste, defined by the Federal Facility Compliance Act (FFCAct) as waste containing both a hazardous waste subject to the Resource Conservation and Recovery Act and a radioactive material subject to the Atomic Energy Act. On April 6, 1993, DOE published a Federal Register notice (58 FR 17875) describing its proposed process for developing the STPs in three phases including a Conceptual, a Draft, and a Proposed Site Treatment Plan (PSTP). All of the DOE Nevada Operations Office STP iterations have been developed with the state of Nevada's input. The options and schedules reflect a ''bottoms-up'' approach and have been evaluated for impacts on other DOE sites, as well as impacts to the overall DOE program. Changes may have occurred in the preferred option and associated schedules between the PSTP, which was submitted to the state of Nevada and US Environmental Protection Agency April 1995, and the Final STP (hereafter referred to as the STP) as treatment evaluations progressed. The STP includes changes that have occurred since the submittal of the PSTP as a result of state-to-state and DOE-to-state discussions
International Nuclear Information System (INIS)
Parazin, R.J.
1998-01-01
This document describes the functional and physical interfaces between the Tank Waste Remediation System (TWRS) Privatization Phase 1 Infrastructure Project W-519 and the various other projects (i.e., Projects W-314, W-464, W-465, and W-520) supporting Phase 1 that will require the allocation of land in and about the Privatization Phase 1 Site and/or interface with the utilities extended by Project W-519. Project W-519 will identify land use allocations and upgrade/extend several utilities in the 200-East Area into the Privatization Phase 1 Site (formerly the Grout Disposal Compound) in preparation for the Privatization Contractors (PC) to construct treatment facilities. The project will upgrade/extend: Roads, Electrical Power, Raw Water (for process and fire suppression), Potable Water, and Liquid Effluent collection. The replacement of an existing Sanitary Sewage treatment system that may be displaced by Phase 1 site preparation activities may also be included
Contributions to reversed-phase column selectivity: III. Column hydrogen-bond basicity.
Carr, P W; Dolan, J W; Dorsey, J G; Snyder, L R; Kirkland, J J
2015-05-22
Column selectivity in reversed-phase chromatography (RPC) can be described in terms of the hydrophobic-subtraction model, which recognizes five solute-column interactions that together determine solute retention and column selectivity: hydrophobic, steric, hydrogen bonding of an acceptor solute (i.e., a hydrogen-bond base) by a stationary-phase donor group (i.e., a silanol), hydrogen bonding of a donor solute (e.g., a carboxylic acid) by a stationary-phase acceptor group, and ionic. Of these five interactions, hydrogen bonding between donor solutes (acids) and stationary-phase acceptor groups is the least well understood; the present study aims at resolving this uncertainty, so far as possible. Previous work suggests that there are three distinct stationary-phase sites for hydrogen-bond interaction with carboxylic acids, which we will refer to as column basicity I, II, and III. All RPC columns exhibit a selective retention of carboxylic acids (column basicity I) in varying degree. This now appears to involve an interaction of the solute with a pair of vicinal silanols in the stationary phase. For some type-A columns, an additional basic site (column basicity II) is similar to that for column basicity I in primarily affecting the retention of carboxylic acids. The latter site appears to be associated with metal contamination of the silica. Finally, for embedded-polar-group (EPG) columns, the polar group can serve as a proton acceptor (column basicity III) for acids, phenols, and other donor solutes. Copyright © 2015 Elsevier B.V. All rights reserved.
Monitoring well design and sampling techniques at NAPL sites
International Nuclear Information System (INIS)
Collins, M.; Rohrman, W.R.; Drake, K.D.
1992-01-01
The existence of Non-Aqueous Phase Liquids (NAPLs) at many Superfund and RCRA hazardous waste sites has become a recognized problem in recent years. The large number of sites exhibiting this problem results from the fact that many of the most frequently used industrial solvents and petroleum products can exist as NAPLs. Hazardous waste constituents occurring as NAPLs possess a common characteristic that causes great concern during groundwater contamination evaluation: while solubility in water is generally very low, it is sufficient to cause groundwater to exceed Maximum Contamination Levels (MCLs). Thus, even a small quantity of NAPL within a groundwater regime can act as a point source with the ability to contaminate vast quantities of groundwater over time. This property makes it imperative that groundwater investigations focus heavily on characterizing the nature, extent, and migration pathways of NAPLs at sites where it exists. Two types of NAPLs may exist in a groundwater system. Water-immiscible liquid constituents having a specific gravity greater than one are termed Dense Non-Aqueous Phase Liquids, while those with a specific gravity less than one are considered Light Non-Aqueous Phase Liquids. For a groundwater investigation to properly characterize the two types of NAPLs, careful consideration must be given to the placement and sampling of groundwater monitoring wells. Unfortunately, technical reviewers at EPA Region VII and the Corps of Engineers find that many groundwater investigations fall short in characterizing NAPLs because several basic considerations were overlooked. Included among these are monitoring well location and screen placement with respect to the water table and significant confining units, and the ability of the well sampling method to obtain samples of NAPL. Depending on the specific gravity of the NAPL that occurs at a site, various considerations can substantially enhance adequate characterization of NAPL contaminants
Site-selection studies for final disposal of spent fuel in Finland
International Nuclear Information System (INIS)
Vuorela, P.; Aeikaes, T.
1984-02-01
In the management of waste by the Industrial Power Company Ltd. (TVO) preparations are being made for the final disposal of unprocessed spent fuel into the Finnish bedrock. The site selection program will advance in three phases. The final disposal site must be made at the latest by the end of the year 2000, in accordance with a decision laid down by the Finnish Government. In the first phase, 1983-85, the main object is to find homogeneous stable bedrock blocks surrounded by fracture zones located at a safe distance from the planned disposal area. The work usually starts with a regional structural analysis of mosaics of Landsat-1 winter and summer imagery. Next an assortment of different maps, which cover the whole country, is used. Technical methods for geological and hydrogeological site investigations are being developed during the very first phase of the studies, and a borehole 1000 meters deep will be made in southwestern Finland. Studies for the final disposal of spent fuel or high-level reprocessing waste have been made since 1974 in Finland. General suitability studies of the bedrock have been going on since 1977. The present results indicate that suitable investigation areas for the final disposal of highly active waste can be found in Finland
Environmental Survey preliminary report, Nevada Test Site, Mercury, Nevada
Energy Technology Data Exchange (ETDEWEB)
1988-04-01
This report presents the preliminary findings from the first phase of the Environmental Survey of the United States Department of Energy (DOE) Nevada Test Site (NTS), conducted June 22 through July 10, 1987. The Survey is being conducted by a multidisciplinary team of environmental specialists led and managed by the Office of Environment, Safety and Health's Office of Environmental Audit. Individual team members are outside experts being supplied by a private contractor. The objective of the Survey is to identify environmental problems and areas of environmental risk associated with the NTS. The Survey covers all environment media and all areas of environmental regulation. It is being performed in accordance with the DOE Environmental Survey Manual. This phase of the Survey involves the review of existing site environmental data, observations of the operations and activities performed at the NTS, and interviews with site personnel. The Survey team developed a Sampling and Analysis Plan to assist in further assessing certain environmental problems identified during its on-site activities. The Sampling and Analysis Plan is being executed by the Battelle Columbus Division under contract with DOE. When completed, the results will be incorporated into the NTS Environmental Survey Interim Report. The Interim Report will reflect the final determinations of the NTS Survey. 165 refs., 42 figs., 52 tabs.
Directory of Open Access Journals (Sweden)
João Donizete Denardi
2012-03-01
Full Text Available Connarus suberosus is a typical species of the Brazilian Cerrado biome, and its inflorescences and young vegetative branches are densely covered by dendritic trichomes. The objective of this study was to report the occurrence of a previously undescribed glandular trichome of this species. The localization, origin and structure of these trichomes were investigated under light, transmission and scanning electron microscopy. Collections were made throughout the year, from five adult specimens of Connarus suberosus near Botucatu, São Paulo, Brazil, including vegetative and reproductive apices, leaves and fruits in different developmental stages, as well as floral buds and flowers at anthesis. Glandular trichomes (GTs occurred on vegetative and reproductive organs during their juvenile stages. The GTs consisted of a uniseriate, multicellular peduncle, whose cells contain phenolic compounds, as well as a multicellular glandular portion that accumulates lipids. The glandular cell has thin wall, dense cytoplasm (with many mitochondria, plastids and dictyosomes, and a large nucleus with a visible nucleolus. The starch present in the plastids was hydrolyzed during the synthesis phase, reducing the density of the plastid stroma. Some plastids were fused to vacuoles, and some evidence suggested the conversion of plastids into vacuoles. During the final activity stages of the GTs, a darkening of the protoplasm was observed in some of the glandular cells, as a programmed cell death; afterwards, became caducous. The GTs in C. suberosus had a temporal restriction, being limited to the juvenile phase of the organs. Their presence on the exposed surfaces of developing organs and the chemical nature of the reserve products, suggest that these structures are food bodies. Field observations and detailed studies of plant-environment interactions, as well as chemical analysis of the reserve compounds, are still necessary to confirm the role of these GTs as feeding
Thermodynamic phase profiles of optically thin midlatitude cloud and their relation to temperature
Energy Technology Data Exchange (ETDEWEB)
Naud, C. M.; Del Genio, Anthony D.; Haeffelin, M.; Morille, Y.; Noel, V.; Dupont, Jean-Charles; Turner, David D.; Lo, Chaomei; Comstock, Jennifer M.
