WorldWideScience

Sample records for site bor forest

  1. Impact assessment of mine drainage water and municipal wastewater on the surface water in the vicinity of Bor

    OpenAIRE

    Gardić Vojka R.; Petrović Jelena V.; Đurđevac-Ignjatović Lidija V.; Kolaković Srđan R.; Vujović Svetlana R.

    2015-01-01

    Mining and copper production in Bor, in the past hundred years, had a huge impact on the environment of town, but also in a wide region. In the area of Bor, in the zone of Mining and Smelting Company (RTB) activity, over 29,000 ha of land under forests and fields is degraded. The area of degraded agricultural land in the Bor municipality is over 60% of total agricultural land. Wastewater, generated in the sites of RTB Bor, pollute the Bor River and Krivelj ...

  2. Impact assessment of mine drainage water and municipal wastewater on the surface water in the vicinity of Bor

    Directory of Open Access Journals (Sweden)

    Gardić Vojka R.

    2015-01-01

    Full Text Available Mining and copper production in Bor, in the past hundred years, had a huge impact on the environment of town, but also in a wide region. In the area of Bor, in the zone of Mining and Smelting Company (RTB activity, over 29,000 ha of land under forests and fields is degraded. The area of degraded agricultural land in the Bor municipality is over 60% of total agricultural land. Wastewater, generated in the sites of RTB Bor, pollute the Bor River and Krivelj River, which still flow into the Timok River and Danube River. These pollutions are often presented by low pH value, increased content of heavy metal ions, suspended particles and fine particles of flotation tailings, which is deposited in the valleys of these rivers on the area of over 2000 hectares. During the decades of exploitation of ore from the open pit Bor at different locations ("Visoki Planir" - also called “Oštreljski planir”, "Severni planir" dump of ore body "H" (RTH gangue and tailings were delayed. The largest amount of tailings, about 150 million tons, was postponed on location Visoki planir. The effect of the mining waste and the impact of the whole process of processing copper ore to the final products on the environment, was conducted during the 4th study period of the project "Management of mining waste-tailing dump in the Bor region," supported by the Japan Society for the Promotion Science (Eng. Japan Society for the Promotion of Science and the Japan international cooperation Agency and the Ministry of environment, Mining and Spatial planning of the Republic of Serbia. Influence of season on the level of pollutants in soil and water, the impact on water quality in the river Timok and the River Danube, was conducted during first three periods of project. This paper presents the results of the third study period. The third period of research, which was conducted over a period of 17. 10. 2012 to 17. 01.2013 year, included a review of pollution sources and define their

  3. The choice of forest site for recreation

    DEFF Research Database (Denmark)

    Agimass, Fitalew; Lundhede, Thomas; Panduro, Toke Emil

    2018-01-01

    logit as well as a random parameter logit model. The variables that are found to affect the choice of forest site to a visit for recreation include: forest area, tree species composition, forest density, availability of historical sites, terrain difference, state ownership, and distance. Regarding......In this paper, we investigate the factors that can influence the site choice of forest recreation. Relevant attributes are identified by using spatial data analysis from a questionnaire asking people to indicate their most recent forest visits by pinpointing on a map. The main objectives...

  4. Evaluation of BOR-60 operation safety

    International Nuclear Information System (INIS)

    Minakov, A.A.; Antipin, G.K.; Efimov, V.N.; Kuzin, G.G.; Eschenko, L.V.; Eschenko, S.N.

    1987-12-01

    In this communication, BOR-60 reactor operation anomalies capable to produce a dangerous overheating of the core (SDC) is examined. On bases of calculations and reactor operation experience an event tree for SDC is built. Evaluations of probable anomalies entering in the event tree and reactor parameters modifications in case of anomalies are presented. In conclusion BOR-60 agree with the sovietic nuclear safety [fr

  5. Mechanical site preparation for forest restoration

    Science.gov (United States)

    Magnus Lof; Daniel C. Dey; Rafael M. Navarro; Douglass F. Jacobs

    2012-01-01

    Forest restoration projects have become increasingly common around the world and planting trees is almost always a key component. Low seedling survival and growth may result in restoration failures and various mechanical site preparation techniques for treatment of soils and vegetation are important tools used to help counteract this. In this article, we synthesize the...