2010-06-03
Winter cloud phase and temperature profiles derived from ground-based lidar depolarization and radiosonde measurements are analyzed for two midlatitude locations: the United States Atmospheric Radiation Measurement Program Southern Great Plains (SGP) site and the Site Instrumental de Recherche par Télédétection Atmosphérique (SIRTA) in France. Because lidars are attenuated in optically thick clouds, the dataset only includes optically thin clouds (optical thickness < 3). At SGP, 57% of the clouds observed with the lidar in the temperature range 233-273 K are either completely liquid or completely glaciated, while at SIRTA only 42% of the observed clouds are single phase, based on a depolarization ratio threshold of 11% for differentiating liquid from ice. Most optically thin mixed phase clouds show an ice layer at cloud top, and clouds with liquid at cloud top are less frequent. The relationship between ice phase occurrence and temperature only slightly changes between cloud base and top. At both sites liquid is more prevalent at colder temperatures than has been found previously in aircraft flights through frontal clouds of greater optical thicknesses. Liquid in clouds persists to colder temperatures at SGP than SIRTA. This information on the average temperatures of mixed phase clouds at both locations complements earlier passive satellite remote sensing measurements that sample cloud phase near cloud top and for a wider range of cloud optical thicknesses.
Identification of sigma and chi phases in duplex stainless steels
Energy Technology Data Exchange (ETDEWEB)
Llorca-Isern, Núria, E-mail: nullorca@ub.edu [Departament de Ciència dels Materials i Enginyeria Metallurgica, Facultat de Química, Universitat de Barcelona, Marti-Franqués 1, 08028 Barcelona (Spain); López-Luque, Héctor, E-mail: hlopezlu7@alumnes.ub.edu [Departament de Ciència dels Materials i Enginyeria Metallurgica, Facultat de Química, Universitat de Barcelona, Marti-Franqués 1, 08028 Barcelona (Spain); López-Jiménez, Isabel, E-mail: ilopezji9@alumnes.ub.edu [Departament de Ciència dels Materials i Enginyeria Metallurgica, Facultat de Química, Universitat de Barcelona, Marti-Franqués 1, 08028 Barcelona (Spain); Biezma, Maria Victoria, E-mail: maria.biezma@unican.es [Department of Earth, Materials Science and Engineering, University of Cantabria - UC, Gamazo, 1, 39004 Santander (Spain)
2016-02-15
The aim of this work is to find out the most suitable method for detecting and analyzing accurately the formation conditions of secondary phases, particularly Sigma-phase (σ-phase) and Chi-phase (χ-phase) in duplex stainless steels (UNS S32205 and UNS S32750). The microstructure was characterized after a solution annealing at 1080 °C followed by an isothermal heating at 830 °C for different time ranges, ranging from 1 min to 9 h, in order to enlighten the controversial point concerning the mechanism of χ-phase nucleation in relation with the σ-phase. Etched samples were observed using optical microscopy (MO), and scanning electron microscopy (FESEM) with a backscattered electron detector (BSE) was used on unetched samples. Compositional microanalysis (EDS) was carried out for identifying the different phases present in the steels. Sigma phase was easily observed using different etching procedures, whereas χ-phase was only clearly detected with FESEM–BSE on unetched samples. The compositional analyses showed that the molybdenum content in χ-phase almost doubles the content of this element in σ-phase, and as a result the kinetics of nucleation and growth were also found to be remarkably faster when the alloy content in the steel is higher. In addition, chromium nitrides and carbides were also observed to precipitate as a result of the heat treatments and, in the case of the chromium nitrides, they act as a favorable site for the nucleation of σ-phase and χ-phase. - Highlights: • Microscopy was used on heat treated duplex steels for microstructure identification. • FESEM–BSE observation on unetched samples provided the best contrast between phases. • Analyses of carbides, nitrides, chi and sigma phases were possible by EDS and WDS. • Chromium nitrides act as favorable site for the nucleation of chi and sigma phases. • Secondary phases nucleation kinetics are faster in superduplex than in duplex steels.
International Nuclear Information System (INIS)
1977-12-01
An engineering assessment of the problems resulting from the existence of radioactive uranium mill tailings was performed at the Spook Site, Converse County, Wyoming. Data are presented from soil, water and other sample analyses, radiometric measurements to determine areas with radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations, the investigation of site geology, hydrology, and meteorology, and the evaluation and costing of alternative corrective actions. Radon gas release from the 187,000 tons of tailings at the Spook Site constitutes the main environmental impact, which is negligible. The two alternative actions presented are better fencing of the site in its present state and placing tailings and contaminated on-site materials and soil in the open-pit mine and covering the resulting pile with 2 ft of overburden material. The cost estimates for the options are $81,000 and $142,000, respectively. Reprocessing the tailings for uranium at a nearby operating uranium mill is worthy of economic consideration at this time
Normal tension glaucoma management: a survey of contemporary practice.
Symes, Richard J; Mikelberg, Frederick S
2017-08-01
The aim of this study was to investigate contemporary practice patterns with respect to normal tension glaucoma (NTG) management and to determine whether the 2 largest NTG trials have influenced ophthalmologists' clinical practice. A survey questionnaire was sent to ophthalmologists via the American Glaucoma Society, the Canadian Glaucoma Society, and the Canadian Ophthalmological Society. The questionnaire was designed to investigate ophthalmologists' usual practice with respect to NTG and the extent to which practice has been influenced by the Collaborative Normal Tension Glaucoma Study (CNTGS) and the Low pressure Glaucoma Treatment Study (LoGTS). In total, 419 ophthalmologists completed the survey. Of these, 264 respondents were glaucoma subspecialists. The survey showed that 95% and 64% of ophthalmologists were familiar with the CNTGS and the LoGTS, respectively. Of the respondents, 70% indicated that they would initiate treatment in mild-to-moderate NTG without waiting for documented disease progression. Of the respondents, 61% of the total surveyed and 50% of the glaucoma subspecialists felt that the LoGTS results had no impact on their usual clinical practice. The first-choice topical drug for NTG was a prostaglandin analogue (88% of respondents) or brimonidine (10% of respondents). Most ophthalmologists treat NTG more aggressively than recommended by the CTNGS protocol. Most ophthalmologists felt that the LoGTS results had no impact on their normal clinical practice. The prostaglandin analogues are, by far, the most popular choice of drug for contemporary management of NTG. Copyright © 2017 Canadian Ophthalmological Society. Published by Elsevier Inc. All rights reserved.
The WMO/IAEA rapid data exchange system in support of the early notification convention
International Nuclear Information System (INIS)
Asculai, E.; Mildner, S.
1990-01-01
Following the adoption, in September 1986, of the Convention on Early Notification of a Nuclear Accident, the IAEA and the WMO began work on the development of a methodology for the rapid dissemination of information and data following a nuclear accident. Expert Group meetings defined the data and information which needs to be disseminated, under the requirements of the Conventions. The Global Telecommunication System (GTS) of the WMO was identified as the suitable technical means of transmission since it combines immediate availability during times of emergency, rapidity of transmission and permanent connections to all Member States through their National Meteorological Centres. In order to utilize the GTS, special procedures and transmission formats have to be observed ad a specific code was jointly developed by WMO and IAEA to make the message Language-independent. Relevant instructions were issued in the WMO/IAEA Manual on the use of the WMO-GTS for the Early Notification Conventions. National arrangements for access by competent authorities to the information provided under the Early Notification Convention and for the provision of basic radiological data are of critical importance. Preparations are being made to provide specialized analyses and predictions on the atmospheric transport of radionuclides using the GTS and other means. The format and number of special output products is being specified in accordance with the requirements of the Member States. Requirements for meteorological and radiological data need to be kept under review in the light of model developments. The IAEA is presently engaged in the production of a software package for the coding/decoding of the data transmission
Ciri-Ciri Kepimpinan Pelajar Pintar dan Berbakat: Implikasi Ke atas Kepimpinan Remaja Islam
Directory of Open Access Journals (Sweden)
RORLINDA YUSOF
2014-12-01
Full Text Available Leadership is an important characteristic that enables Gifted and Talented Students (GTS to assume responsibility in the near future. This study aims to examine the levels of leadership characteristic and identify the leadership characteristics profiles amongst GTS. A total of 171 students (93 from High School Gifted Students and 78 from the Pre-University Gifted Students were involved in the study. The study employs a cross-sectional survey design and data was collected using questionnaire namely Student Leadership Characteristics Questionnaire (SLCQ. Data shows that GTS posses a high level of leadership characteristic. It is also found that collegiality indicates the highest score of the leadership characteristic, followed by leadership behaviour, influence competency, spiritual ethics, work relation, transformation and cohesion. Whereas, self-esteem, leadership efficacy, and visionary were among the average high and self-monitoring was the lowest leadership characteristic. The findings also indicated that female students possess higher leadership characteristics in comparison to the male students. Races such as Punjab and Bumiputra Sabah and Sarawak descend possess higher scores compared to the Chinese and Malays, whereas the Indians scored the lowest. Lastly, students from the High School Gifted Education Program possess higher leadership characteristics in comparison to the students from Pre-University Gifted Program. The study has proven that leadership characteristics were embedded in the GTS personality. The findings of this research provided a fundamental basis to be used in the future leadership education program for the gifted students and the leadership character development programs for Islamic youth in local school context.
Kundu, Ashis; Ghosh, Subhradip
2017-11-29
A delicate balance between various factors such as site occupancy, composition and magnetic ordering seems to affect the stability of the martensitic phase in [Formula: see text] [Formula: see text] [Formula: see text]. Using first-principles DFT calculations, we explore the impacts of each one of these factors on the martensitic stability of this system. Our results on total energies, magnetic moments and electronic structures upon changes in the composition, the magnetic configurations and the site occupancies show that the occupancies at the 4d sites in the inverse Heusler crystal structure play the most crucial role. The presence of Mn at the 4d sites originally occupied by Sn and its interaction with the Mn atoms at other sites decide the stability of the martensitic phases. This explains the discrepancy between the experiments and earlier DFT calculations regarding phase stability in [Formula: see text]NiSn. Our results qualitatively explain the trends observed experimentally with regard to martensitic phase stability and the magnetisations in Ni-excess, Sn-deficient [Formula: see text]NiSn system.
Gideaa study site. Scope of activities and main results
International Nuclear Information System (INIS)
Ahlbom, K.; Andersson, J.E.; Nordqvist, R.; Ljunggren, C.; Tiren, S.; Voss, C.
1991-10-01
During the period from 1977-1986 SKB (Swedish Nuclear Fuel and Waste Management Co) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection programme will be to perform detailed characterization, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build a repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if anyone of the study sites will be selected as a site for detailed characterization. Other site with geological and/or socio-economical characteristics judged more favourable may very well be the ones selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need of complementary investigations. This report concerns the Gideaa study site. (au)
Kamlunge study site. Scope of activities and main results
International Nuclear Information System (INIS)
Ahlbom, K.; Andersson, J.E.; Andersson, P.; Ittner, T.; Tiren, S.; Ljunggren, C.
1992-05-01
During the period from 1977-1986 SKB (Swedish nuclear Fuel and Waste Management Co.) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection programme will be to perform detailed characterization, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build a repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if anyone of the study sites will be selected as a site for detailed characterization. Other sites with geological and/or socio-economical characteristics judged more favourable may very well be selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need of complementary investigations. This report concerns the Kamlunge study site. (79 refs.) (au)
Fjaellveden study site. Scope of activities and main results
International Nuclear Information System (INIS)
Ahlbom, K.; Andersson, J.E.; Nordqvist, R.; Ljunggren, C.; Tiren, S.; Voss, C.
1991-10-01
During the period from 1977-1986 SKB (Swedish Nuclear Fuel and Waste Management CO) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection programme will be to perform detailed characterization, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if anyone of the study sites will be selected as a site for detailed characterization. Other sites with geological and/or socio-economical characteristics judged more favourable may very well be the ones selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need for complementary investigations. This report concerns the Fjaellveden study site. (au)
International Nuclear Information System (INIS)
1994-11-01
This baseline risk assessment of ground water contamination at the uranium mill tailings sites near Slick Rock, Colorado, evaluates potential public health and environmental impacts resulting from ground water contamination at the former North Continent (NC) and Union Carbide (UC) uranium mill processing sites. The tailings at these sites will be placed in a disposal cell at the proposed Burro Canyon, Colorado, site. The US Department of Energy (DOE) anticipates the start of the first phase remedial action by the spring of 1995 under the direction of the DOE's Uranium Mill Tailings Remedial Action (UMTRA) Project. The second phase of the UMTRA Project will evaluate ground water contamination. This baseline risk assessment is the first site-specific document for these sites under the Ground Water Project. It will help determine the compliance strategy for contaminated ground water at the site. In addition, surface water and sediment are qualitatively evaluated in this report
Energy Technology Data Exchange (ETDEWEB)
1994-11-01
This baseline risk assessment of ground water contamination at the uranium mill tailings sites near Slick Rock, Colorado, evaluates potential public health and environmental impacts resulting from ground water contamination at the former North Continent (NC) and Union Carbide (UC) uranium mill processing sites. The tailings at these sites will be placed in a disposal cell at the proposed Burro Canyon, Colorado, site. The US Department of Energy (DOE) anticipates the start of the first phase remedial action by the spring of 1995 under the direction of the DOE`s Uranium Mill Tailings Remedial Action (UMTRA) Project. The second phase of the UMTRA Project will evaluate ground water contamination. This baseline risk assessment is the first site-specific document for these sites under the Ground Water Project. It will help determine the compliance strategy for contaminated ground water at the site. In addition, surface water and sediment are qualitatively evaluated in this report.
International Nuclear Information System (INIS)
Dowell, F.
1987-01-01
A summary of results from a unique statistical-physics theory to predict and explain competing interactions and resulting microstructures in some partially-ordered [in this case, liquid-crystalline (LC)] phases is presented. The static aspects of both partial orientational and partial positional ordering of the molecules into various microstructures in these phases (including the incommensurate smectic-Ad phase) can be understood in terms of various competing interactions (both entropic and energetic) involved in the packing together of the different molecular sub-units at given pressures and temperatures. These microstructures are predicted and explained (using no ad hoc or arbitrarily adjustable parameter) as a function of molecule chemical structure [including lengths and shapes (from bond lengths and angles), intramolecular rotations, site-site polarizabilities and pair potentials, dipole moments, etc]. Theoretical results are presented for the nematic, re-entrant nematic, smectic-Ad, and smectic-Al LC phases and the isotropic phase
Quantifying Construction Site Sediment Discharge Risk and Treatment Potential
Ferrell, L.; Beighley, R. E.
2006-12-01
Dealing with soil erosion and sediment transport can be a significant challenge during the construction process due to the potentially large spatial and temporal extent and conditions of bare soils. Best Management Practices (BMP) are commonly used to eliminate or reduce offsite discharge of sediment. However, few efforts have investigated the time varying risk of sediment discharge from construction sites, which often have dynamic soil conditions and the potential for less than optimal BMP installations. The goal of this research is to improve the design, implementation and effectiveness of sediment and erosion control at construction sites using site specific, temporal distributions of sediment discharge risk. Sediment risk is determined from individual factors leading to sediment expert, such as rainfall frequency, the adequacy of BMP installations, and the extent and duration of bare soil conditions. This research specifically focuses on quantifying: (a) the effectiveness of temporary sediment and control erosion control BMPs in preventing, containing, and/or treating construction site sediment discharge at varying levels of "proper" installation, and (b) sediment discharge potential from construction sites during different phases of construction, (ex., disturbed earth operations). BMPs are evaluated at selected construction sites in southern California and at the Soil Erosion Research Laboratory (SERL) in the Civil and Environmental Engineering department at San Diego State University. SERL experiments are performed on a 3-m by 10-m tilting soil bed with soil depths up to 1 meter, slopes ranging from 0 to 50 percent, and rainfall rates up to 150 mm/hr (6 in/hr). BMP performance is assessed based on experiments where BMPs are installed per manufacture specifications, potential less than optimal installations, and no treatment conditions. Soil conditions are also varied to represent site conditions during different phases of construction (i.e., loose lifts
International Nuclear Information System (INIS)
ABDEL AZIZ, M.A.H.; COCHRAN, J.R.
2008-01-01
The aim of this study is to present a systematic methodology for siting of radioactive sealed sources disposal in arid countries and demonstrate the use of this methodology in Egypt. Availing from the experience gained from the greater confinement disposal (GCD) boreholes in Nevada, USA, the IAEA's approach for siting of near disposal was modified to fit the siting of the borehole disposal which suits the unwanted radioactive sealed sources. The modifications are represented by dividing the surveyed area into three phases; the exclusion phase in which the areas that meet exclusion criteria should be excluded, the site selection phase in which some potential sites that meet the primary criteria should be candidate and the preference stage in which the preference between the potential candidate sites should be carried out based on secondary criteria to select one or two sites at most. In Egypt, a considerable amount of unwanted radioactive sealed sources wastes have accumulated due to the peaceful uses of radio-isotopes.Taking into account the regional aspects and combining of the proposed developed methodology with geographic information system (GIS), the Nile Delta and its valley, the Sinai Peninsula and areas of historical heritage value are excluded from our concern as potential areas for radioactive waste disposal. Using the primary search criteria, some potential sites south Kharga, the Great Sand Sea, Gilf El-Kebear and the central part of the eastern desert have been identified as candidate areas meeting the primary criteria of site selection. More detailed studies should be conducted taking into account the secondary criteria to prefer among the above sites and select one or two sites at most
Feasibility study for the United Heckathorn Superfund Site, Richmond, California
Energy Technology Data Exchange (ETDEWEB)
Lincoff, A.H. [US Environmental Protection Agency, San Francisco, CA (United States). Region IX; Costan, G.P.; Montgomery, M.S.; White, P.J. [Pacific Northwest Lab., Richland, WA (United States)
1994-07-01
The United Heckathom Superfund Site in Richmond, California, was used to formulate pesticides from approximately 1947 to 1966. Soils at the site and sediments in the harbor were contaminated with various chlorinated pesticides, primarily DDT, as a result of these activities. The US Environmental Protection Agency listed the site on the Superfund National Priorities List in 1990. This document is part of the Remedial Investigation and Feasibility Study phase of the Superfund response, which will provide the basis for selection of a final remedy that will protect human health and the environment and achieve compliance with federal and state envirorunental laws.
Feasibility study for the United Heckathorn Superfund Site, Richmond, California
International Nuclear Information System (INIS)
Lincoff, A.H.