  6. Prediction of glycosylation sites using random forests

    Directory of Open Access Journals (Sweden)

    Hirst Jonathan D

    2008-11-01

    Full Text Available Abstract Background Post translational modifications (PTMs occur in the vast majority of proteins and are essential for function. Prediction of the sequence location of PTMs enhances the functional characterisation of proteins. Glycosylation is one type of PTM, and is implicated in protein folding, transport and function. Results We use the random forest algorithm and pairwise patterns to predict glycosylation sites. We identify pairwise patterns surrounding glycosylation sites and use an odds ratio to weight their propensity of association with modified residues. Our prediction program, GPP (glycosylation prediction program, predicts glycosylation sites with an accuracy of 90.8% for Ser sites, 92.0% for Thr sites and 92.8% for Asn sites. This is significantly better than current glycosylation predictors. We use the trepan algorithm to extract a set of comprehensible rules from GPP, which provide biological insight into all three major glycosylation types. Conclusion We have created an accurate predictor of glycosylation sites and used this to extract comprehensible rules about the glycosylation process. GPP is available online at http://comp.chem.nottingham.ac.uk/glyco/.

  7. Geoecology of a forest watershed underlain by serpentine in Central Europe

    Science.gov (United States)

    Pavel Krám; Filip Oulehle; Veronika Štedrá; Jakub Hruška; James B. Shanley; Rakesh Minocha; Elena. Traister

    2009-01-01

    The geoecology of a serpentinite-dominated site in the Czech Republic was investigated by rock, soil, water, and plant analyses. The 22-ha Pluhuv Bor watershed is almost entirely forested by a nearly 110-year old plantation of Picea abies (Norway Spruce) mixed with native Pinus sylvestris (Scots Pine) in the highest elevations...

  8. Optimization of heavy metals total emission, case study: Bor (Serbia)

    Science.gov (United States)

    Ilić, Ivana; Bogdanović, Dejan; Živković, Dragana; Milošević, Novica; Todorović, Boban

    2011-07-01

    The town of Bor (Serbia) is one of the most polluted towns in southeastern Europe. The copper smelter which is situated in the centre of the town is the main pollutant, mostly because of its old technology, which leads to environmental pollution caused by higher concentrations of SO 2 and PM 10. These facts show that the word is about a very polluted region in Europe which, apart from harming human health in the region itself, poses a particular danger for wider area of southeastern Europe. Optimization of heavy metal's total emission was undertaken because years of long contamination of the soil with heavy metals of anthropogenic origin created a danger that those heavy metals may enter the food chains of animals and people, which can lead to disastrous consequences. This work represents the usage of Geographic Information System (GIS) for establishing a multifactor assessment model to quantitatively divide polluted zones and for selecting control sites in a linear programming model, combined with PROMETHEE/GAIA method, Screen View modeling system, and linear programming model. The results show that emissions at some control sites need to be cut for about 40%. In order to control the background of heavy metal pollution in Bor, the ecological environment must be improved.

  9. Possibilities of sustainable development the RTB Bor

    Directory of Open Access Journals (Sweden)

    Zeković Slavka

    2006-01-01

    Full Text Available The paper analysis the medium and long-term perspectives, framework and considered possibilities of sustainable development of RTB "Bor" in the period of transition. It is today the giant in the best quality copper production in the Balkans. In the paper are elaborated the problems of privatization, debt, investment, growth of copper production from own mines (and imported raw, opening of new mines, economical efficiency of production, environmental problems and impacts in the last time. The RTB "Bor" is a serious hot spot in Serbia. Unsustainability trends and process are identified, as follows: open-pit waste dumps, flotation tailings, mining and processing waste waters, air pollution; inefficiency useful of energy water and other inputs in copper complex; trans boundary character of emissions of dust; environmental degradation and quality of wide area and ecologically highly risk, etc.