1994-07-01
The United Heckathom Superfund Site in Richmond, California, was used to formulate pesticides from approximately 1947 to 1966. Soils at the site and sediments in the harbor were contaminated with various chlorinated pesticides, primarily DDT, as a result of these activities. The US Environmental Protection Agency listed the site on the Superfund National Priorities List in 1990. This document is part of the Remedial Investigation and Feasibility Study phase of the Superfund response, which will provide the basis for selection of a final remedy that will protect human health and the environment and achieve compliance with federal and state envirorunental laws
Onuki, Mayumi; Yokoyama, Kazuhito; Kimura, Kaoru; Sato, Hajime; Nordin, Rusli Bin; Naing, Lin; Morita, Yoko; Sakai, Tadashi; Kobayashi, Yasuki; Araki, Shunichi
2003-05-01
To assess dermal absorption of nicotine from tobacco leaves in relation to Green Tobacco Sickness (GTS), urinary cotinine concentrations were measured in 80 male tobacco-growing farmers and in 40 healthy males (controls) who did not handle wet tobacco leaves in Kelantan, Malaysia. Among non-smokers, urinary cotinine levels in farmers were significantly higher than those of controls; farmers with urinary cotinine of 50 ng/ml/m2 or above showed eye symptoms more frequently than those below this level (ptobacco farmers evidence a risk of nicotine poisoning from tobacco leaves, assessment including GTS together with effects of pesticides will be necessary.
Asymmetric exclusion processes with site sharing in a one-channel transport system
International Nuclear Information System (INIS)
Liu Mingzhe; Hawick, Ken; Marsland, Stephen
2010-01-01
This Letter investigates two-species totally asymmetric simple exclusion process (TASEP) with site sharing in a one-channel transport system. In the model, different species of particles may share the same sites, while particles of the same species may not (hard-core exclusion). The site-sharing mechanism is applied to the bulk as well as the boundaries. Such sharing mechanism within the framework of the TASEP has been largely ignored so far. The steady-state phase diagrams, currents and bulk densities are obtained using a mean-field approximation and computer simulations. The presence of three stationary phases (low-density, high-density, and maximal current) are identified. A comparison on the stationary current with the Bridge model [M.R. Evans, et al., Phys. Rev. Lett. 74 (1995) 208] has shown that our model can enhance the current. The theoretical calculations are well supported by Monte Carlo simulations.
Energy Technology Data Exchange (ETDEWEB)
Demircioglu, Eylem; Odabasi, Mustafa [Faculty of Engineering, Department of Environmental Engineering, Dokuz Eylul University, Izmir (Turkey); Sofuoglu, Aysun [Faculty of Engineering, Department of Chemical Engineering, Izmir Institute of Technology, Gulbahce-Urla (Turkey)
2011-04-15
Ambient air polycyclic aromatic hydrocarbon (PAH) samples were collected at a suburban (n = 63) and at an urban site (n = 14) in Izmir, Turkey. Average gas-phase total PAH (sum {sub 14}PAH) concentrations were 23.5 ng m{sup -3} for suburban and 109.7 ng m{sup -3} for urban sites while average particle-phase total PAH concentrations were 12.3 and 34.5 ng m{sup -3} for suburban and urban sites, respectively. Higher ambient PAH concentrations were measured in the gas-phase and sum {sub 14}PAH concentrations were dominated by lower molecular weight PAHs. Multiple linear regression analysis indicated that the meteorological parameters were effective on ambient PAH concentrations. Emission sources of particle-phase PAHs were investigated using a diagnostic plot of fluorene (FLN)/(fluorine + pyrene; PY) versus indeno[1,2,3-cd]PY/(indeno[1,2,3-cd]PY + benzo[g,h,i]perylene) and several diagnostic ratios. These approaches have indicated that traffic emissions (petroleum combustion) were the dominant PAH sources at both sites for summer and winter seasons. Experimental gas-particle partition coefficients (K{sub P}) were compared to the predictions of octanol-air (K{sub OA}) and soot-air (K{sub SA}) partition coefficient models. The correlations between experimental and modeled K{sub P} values were significant (r{sup 2} = 0.79 and 0.94 for suburban and urban sites, respectively, p < 0.01). Octanol-based absorptive partitioning model predicted lower partition coefficients especially for relatively volatile PAHs. However, overall there was a relatively good agreement between the measured K{sub P} and soot-based model predictions. (Copyright copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Signal peptide discrimination and cleavage site identification using SVM and NN.
Kazemian, H B; Yusuf, S A; White, K
2014-02-01
About 15% of all proteins in a genome contain a signal peptide (SP) sequence, at the N-terminus, that targets the protein to intracellular secretory pathways. Once the protein is targeted correctly in the cell, the SP is cleaved, releasing the mature protein. Accurate prediction of the presence of these short amino-acid SP chains is crucial for modelling the topology of membrane proteins, since SP sequences can be confused with transmembrane domains due to similar composition of hydrophobic amino acids. This paper presents a cascaded Support Vector Machine (SVM)-Neural Network (NN) classification methodology for SP discrimination and cleavage site identification. The proposed method utilises a dual phase classification approach using SVM as a primary classifier to discriminate SP sequences from Non-SP. The methodology further employs NNs to predict the most suitable cleavage site candidates. In phase one, a SVM classification utilises hydrophobic propensities as a primary feature vector extraction using symmetric sliding window amino-acid sequence analysis for discrimination of SP and Non-SP. In phase two, a NN classification uses asymmetric sliding window sequence analysis for prediction of cleavage site identification. The proposed SVM-NN method was tested using Uni-Prot non-redundant datasets of eukaryotic and prokaryotic proteins with SP and Non-SP N-termini. Computer simulation results demonstrate an overall accuracy of 0.90 for SP and Non-SP discrimination based on Matthews Correlation Coefficient (MCC) tests using SVM. For SP cleavage site prediction, the overall accuracy is 91.5% based on cross-validation tests using the novel SVM-NN model. © 2013 Published by Elsevier Ltd.
Prindull, Gregor
2012-11-01
This review focuses on gene transcription patterns of leukemogenic S-phases in mitotic cell cycles for identification of enzymatic reactions as potential targets for epigenetics-based drug therapy. Transcription of leukemic genes is triggered by reprogrammed transcription factors (TFs) mediated by chromatin histones. Reprogrammed TFs originate from transcriptional alterations of CpG methylation patterns of mutated epigenetic genes. They preserve memory information of earlier leukemogenic exposures, even transgenerationally via the zygote, through small (e.g. pi)RNA transmitted between cells by exosomes. Normally, reprogrammed TFs are enzymatically silenced and stored as markers in heterochromatic domains. Failure of intra S-phase surveillance (IS) permits the formation and continual operation of DNA replication forks in spite of persisting genotoxic stress. Silenced TFs are re-activated by euchromatin, most likely through leakages of insulator barriers of cis-regulating chromatin modulators (CRM) that normally separate hetero- from euchromatin domains. During transport by sliding nucleosomes, reprogrammed leukemogenic TFs are misplaced at transcription factor binding-/starting-sites (TFBS /TSS) allowing them to interact with and trigger replication of mutated leukemic genes. Interactions of enzymatically reprogrammed TFs, transcribed from mutated epigenetic genes, with replicating leukemic genes at TFBS/TSSs are key driving forces in leukemogenesis. Probably, epigenetic genes, although mutated, still retain their control of replication of leukemic genes. Epigenetics-based enzyme inhibitors must target reprogrammed TFs. Prudently, therapeutic corrections should be introduced within the frame of conventional, cytoreductive treatment protocols. Alternatively, reprogrammed TFs could be replaced by cell populations with regular TF production. Clinically, classification of leukemias should be based on their epigenetic presentation.
Energy Technology Data Exchange (ETDEWEB)
NONE
2008-07-01
As the nuclear industry moves into a new development phase, many facilities built in the fifties and sixties are reaching the end of their service life. Dismantling them and rehabilitating the sites on which they stand is a major industrial challenge which will give rise to a number of new projects. AREVA has more than 20 years' experience in these highly technical fields. As more and more sites reach the end of their service life, AREVA considers nuclear site value development as a fully-fledged industrial activity. The group's competencies in this field have been grouped together to form a dedicated entity: the Nuclear Site Value Development Business Unit, created in 2008. Several billion euros are invested in site value development projects which are far-reaching and complex, and often last for several decades. Long before work actually begins, lengthy studies and preparations are required to schedule operations, select the techniques to be used and optimize costs and deadlines. The Nuclear Site Value Development BU is currently working on four major projects involving its own facilities and those of the CEA: - La Hague: dismantling of the first generation of used fuel recycling facilities. Between 1966 and 1998, almost 5,000 tons of used fuel from graphite-moderated gas-cooled reactors, 4,500 tons of light water reactor fuel, as well as fuel from fast reactors and research reactors, were treated at UP2 400, the very first industrial recycling plant on the La Hague site. - Marcoule: first-time dismantling of a recycling plant. 1,000 rooms to be cleaned up, 30,000 tons of waste to be treated, 30 years of work. - Cadarache: first-time dismantling of a Mox fuel fabrication plant. The Cadarache plant was commissioned in 1962 to fabricate fuel for fast reactors; this was followed by MOX fuel for light water reactors, an activity which continued until the plant was shut down in 2003. - Annecy and Veurey: giving a new lease of life to former industrial sites
Site characterization and petroleum hydrocarbon plume mapping
Energy Technology Data Exchange (ETDEWEB)
Ravishankar, K. [Harding Lawson Associates, Houston, TX (United States)
1996-12-31
This paper presents a case study of site characterization and hydrocarbon contamination plume mapping/delineation in a gas processing plant in southern Mexico. The paper describes innovative and cost-effective use of passive (non-intrusive) and active (intrusive) techniques, including the use of compound-specific analytical methods for site characterization. The techniques used, on a demonstrative basis, include geophysical, geochemical, and borehole drilling. Geochemical techniques used to delineate the horizontal extent of hydrocarbon contamination at the site include soil gas surveys. The borehole drilling technique used to assess the vertical extent of contamination and confirm geophysical and geochemical data combines conventional hollow-stem auguring with direct push-probe using Geoprobe. Compound-specific analytical methods, such as hydrocarbon fingerprinting and a modified method for gasoline range organics, demonstrate the inherent merit and need for such analyses to properly characterize a site, while revealing the limitations of noncompound-specific total petroleum hydrocarbon analysis. The results indicate that the techniques used in tandem can properly delineate the nature and extent of contamination at a site; often supplement or complement data, while reducing the risk of errors and omissions during the assessment phase; and provide data constructively to focus site-specific remediation efforts. 7 figs.