  10. MARKETING MIX BY BED OCCUPANCY RATIO (BOR

    Directory of Open Access Journals (Sweden)

    Abdul Muhith

    2017-04-01

    Full Text Available Introduction: Bed Occupancy Ratio (BOR in RSI Arafah Mojosari during the last three years are at under ideal rate and the lowest of the three existing hospitals in the area of Mojosari. The purpose of this study was to determine the relationship marketing mix with Bed Occupancy Ratio in RSI Arafah Mojosari. Methods: This research uses analytic methods with crossectional approach. Variables in the study is marketing mix and Bed Occupancy Ratio (BOR. The population in this study were all patients hospitalized in the RSI Arafah Mojosari. Samples amounted 44 respondents taken by the Stratified random sampling technique. Data were collected using the questionnaire and analyzed using Fisher's Exact test. Result: The results obtained more than 50% of respondents (59.1% rate well against the marketing mix is developed by the hospital management and the majority of respondents (79.5% are in the treatment room that has a number BOR is not ideal. Fisher Exact test test results obtained probabililty value=0.02<0.05 so that H0 is rejected, which means there is a relationship marketing mix with the Bed Occupancy Ratio in RSI Arafah Mojosari. Discussion: Hospitals which able to develop the marketing mix very well, can attract consumers to use inpatient services at the hospital, with that BOR value will increase as the increased use of inpatient services. Hospital management must be able to formulate a good marketing mix strategy that hospital marketing objectives can be achieved. Conformity between service quality and service rates must be addressed, otherwise it extent of media promotions can attract patients to inpatient services.

  11. Vegetation diversity of the Scots pine stands in different forest sites in the Turawa Forest District

    OpenAIRE

    Stefańska-Krzaczek, Ewa; Pech, Paweł

    2014-01-01

    The utility of phytocenotic indices in the diagnosis and classification of forest sites might be limited because of vegetation degeneration in managed forests. However, even in secondary communities it may be possible to determine indicator species, although these may differ from typical and well known plant indicators. The aim of this work was to assess the vegetation diversity of Scots pine stands in representative forest site types along a moisture and fertility gradient. In total ...

  12. Information system of forest growth and productivity by site quality type and elements of forest

    Science.gov (United States)

    Khlyustov, V.

    2012-04-01

    Information system of forest growth and productivity by site quality type and elements of forest V.K. Khlustov Head of the Forestry Department of Russian State Agrarian University named after K.A.Timiryazev doctor of agricultural sciences, professor The efficiency of forest management can be improved substantially by development and introduction of principally new models of forest growth and productivity dynamics based on regionalized site specific parameters. Therefore an innovative information system was developed. It describes the current state and gives a forecast for forest stand parameters: growth, structure, commercial and biological productivity depend on type of site quality. In contrast to existing yield tables, the new system has environmental basis: site quality type. The information system contains set of multivariate statistical models and can work at the level of individual trees or at the stand level. The system provides a graphical visualization, as well as export of the emulation results. The System is able to calculate detailed description of any forest stand based on five initial indicators: site quality type, site index, stocking, composition, and tree age by elements of the forest. The results of the model run are following parameters: average diameter and height, top height, number of trees, basal area, growing stock (total, commercial with distribution by size, firewood and residuals), live biomass (stem, bark, branches, foliage). The system also provides the distribution of mentioned above forest stand parameters by tree diameter classes. To predict the future forest stand dynamics the system require in addition the time slot only. Full set of forest parameters mention above will be provided by the System. The most conservative initial parameters (site quality type and site index) can be kept in the form of geo referenced polygons. In this case the system would need only 3 dynamic initial parameters (stocking, composition and age) to

  13. 76 FR 71342 - Proposed CERCLA Administrative Cost Recovery Settlement; River Forest Dry Cleaners Site, River...

    Science.gov (United States)

    2011-11-17

    ... Settlement; River Forest Dry Cleaners Site, River Forest, Cook County, IL AGENCY: Environmental Protection... response costs concerning the River Forest Dry Cleaners site in River Forest, Cook County, Illinois with... code: C-14J, Chicago, Illinois 60604. Comments should reference the River Forest Dry Cleaners Site...

  14. Site productivity and forest carbon stocks in the United States: Analysis and implications for forest offset project planning

    Science.gov (United States)

    Coeli M. Hoover; James E. Smith

    2012-01-01

    The documented role of United States forests in sequestering carbon, the relatively low cost of forest-based mitigation, and the many co-benefits of increasing forest carbon stocks all contribute to the ongoing trend in the establishment of forest-based carbon offset projects. We present a broad analysis of forest inventory data using site quality indicators to provide...

  15. Calculated investigation of actinide transmutation in the BOR-60 reactor

    International Nuclear Information System (INIS)

    Zhemkov, I.Yu.; Ishunina, O.V.; Yakovleva, I.V.

    2000-01-01

    One of the prospective actinide burner reactor type is the fast reactor with a 'hard' spectrum and small breeding factor, which is the BOR-60. The calculated investigations demonstrate that Loading up to 40% of minor-actinides to the BOR-60 reactor did not lead to the considerable change of neutron-physical characteristics. The performed calculations show that the BOR- 60 reactor possesses a high efficiency of the minor-actinide and plutonium bum-up (up to 37 kg/(TW · h)) hat is comparable with properties of the actinide burner-reactors under design. The BOR-60 reactor can provide a homogeneous minor-actinide Loading (minor-actinide addition to the standard fuel) to the core and heterogeneous Loading (as separate assemblies-targets with a high minor-actinide fraction) to the first rows of a radial blanket that allows the optimum usage of the reactor and its characteristics. (authors)

  16. Siting wind farms in and around forests

    Energy Technology Data Exchange (ETDEWEB)

    Douglas, N. [Natural Power Consultants, Vancouver, BC (Canada)

    2010-07-01

    This PowerPoint presentation discussed methods of assessing the impact of trees on wind resources. Turbulence is generated and also absorbed by trees. Disturbances generated at tree level are then transported upwards and down-wind by the wind. The turbulence induced by trees can be felt kilometers downwind of forests at wind turbine hub heights. Wind speeds can be less than predicted, and significant over-estimations can occur with modelled results. The effects of high shear and high turbulence can also have an impact on power curve performance and lead to higher levels of mechanical stress. A SCADA analysis was used to demonstrate the impact of forests on power curves. Wind power predictions near forests can be optimized by using a full year of data capture at hub height, full rotor measurements, and a consideration of seasonal variations. Accurate tree maps are needed to determine the effects of trees on wind shear. Various forestry scenarios were modelled to demonstrate the effects of forestry management over time. tabs., figs.

  17. Necropolis on Bor lake: New reports on Bronze age burial

    Directory of Open Access Journals (Sweden)

    Kapuran Aleksandar

    2011-01-01

    Full Text Available This article deals with the social and anthropological aspects of burial rituals during the Middle Bronze Age in Timočka Krajina. Decades of systematic research of necropolises and reconnaissance in the basin of the Crni Timok proved an increase in number of sites around ore - rich areas of the east Kučaj mountains as well as around Romuliana site and the fertile valleys of Džanovo polje (Map. 1. The quantitative increase in settlements was reflected by the emergence of large necropolises, only three of which have been systematically explored; those in Trnjani, Magura and Bor Lake (Fig. 1; Plan 1. Analysis of geographical features of many settlements and their position in relation to natural resources helped define two communities, one of which carried out mining and metallurgical activities, while the other group engaged in the production of food. Both groups lived in the immediate vicinity and mutual dependence, functioning within a developed market for copper production. During the exploration of the necropolis near Bor Lake in 1997, the remains of burnt skeletons were collected from burial structures 2/97 and 13/97 (Fig. 2; Plans 2 and 3. Anthropological analysis of the cremated remains of the deceased showed that high temperatures were used during the cremation process, which we assume could have only been achieved in metallurgical furnaces. This is confirmed by the fact that the skeletal fragments contain traces of melted metal, as well as finds of bronze slag inside urns and grave structures in the necropolis in Trnjani (Figs. 3 and 4; Tables 1-4. Burial ritual of this kind was not proved by systematic archaeological research of necropolises in the basin of Crni Timok, although anthropological data collected from necropolises linked to metallurgical settlements may indicate some guidelines in the ritual cremation of prominent members of these communities. [Projekat Ministarstva nauke Republike Srbije, br. 177020: Arheologija Srbije

  18. A hypothetical severe reactor accident in Sosnovyj Bor, Russia

    International Nuclear Information System (INIS)

    Lahtinen, J.; Toivonen, H.; Poellaenen, R.; Nordlund, G.