International Nuclear Information System (INIS)
1977-12-01
An engineering assessment was performed of the problems resulting from the existence of radioactive uranium mill tailings at the Green River site, Utah. Services included the preparation of topographic maps, the performance of core drillings and radiometric measurements sufficient to determine areas and volumes of tailings and other radium-contaminated materials, the evaluation of resulting radiation exposures of individuals and nearby populations , the investigation of site hydrology and meteorology and the evaluation and costing of alternative corrective actions. Radon gas release from the 123 thousand tons of tailings at the Green River site constitutes the most significant environmental impact, although windblown tailings and external gamma radiation are also factors. The three alternative actions presented are dike stabilization, fencing, on- and off-site decontamination and maintenance (Option I); improvements in the stabilization cover and diking plus cleanup of the site and Browns Wash, and realignment of Browns Wash (Option II); and addition of stabilization cover to a total of 2 ft, realignment of Browns Wash and placement of additional riprap, on-site cleanup and drainage improvements (Option III). All options include remedial action at off-site structures. Cost estimates for the three options range from $700,000 to $926,000
Assessment of air pollutant emissions from the Akrotiri landfill site (Chania, Greece).
Chalvatzaki, E; Lazaridis, M
2010-09-01
Air pollutants emitted from landfills affect air quality, contribute to the greenhouse effect and may cause serious problems to human health under certain circumstances. The current study was focused on the determination of air emissions from the Akrotiri landfill site which is located in the Akrotiri area (Chania, Greece). The landfill consists of two phases, phase A (first phase) which is currently closed (operational between 2003 and 2007) and phase B (second phase, operation between 2007 and (foreseen) 2013). Three different emission models (the EPA LandGEM model, the triangular model and the stoichiometric model) were used for the quantification of emissions. The LandGEM 3.02 software was further adopted and used in conjunction with the long-term dispersion model ISC3-LT for the evaluation of the dispersion of gaseous chemical components from the landfill. The emission and meteorological conditions under which the models were applied were based on the worst-case emission scenario. Furthermore, the concentration of hydrogen sulfide, vinyl chloride and benzene were determined in and around the landfill site. The concentrations of hydrogen sulfide and benzene were calculated to be far below the limit value proposed by the World Health Organization (WHO) for human health safety. However, the vinyl chloride concentrations were above the WHO reference lifetime exposure health criteria for the phase B area.
ORF Alignment: NC_001144 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available GTS Sbjct: 121 PDGGHLSHGYATENRKISAVSTYFESFPYRVNPETGIIDYDTLEKNAILYRPKVLVAGTS 180 ... Query: 255 GAMIFFRRGVRSINPK...TGKEVLYDLENPINFSVFPGHQGGPHNHTIXXXXXXXXXXXXPE 314 ... GAMIFFRRGVRSINPKTGKEV...LYDLENPINFSVFPGHQGGPHNHTI ... PE Sbjct: 241 GAMIFFRRGVRSINPKTGKEVLYDLENPINFSVFPGHQGGPHNHTIAALATALKQAA
Presence of UV-endonuclease sensitive sites in daughter DNA of UV-irradiated mammalian cells
International Nuclear Information System (INIS)
D'Ambrosio, S.; Setlow, R.B.
1978-02-01
Asynchronous Chinese hamster cells were irradiated with 10 Jm -2 uv radiation and 0.25 to 4 hours later pulse-labeled with [ 3 H]thymidine. Cells synchronized by shaking off mitotic and G 1 cells were irradiated in either the G 1 -phase or S-phase of the cell cycle and pulse-labeled with [ 3 H]thymidine in the S-phase. After a 12 to 14 hour chase in unlabeled medium, the DNA was extracted, incubated with Micrococcus luteus uv-endonuclease and sedimented in alkaline sucrose. The number of endonuclease sensitive sites decreased as the time between uv irradiation and pulse-labeling of daughter DNA increased. Further, there were significantly less endonuclease sensitive sites in the daughter DNA from cells irradiated in the G 1 -phase than in the S-phase. These data indicate that very few, if any, dimers are transferred from parental DNA to daughter DNA and that the dimers detected in daughter DNA may be due to the irradiation of replicating daughter DNA before labeling
Phase Synchronization for the Mid-Frequency Square Kilometre Array Telescope
Schediwy, Sascha; Gozzard, David; Stobie, Simon; Gravestock, Charles; Whitaker, Richard; Alachkar, Bassem; Malan, Sias; Boven, Paul; Grainge, Keith
2018-01-01
The Square Kilometre Array (SKA) project is an international effort to build the world’s most sensitive radio telescope operating in the 50 MHz to 14 GHz frequency range. Construction of the SKA has been divided into phases, with the first phase (SKA1) accounting for the first 10% of the telescope's receiving capacity. During SKA1, a low-frequency aperture array comprising over a hundred thousand individual dipole antenna elements will be constructed in Western Australia (SKA1-low), while an array of 197 parabolic-dish antennas, incorporating the 64 dishes of MeerKAT, will be constructed in South Africa (SKA1-mid).Radio telescope arrays such as the SKA require phase-coherent reference signals to be transmitted to each antenna site in the array. In the case of the SKA1-mid, these reference signals will be generated at a central site and transmitted to the antenna sites via fiber-optic cables up to 175 km in length. Environmental perturbations affect the optical path length of the fiber and act to degrade the phase stability of the reference signals received at the antennas, which has the ultimate effect of reducing the fidelity and dynamic range of the data.Since 2011, researchers at the University of Western Australia (UWA) have led the development of an actively-stabilized phase-synchronization system designed specifically to meet the scientific needs and technical challenges of the SKA telescope. Recently this system has been select as the official phase synchronization system for the SKA1-mid telescope. The system is an evolution of Atacama Large Millimeter Array’s distributed ‘photonic local oscillator system’, incorporating key advances made by the international frequency metrology community over the last decade, as well as novel innovations developed by UWA researchers.In this presentation I will describe the technical details of the system; outline how the system's performance was tested using metrology techniques in a laboratory setting, on 186 km
Phase 1 of the Hanford Environmental Dose Reconstruction Project
International Nuclear Information System (INIS)
1991-08-01
The work described in this report was prompted by the public's concern about potential effect from the radioactive materials released from the Hanford Site. The Hanford Environmental Dose Reconstruction (HEDR) Project was established to estimate radiation dose the public might have received from the Hanford Site since 1944, when facilities began operating. Phase 1 of the HEDR Project is a ''pilot'' or ''demonstration'' phase. The objectives of this initial phase were to determine whether enough historical information could be found or reconstructed to be used for dose estimation and develop and test conceptual and computational models for calculating credible dose estimates. Preliminary estimates of radiation doses were produced in Phase 1 because they are needed to achieve these objectives. The reader is cautioned that the dose estimates provided in this and other Phase 1 HEDR reports are preliminary. As the HEDR Project continues, the dose estimates will change for at least three reasons: more complete input information for models will be developed; the models themselves will be refined; and the size and shape of the geographic study area will change. This is one of three draft reports that summarize the first phase of the four-phased HEDR Project. This, the Summary Report, is directed to readers who want a general understanding of the Phase 1 work and preliminary dose estimates. The two other reports -- the Air Pathway Report and the Columbia River Pathway Report -- are for readers who understand the radiation dose assessment process and want to see more technical detail. Detailed descriptions of the dose reconstruction process are available in more than 20 supporting reports listed in Appendix A. 32 refs., 46 figs
Web vulnerability study of online pharmacy sites.
Kuzma, Joanne
2011-01-01
Consumers are increasingly using online pharmacies, but these sites may not provide an adequate level of security with the consumers' personal data. There is a gap in this research addressing the problems of security vulnerabilities in this industry. The objective is to identify the level of web application security vulnerabilities in online pharmacies and the common types of flaws, thus expanding on prior studies. Technical, managerial and legal recommendations on how to mitigate security issues are presented. The proposed four-step method first consists of choosing an online testing tool. The next steps involve choosing a list of 60 online pharmacy sites to test, and then running the software analysis to compile a list of flaws. Finally, an in-depth analysis is performed on the types of web application vulnerabilities. The majority of sites had serious vulnerabilities, with the majority of flaws being cross-site scripting or old versions of software that have not been updated. A method is proposed for the securing of web pharmacy sites, using a multi-phased approach of technical and managerial techniques together with a thorough understanding of national legal requirements for securing systems.
1996 Phase 2 soil sampling at the 183-H Solar Evaporation Basin site
International Nuclear Information System (INIS)
Kramer, C.D.