    1993-12-01

    Individual doses and short-term radiological consequences from a hypothetical severe accident at the Russian nuclear power plant in Sosnovyj Bor were estimated for two sites in Finland. The sites are Kotka, located 140 km from the plant, and Helsinki, 220 km from the plant. The release was assumed to start immediately after the shutdown of the reactor (a 1000 MW RBMK unit) which had been operating at nominal power level for a long time. An effective release height of 500 m was assumed. The prevailing meteorological conditions during the release were taken to present the situation typical of the area (effective wind speed 9 m/s, neutral dispersion conditions). The release fractions applied in the study were of the same order as in the Chernobyl accident, i.e. 100% for noble gases, 60% for iodines, 40% for cesium and 1-10% for other radiologically important nuclides. The release was assumed to last 24 hours. However, half of the nuclides were released during the first hour. No attention was paid to the actual sequence of events that could lead to such release characteristics and time behaviour. The concentration and dose calculations were performed with a modified version of the computer code OIVA developed in Finnish Centre for Radiation and Nuclear Safety. Inhalation dose and external doses from the release plume and from the deposited activity were calculated for adults only, and no sheltering was considered. (11 refs., 4 figs., 6 tabs.)

  19. 77 FR 12002 - Mount Baker-Snoqualmie National Forest Site-Specific Invasive Plant Treatment Project and Forest...

    Science.gov (United States)

    2012-02-28

    ... Invasive Plant Treatment Project and Forest Plan Amendment Number 28 AGENCY: Forest Service, USDA. ACTION... Forest. The current Forest-wide treatment approach pre-dates the Pacific Northwest Region Invasive Plant... interdisciplinary analysis: (1) Whether or not to authorize site- specific invasive plant treatments using...

  20. Relationship Between Site Disturbance and Forest Harvesting Equipment Traffic

    Science.gov (United States)

    Tim McDonald; Emily Carter; Steve Taylor; John Tobert

    1998-01-01

    A study was done to evaluate the use of global positioning systems (GPS) to track the position of forest harvesting equipment and use the information to assess site impacts. GPS units were attached to tree-length harvesting machinery in two clearcuts (1 feller-buncher, 2 skidders). Position of the equipment was recorded at 2-second intervals throughout the harvest of...

  1. LBA-ECO CD-04 Dendrometry, km 83 Tower Site, Tapajos National Forest, Brazil

    Data.gov (United States)

    National Aeronautics and Space Administration — A dendrometry study was conducted at the logged forest tower site, km 83 site, Tapajos National Forest, Para, Brazil over a period of 4 years following the...

  2. Environmental impact of mining activity in Bor area as indicated by the distribution of heavy metals and bacterial population dynamics in sediment

    Directory of Open Access Journals (Sweden)

    Filimon M. N.

    2016-01-01

    Full Text Available The environmental impact of inorganic pollution is pronounced in water adjacent to Bor Copper Smelter Complex (RTB Bor, Serbia, with Cu, Zn, Pb, and As being the main determinants of aquatic pollution pattern. Communities of microorganisms present in the sediments are mainly affected by heavy metal pollution. Some groups of bacteria can be considered pollution bio-indicators, due to their sensibility and ability to bioaccumulate heavy metals, thus contributing to reducing pollution. This study investigates the relationships between trace element accumulation and heterogeneity in sediment bacteria community structure found in water streams adjacent to the Bor Copper Smelter Complex (RTB Bor, Serbia. Our results showed no contamination with copper, zinc, nickel, iron, and chromium, but did show a low to moderate contamination with lead and a moderate to high contamination with arsenic in aquatic sediments within the area of interest. Spatial heterogeneity in sediment-associated bacterial communities did not relate significantly to location of sampling sites, except for iron reducing bacteria. Iron reducing bacteria and nitrifying bacteria were the best distinguishing groups of bacteria. However, only iron reducing bacteria were significantly influenced by sampling locations. The iron reducing bacteria has correlated negatively with the degree of sediment contamination with lead, and therefore, we suggest that this group of bacteria could serve as potential bio-indicators of inorganic water contamination in Bor RTB area.

  3. Functional characterization of Citrus macrophylla BOR1 as a boron transporter.

    Science.gov (United States)

    Cañon, Paola; Aquea, Felipe; Rodríguez-Hoces de la Guardia, Amparo; Arce-Johnson, Patricio

    2013-11-01

    Plants have evolved to develop an efficient system of boron uptake and transport using a range of efflux carriers named BOR proteins. In this work we isolated and characterized a boron transporter of citrus (Citrus macrophylla), which was named CmBOR1 for its high homology to AtBOR1. CmBOR1 has 4403 bp and 12 exons. Its coding region has 2145 bp and encodes for a protein of 714 amino acids. CmBOR1 possesses the molecular features of BORs such as an anion exchanger domain and the presence of 10 transmembrane domains. Functional analysis in yeast indicated that CmBOR1 has an efflux boron transporter activity, and transformants have increased tolerance to excess boron. CmBOR1 is expressed in leaves, stem and flowers and shows the greatest accumulation in roots. The transcript accumulation was significantly increased under boron deficiency conditions in shoots. In contrast, the accumulation of the transcript did not change in boron toxicity conditions. Finally, we observed that constitutive expression of CmBOR1 was able to increase tolerance to boron deficiency conditions in Arabidopsis thaliana, suggesting that CmBOR1 is a xylem loading boron transporter. Based on these results, it was determined that CmBOR1 encodes a boric acid/borate transporter involved in tolerance to boron deficiency in plants. © 2013 Scandinavian Plant Physiology Society.

  4. LBA-ECO CD-04 Leaf Litter Data, km 83 Tower Site, Tapajos National Forest, Brazil

    Data.gov (United States)

    National Aeronautics and Space Administration — Above-ground litter productivity was measured in a 18 ha plot adjacent to the eddy flux tower at the logged forest tower site, km 83, Tapajos National Forest, Para,...

  5. LBA-ECO CD-04 Leaf Area Index, km 83 Tower Site, Tapajos National Forest, Brazil

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: Leaf area index was estimated in an 18 ha plot at the logged forest tower site, km 83, Tapajos National Forest, Para, Brazil. The plot was adjacent to the...

  6. LBA-ECO CD-04 Leaf Area Index, km 83 Tower Site, Tapajos National Forest, Brazil

    Data.gov (United States)

    National Aeronautics and Space Administration — Leaf area index was estimated in an 18 ha plot at the logged forest tower site, km 83, Tapajos National Forest, Para, Brazil. The plot was adjacent to the eddy flux...

  7. The influence of site factors on nitrogen mineralization in forest soils ...

    African Journals Online (AJOL)

    The influence of site factors on nitrogen mineralization in forest soils of the ... on N mineralization, as well as the effect of N mineralization on forest productivity. ... of the natural log of mean annual temperature, geological substrate and total N ...

  8. Transforming Pinus pinaster forest to recreation site: preliminary effects on LAI, some forest floor, and soil properties.

    Science.gov (United States)

    Öztürk, Melih; Bolat, İlyas

    2014-04-01

    This study investigates the effects of forest transformation into recreation site. A fragment of a Pinus pinaster plantation forest was transferred to a recreation site in the city of Bartın located close to the Black Sea coast of northwestern Turkey. During the transformation, some of the trees were selectively removed from the forest to generate more open spaces for the recreationists. As a result, Leaf Area Index (LAI) decreased by 0.20 (about 11%). Additionally, roads and pathways were introduced into the site together with some recreational equipment sealing parts of the soil surface. Consequently, forest environment was altered with a semi-natural landscape within the recreation site. The purpose of this study is to assess the effects of forest transformation into recreation site particularly in terms of the LAI parameter, forest floor, and soil properties. Preliminary monitoring results indicate that forest floor biomass is reduced by 26% in the recreation site compared to the control site. Soil temperature is increased by 15% in the recreation site where selective removal of trees expanded the gaps allowing more light transmission. On the other hand, the soil bulk density which is an indicator of soil compaction is unexpectedly slightly lower in the recreation site. Organic carbon (C(org)) and total nitrogen (N(total)) together with the other physical and chemical parameter values indicate that forest floor and soil have not been exposed to much disturbance. However, subsequent removal of trees that would threaten the vegetation, forest floor, and soil should not be allowed. The activities of the recreationists are to be concentrated on the paved spaces rather than soil surfaces. Furthermore, long-term monitoring and management is necessary for both the observation and conservation of the site.