1996-10-01
This report consolidates 1996 soil sampling data collected from the 183-H Solar Evaporation Basin Site. This report is intended to be a data reference and does not make comparisons or conclusions regarding specific regulatory criteria. Chemical and radiological data were collected to support cleanup activities at the Hanford Site; soil sampling occurred beneath and next to the former basin structures. The 183-H Solar Evaporation Basins, which consisted of four adjoining concrete basins, were located in the 100 Area of the Hanford Site, north of the retired 105-H Reactor. Originally, the basins were built as part of the 100-H water treatment structures. The four basins were inactive from the mid-1960's until 1973 when radioactive and dangerous (mixed) waste from the 300 Area Fuel Fabrication Facility was shipped to the basins for storage and treatment. The basins were used for solar evaporation of the waste. The last shipment of waste to the 183-H Basins took place in November 1985. Decontamination of the cement structure took place in 1995. The structure has subsequently been dismantled and disposed. Chapters 2.0 through 4.0 present summary information about sampling (1) beneath the loading ramp and berm piles, (2) in shallow soils beneath the former basin floor, and (3) deep vadose soils. Detailed data are provided in the appendices
Petrology of tuff units from the J-13 drill site, Jackass Flats, Nevada
International Nuclear Information System (INIS)
Heiken, G.H.; Bevier, M.L.
1979-01-01
The J-13 drill hole, located in Jackass Flats, Nevada Test Site, has penetrated 125 m of alluvium and 932 m of tuff. Most of the tuff deposits consist of welded tuffs; glass phases in the tuffs have been replaced by authigenic minerals, mainly K-feldspar, silica, and zeolites. The zonation of authigenic minerals, with depth, indictes that alteration of glass phases and filling of vugs occurred during welding and compaction of tuff units soon after deposition and by interaction with groundwater. Zonation of authigenic minerals in tuff deposits at Jackass Flats is similar to mineral zonation in tuffs elsewhere at the Nevada Test Site and in tuff deposits of west Texas. All appear to have been developed by leaching of glass phases and deposition of authigenic minerals in open hydrologic systems. 10 figures, 38 tables
Photometric Observations of Soils and Rocks at the Mars Exploration Rover Landing Sites
Johnson, J. R.; Arvidson, R. A.; Bell, J. F., III; Farrand, W.; Guinness, E.; Johnson, M.; Herkenhoff, K. E.; Lemmon, M.; Morris, R. V.; Seelos, F., IV
2005-01-01
The Panoramic Cameras (Pancam) on the Spirit and Opportunity Mars Exploration Rovers have acquired multispectral reflectance observations of rocks and soils at different incidence, emission, and phase angles that will be used for photometric modeling of surface materials. Phase angle coverage at both sites extends from approx. 0 deg. to approx. 155 deg.
Alternating current electrocoagulation for Superfund site remediation
International Nuclear Information System (INIS)
Farrell, C.W.
1991-01-01
A study is being conducted by Electro-Pure Systems, Inc. (EPS) under the Emerging Technology portion of the U.S. Environmental Protection Agency's (EPA's) Superfund Innovative Technology Evaluation (SITE) Program to study alternating current electrocoagulation for Superfund site remediation. Alternating current electrocoagulation has proven to be effective in agglomerating and removing colloidal solids, metals and certain organic contaminants from surrogate soils prepared from the US EPA's Synthetic Soil Matrix. Treatments under a wide range of operating conditions have enabled the optimum parameter settings to be established for multiple phase separation. Electrocoagulation enables appreciably enhanced filtration and dewatering rates to be realized for metals- and diesel fuel-spiked surrogate soil slurries; such enhancements are prompted by growth in the mean particle size of the clays and particulates from typically < 10 microns to as much as 150 microns depending on the degree of electrocoagulation. Reduction in the total suspended solids content of clays in all slurries in excess of 90% can routinely be achieved. Bench-scale experiments of the metals-spiked surrogate soils indicate that electrocoagulation preferentially concentrates soluble metals into the sludge phase; excellent metals separation (Pb, Cr, Cu, Cd) can be realized. Experiments on surrogate wastes spiked with volatile organics suggest that this technology is not capable of effecting good volatile extractions from the aqueous phase. Reductions in excess of 80% in the total organic carbon (TOC) content of the diesel fuel-spiked surrogates can, however, be achieved
Geologic nuclear waste repository site selection studies in the Paradox Basin, Utah
International Nuclear Information System (INIS)
Rogers, T.H.; Conwell, F.R.
1981-01-01
During Phase I regional-level studies, a literature review was conducted to ascertain geologic characteristics pertinent to repository siting factors. On the basis of the regional screening results, four areas in southeastern Utah were selected as being suitable for more detailed study in Phase II: Elk Ridge and Gibson Dome, containing nearly horizontal bedded salt deposits; Salt Valley, containing a diapiric salt anticline; and Lisbon Valley, containing a non-diapiric salt anticline. During current Phase II area studies, the four study areas are being characterized in greater detail than in Phase I. Phase II will culminate in the identification of a potentially suitable location(s), if any, that will be recommended for study in still greater detail in a subsequent phase of work. 5 refs
Energy Technology Data Exchange (ETDEWEB)
Nie, Lei [Collaborative Innovation Center of Chemical Science and Engineering, School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 P.R. China; Institute for Integrated Catalysis, Pacific Northwest National Laboratory, P.O. Box 999 Richland WA 99352 USA; Peng, Bo [Institute for Integrated Catalysis, Pacific Northwest National Laboratory, P.O. Box 999 Richland WA 99352 USA; Zhu, Xinli [Collaborative Innovation Center of Chemical Science and Engineering, School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 P.R. China
2018-02-05
Hydrodeoxygenation of guaiacol, a phenolic compound derived from lignin fraction of biomass, over a Pt/HBeta catalyst at 350 °C and atmospheric pressure produces benzene, toluene, xylenes, and C9+ aromatics with yield of 42%, 29%, 12%, and 5%, respectively. Reaction pathways for conversion of two functional groups (hydroxyl and methoxyl) over the bifunctional catalyst were studied. Both guaiacol and intermediate products (catechol and cyclopentanone) were fed onto zeolite HBeta and Pt/SiO2 to identify the individual role of acid site and metal site. Acid sites (mainly Brønsted acid site, BAS) catalyze transalkylation and dehydroxylation reactions in sequence, producing phenol, cresols and xylenols as the major products at high conversion. Pt sites catalyze demethylation reaction resulting in catechol as the primary product, which can either be deoxygenated to phenol followed by phenol to benzene, or decarbonylated to cyclopentanone and further to butane. The close proximity of Pt and BAS in bifunctional Pt/HBeta enables both transalkylation and deoxygenation reactions with inhibited demethylation and decarbonylation reactions, producing aromatics as major final products with a total yield > 85%. Both activity and stability of bifunctional Pt/HBeta during hydrodeoxygenation of guaiacol is improved compared to HBeta and Pt/SiO2. The addition of water to the feed further improves the activity and stability via hydrolysis of O-CH3 bond of guaiacol on BAS and removing coke around Pt.
International Nuclear Information System (INIS)
Olshansky, S.J.; Krummel, J.R.; Policastro, A.J.; McGinnis, L.D.
1994-03-01
As part of the Chemical Stockpile Disposal Program, an independent review is presented of the US Army Phase I environmental report for the disposal of chemical agents and munitions stored at the Pueblo Depot Activity (PUDA) in Pueblo, Colorado. The Phase I report addresses new and additional concerns not incorporated in the final programmatic environmental impact statement (FPEIS). These concerns are addressed by examining site-specific data for the PUDA. On the basis of our review of the Phase I report, we concluded that on-site meteorological data from December 1988 to June 1992 appear to be of insufficient quality to have been used instead of the off-site Pueblo airport data. No additional meteorological data have been collected since June 1992. The Phase I report briefly mentions problems with the air pollution control system. These problems will likely require the systems to be upgraded at the Johnston Atoll site and at each of the other depots in the continental United States. Without such improvements, the probability of accidents during start-up and shutdown would likely increase. The Army has a lessons-learned program to incorporate improvements into the design of future facilities. The Phase I report does not make any design change commitments. These issues need to be fully evaluated and resolved before any final conclusion concerning the adequacy of the decision in the FPEIS can be made with respect to the PUDA. With the exception of this issue, the inclusion of other more detailed site-specific data in the Phase I report does not change the decision reached in the FPEIS (which favored on-site disposal at the PUDA). We recommend that site-specific data on water, ecological, socioeconomic, and cultural resources and emergency planning and preparedness be considered explicitly in the site-specific EIS decision-making process
SRP Baseline Hydrogeologic Investigation, Phase 3
Energy Technology Data Exchange (ETDEWEB)
Bledsoe, H.W.
1988-08-01
The SRP Baseline Hydrogeologic Investigation was implemented for the purpose of updating and improving the knowledge and understanding of the hydrogeologic systems underlying the SRP site. Phase III, which is discussed in this report, includes the drilling of 7 deep coreholes (sites P-24 through P-30) and the installation of 53 observation wells ranging in depth from approximately 50 ft to more than 970 ft below the ground surface. In addition to the collection of geologic cores for lithologic and stratigraphic study, samples were also collected for the determination of physical characteristics of the sediments and for the identification of microorganisms.
Calculated site substitution in ternary gamma'-Ni3Al: Temperature and composition effects
DEFF Research Database (Denmark)
Ruban, Andrei; Skriver, Hans Lomholt
1997-01-01
-tin orbitals method in conjunction with the local-density and multisublattice coherent-potential approximations and include all 3d, 4d, 5d, and noble metals. The calculations show the existence of simple trends in the alloying behavior of the gamma' phase which may be explained in a Friedel-like model based...... on the interaction between Ni and the added species. It is shown that the commonly accepted interpretation of the site substitution behavior of Cu and Pd may be incorrect because of site substitution reversal at high temperatures. It is further shown that the direction of the solubility lobe in the ternary phase...