  9. New evidence for prehistoric copper metallurgy in the vicinity of Bor

    Directory of Open Access Journals (Sweden)

    Kapuran Aleksandar

    2016-01-01

    Full Text Available The last three years of archaeological investigations at the site Ru`ana in Banjsko Polje, in the immediate vicinity of Bor, have provided new evidence regarding the role of non-ferrous metallurgy in the economy of the prehistoric communities of north-eastern Serbia. The remains of metallurgical furnaces and a large amount of metallic slags at two neighbouring sites in the mentioned settlement reveal that locations with many installations for the thermal processing of copper ore existed in the Bronze Age. We believe, judging by the finds of material culture, that metallurgical activities in this area also continued into the Iron Age and, possibly, into the 4th century AD. [Projekat Ministarstva nauke Republike Srbije, br. 177020: Archaeology of Serbia: Cultural identity, integration factors, technological processes and the role of the central Balkans in the development of European prehistory

  10. LBA-ECO CD-10 Temperature Profiles at km 67 Tower Site, Tapajos National Forest

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains a single text file which reports temperature measurements at the Para Western (Santarem) - km 67, Primary Forest Tower Site. This site is in...

  11. Shear Punch Testing of BOR-60 Irradiated TEM Specimens

    Energy Technology Data Exchange (ETDEWEB)

    Saleh, Tarik A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Quintana, Matthew Estevan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Romero, Tobias J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-06-13

    As a part of the project “High Fidelity Ion Beam Simulation of High Dose Neutron Irradiation” an Integrated Research Program (IRP) project from the U.S. Department of Energy, Nuclear Energy University Programs (NEUP), TEM geometry samples of ferritic cladding alloys, Ni based super alloys and model alloys were irradiated in the BOR-60 reactor to ~16 dpa at ~370°C and ~400°C. Samples were sent to Los Alamos National Laboratory and subjected to shear punch testing. This report presents the results from this testing.

  12. Acoustic monitoring of the BOR-60 reactor circulating pump state

    International Nuclear Information System (INIS)

    Efimov, V.N.; Myntsov, A.A.

    1988-01-01

    Diagnostics methods for circulation pumps of the experimental BOR-60 fast reactor are described. The results of signal processing during a microcompain, as well as detected anomalies in pump operation in the earth stage are presented. Analysis carried out for an acoustic signal envelope has shown high efficiency of the method. When oscillations of a mechanical shaft are present, the envelope level increases 1.5 times. More detailed investigation is carried out by the analysis of the spectrum of the pump acoustic signal envelope. During abnormal operation there are peaks, corresponding to the circulation frequency, and harmonics multiple of it, in the spectrum. 6 figs

  13. Bulgarian Rila mountain forest ecosystems study site: site description and SO42-, NO3- deposition

    Science.gov (United States)

    Karl Zeller; Christo Bojinov; Evgeny Donev; Nedialko Nikolov

    1998-01-01

    Bulgaria's forest ecosystems (31 percent of the country's area) are considered vulnerable to dry and wet pollution deposition. Coniferous forests that cover one-third of the total forest land are particularly sensitive to pollution loads. The USDA Forest Service, Sofia University, and the Bulgarian Forest Research Institute (FRI) established a cooperative...