40 CFR 228.6 - Specific criteria for site selection.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Specific criteria for site selection. 228.6 Section 228.6 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN..., nursery, feeding, or passage areas of living resources in adult or -juvenile phases; (3) Location in...
Klipperaas study site. Scope of activities and main results
International Nuclear Information System (INIS)
Ahlbom, K.; Andersson, J.E.; Andersson, Peter; Ittner, T.; Tiren, S.; Ljunggren, C.
1992-09-01
During the period from 1977 - 1986 SKB (Swedish Nuclear Fuel and Waste Management Co.) performed surface and borehole investigations of 14 study sites for the purpose of assessing their suitability for a repository of spent nuclear fuel. The next phase in the SKB site selection rpogramme will be to perform detailed characterisation, including characterization from shafts and/or tunnels, of two or three sites. The detailed investigations will continue over several years to provide all the data needed for a licensing application to build a repository. Such an application is foreseen to be given to the authorities around the year 2003. It is presently not clear if any of the study sites will be selected as a site for detailed characterization. Other sites with geological and/or socio-economical characteristics judged more favorable may very well be the ones selected. However, as a part of the background documentation needed for the site selection studies to come, summary reports will be prepared for most study sites. These reports will include scope of activities, main results, uncertainties and need of complementary investigations. This report concern the Klipperaas study site. The main topics are the scope of activities, geologic model, geohydrological model, groundwater chemistry, assessment of solute transport, and rock mechanics
Process for selecting a site for Canada's deep geological repository for used nuclear fuel
International Nuclear Information System (INIS)
Facella, J.; Belfadhel, M.B.
2011-01-01
The Nuclear Waste Management Organization (NWMO) is responsible for implementing Adaptive Phased Management, the approach selected by the Government of Canada for long-term management of used nuclear fuel waste generated by Canadian nuclear reactors. The ultimate objective of Adaptive Phased Management is the centralized containment and isolation of Canada's used nuclear fuel in a Deep Geological Repository in a suitable crystalline or sedimentary rock formation at a depth of about 500m. The repository will consist of a series of access and service shafts and a series of tunnels leading to placement rooms where used fuel will be placed and sealed in competent rock using a multi-barrier system which includes long lived specially designed containers, sealing materials such as bentonite and the rock itself. The used fuel will be monitored throughout all phases of implementation and will also remain retrievable for an extended period of time. In May 2010, the NWMO published the site selection process that serves as the road map to decision-making on the location for the deep geological repository. NWMO initiated the process with a first stage that invites communities to learn more about the project and the site selection process. NWMO is actively building awareness of the project and, on request of communities, is delivering briefings, supporting community capacity building and undertaking high-level screenings of site suitability. The paper provides a brief description of: Adaptive Phased Management including the deep geological repository which is its ultimate goal, and the design of the site selection process, and importantly the approach to assessing the suitability of sites from both a social and technical perspective. The paper will outline how NWMO sought to develop a socially-acceptable site selection process as a firm foundation for future decisions on siting. Through a two-year collaborative process, NWMO sought to understand the expectations of
Advanced Simulation Capability for Environmental Management (ASCEM) Phase II Demonstration
Energy Technology Data Exchange (ETDEWEB)
Freshley, M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hubbard, S. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Flach, G. [Savannah River National Lab. (SRNL), Aiken, SC (United States); Freedman, V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Agarwal, D. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Andre, B. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Bott, Y. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Chen, X. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Davis, J. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Faybishenko, B. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Gorton, I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Murray, C. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Moulton, D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Meyer, J. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Rockhold, M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Shoshani, A. [LBNL; Steefel, C. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Wainwright, H. [Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States); Waichler, S. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2012-09-28
quality assurance. The Platform and HPC capabilities are being tested and evaluated for EM applications through a suite of demonstrations being conducted by the Site Applications Thrust. In 2010, the Phase I Demonstration focused on testing initial ASCEM capabilities. The Phase II Demonstration, completed in September 2012, focused on showcasing integrated ASCEM capabilities. For Phase II, the Hanford Site Deep Vadose Zone (BC Cribs) served as an application site for an end-to-end demonstration of ASCEM capabilities on a site with relatively sparse data, with emphasis on integration and linkages between the Platform and HPC components. Other demonstrations included in this Phase II report included addressing attenuation-based remedies at the Savannah River Site F-Area, to exercise linked ASCEM components under data-dense and complex geochemical conditions, and conducting detailed simulations of a representative waste tank. This report includes descriptive examples developed by the Hanford Site Deep Vadose Zone, the SRS F-Area Attenuation-Based Remedies for the Subsurface, and the Waste Tank Performance Assessment working groups. The integrated Phase II Demonstration provides test cases to accompany distribution of the initial user release (Version 1.0) of the ASCEM software tools to a limited set of users in 2013. These test cases will be expanded with each new release, leading up to the release of a version that is qualified for regulatory applications in the 2015 time frame.
Exact phase boundaries and topological phase transitions of the X Y Z spin chain
Jafari, S. A.
2017-07-01
Within the block spin renormalization group, we give a very simple derivation of the exact phase boundaries of the X Y Z spin chain. First, we identify the Ising order along x ̂ or y ̂ as attractive renormalization group fixed points of the Kitaev chain. Then, in a global phase space composed of the anisotropy λ of the X Y interaction and the coupling Δ of the Δ σzσz interaction, we find that the above fixed points remain attractive in the two-dimesional parameter space. We therefore classify the gapped phases of the X Y Z spin chain as: (1) either attracted to the Ising limit of the Kitaev-chain, which in turn is characterized by winding number ±1 , depending on whether the Ising order parameter is along x ̂ or y ̂ directions; or (2) attracted to the charge density wave (CDW) phases of the underlying Jordan-Wigner fermions, which is characterized by zero winding number. We therefore establish that the exact phase boundaries of the X Y Z model in Baxter's solution indeed correspond to topological phase transitions. The topological nature of the phase transitions of the X Y Z model justifies why our analytical solution of the three-site problem that is at the core of the present renormalization group treatment is able to produce the exact phase boundaries of Baxter's solution. We argue that the distribution of the winding numbers between the three Ising phases is a matter of choice of the coordinate system, and therefore the CDW-Ising phase is entitled to host appropriate form of zero modes. We further observe that in the Kitaev-chain the renormalization group flow can be cast into a geometric progression of a properly identified parameter. We show that this new parameter is actually the size of the (Majorana) zero modes.
Hydrothermal Phase Relations Among Uranyl Minerals at the Nopal I Analog Site
International Nuclear Information System (INIS)
Murphy, William M.
2007-01-01
Uranyl mineral paragenesis at Nopal I is an analog of spent fuel alteration at Yucca Mountain. Petrographic studies suggest a variety of possible hydrothermal conditions for uranium mineralization at Nopal I. Calculated equilibrium phase relations among uranyl minerals show uranophane stability over a broad range of realistic conditions and indicate that uranyl mineral variety reflects persistent chemical potential heterogeneity. (author)
Passive remediation strategies for petroleum contaminated sites
International Nuclear Information System (INIS)
Everett, L.G.; Cullen, S.J.; Eccles, L.A.
1991-01-01
The US EPA is becoming increasingly aware of costs and the limited success of existing remediation strategies. Research teams within the US EPA believe that if passive remediation can be successfully demonstrated, it is a candidate for best available technology. Passive remediation, however, must be demonstrated through the use of monitoring techniques, which demonstrate: contaminants are not moving in the dissolved, adsorbed or free product phase; and contamination is biodegrading in-place. This paper presents a concise monitoring and analysis strategy for passive remediation. Specifically, the paper presents the accuracy, precision and operating range of neutron moderation techniques as a low cost, real-time screening tool to measure the migration of the dissolved phase in soil moisture, the stabilized adsorbed phase and free product movement. In addition, the paper identifies the capillary pressure range through which the dissolved phase will move and identifies techniques for satisfying the risk analysis that movement is not taking place. The rationale for passive remediation taking place is confirmed through a discussion of gas ratios associated with bacterial assimilation of hydrocarbons. Gas ratios which are relatively constant above ground are highly inverted in the subsurface at contamination sites. The use of frequent screening of a vertical geologic profile using least cost techniques and the infrequent analysis of soil gas ratios provides the required data upon which the public will accept passive remediation as best available technology at a particular site. The paper points out that neutron moderation is a high candidate vadose zone monitoring device and identifies alternative techniques using resistivity and dielectric constants, which are in the developmental stage. The economic implications for passive remediation are enormous relative to the excavation and remediation strategies which are currently in use
Oak Ridge Health Studies phase 1 report, Volume 1: Oak Ridge Phase 1 overview
International Nuclear Information System (INIS)
Yarbrough, M.I.; Van Cleave, M.L.; Turri, P.; Daniel, J.
1993-09-01
In July 1991, the State of Tennessee initiated the Health Studies Agreement with the United States Department of Energy to carry out independent studies of possible adverse health effects in people living in the vicinity of the Oak Ridge Reservation. The health studies focus on those effects that could have resulted or could result from exposures to chemicals and radioactivity released at the Reservation since 1942. The major focus of the first phase was to complete a Dose Reconstruction Feasibility Study. This study was designed to find out if enough data exist about chemical and radionuclide releases from the Oak Ridge Reservation to conduct a second phase. The second phase will lead to estimates of the actual amounts or the ''doses'' of various contaminants received by people as a result of off-site releases. Once the doses of various contaminants have been estimated, scientists and physicians will be better able to evaluate whether adverse health effects could have resulted from the releases
Oak Ridge Health Studies phase 1 report, Volume 1: Oak Ridge Phase 1 overview
Energy Technology Data Exchange (ETDEWEB)
Yarbrough, M.I.; Van Cleave, M.L.; Turri, P.; Daniel, J.
1993-09-01
In July 1991, the State of Tennessee initiated the Health Studies Agreement with the United States Department of Energy to carry out independent studies of possible adverse health effects in people living in the vicinity of the Oak Ridge Reservation. The health studies focus on those effects that could have resulted or could result from exposures to chemicals and radioactivity released at the Reservation since 1942. The major focus of the first phase was to complete a Dose Reconstruction Feasibility Study. This study was designed to find out if enough data exist about chemical and radionuclide releases from the Oak Ridge Reservation to conduct a second phase. The second phase will lead to estimates of the actual amounts or the ``doses`` of various contaminants received by people as a result of off-site releases. Once the doses of various contaminants have been estimated, scientists and physicians will be better able to evaluate whether adverse health effects could have resulted from the releases.
Safety aspects of geological studies around nuclear installations sites
International Nuclear Information System (INIS)
Faure, J.
1988-01-01
The experience of geological studies of about forty french nuclear sites allows to set out the objectives, the phases and the geographic extensions of workings to be realized for confirming a site. The data to be collected for the safety analysis are specified; they concern the local and regional geology, the geotechnical characteristics and the essential elements for evaluating the hazards related to the soil liquefaction, the surface fracturing and in some cases the volcanic risks. It is necessary to follow up the geology during the installation construction and life. 8 refs. (F.M.)
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-08-01
This Baseline Risk Assessment of Ground Water Contamination at the Inactive Uraniferous Lignite Ashing Site Near Belfield, North Dakota, evaluates potential impacts to public health or the environment resulting from ground water contamination at the site where coal containing uranium was burned to produce uranium. The US Department of Energy`s Uranium Mill Tailings Remedial Action (UMTRA) Project is evaluating plans to remedy soil and ground water contamination at the site. Phase I of the UMTRA Project consists of determining the extent of soil contamination. Phase II of the UMTRA Project consists of evaluating ground water contamination. Under Phase II, results of this risk assessment will help determine what remedial actions may be necessary for contaminated ground water at the site. This risk assessment evaluates the potential risks to human health and the environment resulting from exposure to contaminated ground water as it relates to historic processing activities at the site. Potential risk is quantified for constituents introduced from the processing activities, and not for those constituents naturally occurring in water quality in the site vicinity. Background ground water quality has the potential to cause adverse health effects from exposure through drinking. Any risks associated with contaminants attributable to site activities are incremental to these risks from background ground water quality. This incremental risk from site-related contaminants is quantified in this risk assessment. The baseline risk from background water quality is incorporated only into the assessment of potential chemical interactions and the definition of the overall site condition.
International Nuclear Information System (INIS)
1994-08-01
This Baseline Risk Assessment of Ground Water Contamination at the Inactive Uraniferous Lignite Ashing Site Near Belfield, North Dakota, evaluates potential impacts to public health or the environment resulting from ground water contamination at the site where coal containing uranium was burned to produce uranium. The US Department of Energy's Uranium Mill Tailings Remedial Action (UMTRA) Project is evaluating plans to remedy soil and ground water contamination at the site. Phase I of the UMTRA Project consists of determining the extent of soil contamination. Phase II of the UMTRA Project consists of evaluating ground water contamination. Under Phase II, results of this risk assessment will help determine what remedial actions may be necessary for contaminated ground water at the site. This risk assessment evaluates the potential risks to human health and the environment resulting from exposure to contaminated ground water as it relates to historic processing activities at the site. Potential risk is quantified for constituents introduced from the processing activities, and not for those constituents naturally occurring in water quality in the site vicinity. Background ground water quality has the potential to cause adverse health effects from exposure through drinking. Any risks associated with contaminants attributable to site activities are incremental to these risks from background ground water quality. This incremental risk from site-related contaminants is quantified in this risk assessment. The baseline risk from background water quality is incorporated only into the assessment of potential chemical interactions and the definition of the overall site condition
Renewing library Web sites CMS at libraries
Vida, A
2006-01-01
The use of the Internet has a ten-year history in Hungary. In the beginning, users were surfing on textual Web sites with the browser Lynx (1991), then a range of graphic browsers appeared: Mosaic (1993) , Netscape (1994), and finally Internet Explorer (1995). More and more institutions, including libraries decided to enter the World Wide Web with their own homepage. The past ten years have brought enormous changes and new requirements in the way that institutional homepages are designed. This article offers an overview of the development phases of Web sites, presents the new tools necessary for the state-of-the-art design and gives advice on their up-to-date maintenance.
Management of Decommissioning on a Multi-Facility Site
International Nuclear Information System (INIS)
Laraia, Michele; McIntyre, Peter; Visagie, Abrie
2008-01-01
The management of the decommissioning of multi-facility sites may be inadequate or inappropriate if based on approaches and strategies developed for sites consisting of only a single facility. The varied nature of activities undertaken, their interfaces and their interdependencies are likely to complicate the management of decommissioning. These issues can be exacerbated where some facilities are entering the decommissioning phase while others are still operational or even new facilities are being built. Multi-facility sites are not uncommon worldwide but perhaps insufficient attention has been paid to optimizing the overall site decommissioning in the context of the entire life cycle of facilities. Decommissioning management arrangements need to be established taking a view across the whole site. A site-wide decommissioning management system is required. This should include a project evaluation and approval process and specific arrangements to manage identified interfaces and interdependencies. A group should be created to manage decommissioning across the site, ensuring adequate and consistent practices in accordance with the management system. Decommissioning management should be aimed at the entire life cycle of facilities. In the case of multi facility sites, the process becomes more complex and decommissioning management arrangements need to be established with a view to the whole site. A site decommissioning management system, a group that is responsible for decommissioning on site, a site project evaluation and approval process and specific arrangements to manage the identified interfaces are key areas of a site decommissioning management structure that need to be addressed to ensure adequate and consistent decommissioning practices. A decommissioning strategy based on single facilities in a sequential manner is deemed inadequate
Objective assessments of longitudinal outcome in Gilles de la Tourette's syndrome.
Pappert, E J; Goetz, C G; Louis, E D; Blasucci, L; Leurgans, S
2003-10-14
To define the long-term outcome in Gilles de la Tourette syndrome (GTS) using objective rating measures. Previous historical studies suggest spontaneous improvement of tic symptoms after adolescence, but objective longitudinal data are limited. The authors reviewed all videotapes in their database (1978 through 1991) of children with GTS (ages 8 to 14) who were seen in their tertiary care movement disorder center and underwent a standardized 5-minute filming protocol (n = 56). Through multiple contact methods, they successfully located 36 of these patients, who are now adults (age >20 years), and recruited 31 (28 men and 3 women) to volunteer for a second videotape and in-person assessment. A blinded rater evaluated the 62 tapes and rated five tic domains: body areas involved, motor and phonic tic frequency, and motor and phonic tic severity. Using standardized GTS videotape rating scale and Wilcoxon signed-rank tests with Bonferroni correction for multiple comparisons, the authors compared the two videotapes for each tic domain as well as the composite tic disability score. Ninety percent of adult patients still had tics. Adult patients who considered themselves tic-free were often inaccurate in their self-assessment: 50% had objective evidence of tics. Mean objective tic disability diminished in comparison to childhood (mean composite tic disability score childhood 9.58 vs adulthood 7.52, p = 0.014). All domains improved by adulthood, and significant improvements occurred in motor tic severity (p = 0.008). The improvements in tic disability did not relate to medication use, as only 13% of adults received medications for tics, compared with 81% of children. In GTS syndrome, tics objectively improve over time but most adults have persistent tics.
Energy Technology Data Exchange (ETDEWEB)
Comings, D.E. [City of Hope Medical Center, Duarte, CA (United States)
1995-04-24
Tourette syndrome (TS) is a common, neuropsychiatric disorder which has many similarities to attention deficit hyperactivity disorder (ADHD). TS probands have a high frequency of a variety of behavioral disorders including depression. The depression may be due to a pleiotropic effect of the Gts genes, proband ascertainment bias, or a result of coping with the chronic tics. To distinguish between these hypotheses we examined the responses to 17 Diagnostic Interview Schedule questions to evaluate the 9 DSM-III-R criteria for major depressive episode in 1,080 adults consisting of TS and ADHD probands, their relatives and controls. Using a Bonferonni corrected p there was a significant progressive increase in 16 of 17 depressive symptoms and for a life time history of a major depressive episode in groups with increased genetic loading for Gts genes. Similar trends were seen in the small number of ADHD probands and their relatives. There was also a significant increase for these variables in non-proband TS relatives versus non-TS relatives, indicating the association of depression with Gts genes was not due to ascertainment bias or the inappropriate choice of controls. Multiple linear regression analysis indicated that obsessive-compulsive behaviors, sex, ADHD, drug abuse, and age all showed a more significant effect on depressive symptoms than the number of tics. The presence or absence of TS in the relatives had a much greater effect on risk for depression than the presence or absence of an episode of major depression in the proband. These results are consistent with the hypothesis that Gts and ADHD genes play a major role in depression. 69 refs., 5 tabs.