  14. İçme ve sulama sularında bor kirliliği ve bor giderme yöntemleri

    Directory of Open Access Journals (Sweden)

    Meltem Bilici Başkan

    2014-03-01

    Full Text Available Periyodik cetvelin 3A grubunda yer alan bor yüksek iyonlaşma potansiyeline sahip olması nedeniyle yarı metal olarak kabul edilir. Yerkabuğundaki ortalama bor konsantrasyonu 10 mg/kg'dır. Bor doğada Ca, Na ve Mg'un tuzları şeklinde bulunur. Yüksek konsantrasyonlarda ve ekonomik boyutlardaki bor yatakları; borun oksijen ile bağlanmış bileşikleri şeklinde daha çok Türkiye ve ABD'nin kurak, volkanik ve hidrotermal aktivitesi olan bölgelerinde bulunmaktadır. Bor, bitkiler için gerekli bir mikro besin elementi olmanın yanı sıra, gerekli tüm besin elementleri içerisinde, eksiklik belirtilerine neden olan miktarı ile toksik etki yapan miktarı, birbirine çok yakın olan tek elementtir. Bor su ortamında genellikle borik asit ve kısmen de borat tuzları formlarında bulunmaktadır. Pek çok endüstride kullanım alanı bulan bor bileşiklerinin endüstriyel gelişmelere bağlı olarak yüzeysel sularda bulunan konsantrasyonu artış göstermektedir. Yüzeysel sularda bulunan bor aynı zamanda evsel atıksulardan da kaynaklanmaktadır. Türkiye'de içme ve sulama sularını en çok kirleten toksik elementlerin başında bor gelmektedir. Bu nedenle bor giderimi hem insan sağlığı açısından hem de sağlıklı tarım ürünü yetiştirilebilmesi açısından oldukça önemlidir. Sulardan bor giderimi için uygulanan temel yöntemler arasında iyon değişimi, ultrafiltrasyon, ters osmoz ve adsorbsiyon gelmektedir.

  15. Urban Forest and Rural Cities: Multi-sited Households, Consumption Patterns, and Forest Resources in Amazonia

    Directory of Open Access Journals (Sweden)

    Christine Padoch

    2008-12-01

    Full Text Available In much of the Amazon Basin, approximately 70% of the population lives in urban areas and urbanward migration continues. Based on data collected over more than a decade in two long-settled regions of Amazonia, we find that rural-urban migration in the region is an extended and complex process. Like recent rural-urban migrants worldwide, Amazonian migrants, although they may be counted as urban residents, are often not absent from rural areas but remain members of multi-sited households and continue to participate in rural-urban networks and in rural land-use decisions. Our research indicates that, despite their general poverty, these migrants have affected urban markets for both food and construction materials. We present two cases: that of açaí palm fruit in the estuary of the Amazon and of cheap construction timbers in the Peruvian Amazon. We find that many new Amazonian rural-urban migrants have maintained some important rural patterns of both consumption and knowledge. Through their consumer behavior, they are affecting the areal extent of forests; in the two floodplain regions discussed, tree cover is increasing. We also find changes in forest composition, reflecting the persistence of rural consumption patterns in cities resulting in increased demand for and production of açaí and cheap timber species.

  16. Energy partitioning at treeline forest and tundra sites and its sensitivity to climate change

    Energy Technology Data Exchange (ETDEWEB)

    Lafleur, P.M. [Trent Univ., Peterborough, ON (Canada); Rouse, W.R. [McMaster Univ., Hamilton, ON (Canada)

    1995-12-31

    A study was conducted to examine the inter-annual variability in energy fluxes of treeline tundra and forest and to investigate the sensitivity of forest and tundra energy balances to climatic changes. A five year record of energy balance data from contiguous wetland tundra and subarctic forest sites near Churchill, Manitoba was analyzed. The data included snow free periods only. Wind direction was used as an analogue for changing climatic conditions where onshore winds are cooler and moister than offshore winds. Sensible and latent heat fluxes at both sites varied significantly between onshore and offshore wind regimes. The differences between onshore and offshore fluxes at the tundra site were larger than for the forest. The tundra-to-forest Bowen ratios decreased with increasing vapour pressure deficit and increasing air temperature. Results suggest that energy partitioning in the wetland tundra is more sensitive to climate change than in the treeline forests. 22 refs., 1 tab., 6 figs.

  17. Assessing the Sensitivity of Mountain Forests to Site Degradation in the Northern Limestone Alps, Europe

    Directory of Open Access Journals (Sweden)

    Birgit Reger

    2015-05-01

    Full Text Available Because of some land-use practices (such as overstocking with wild ungulates, historical clear-cuts for mining, and locally persisting forest pasture, protective forests in the montane vegetation belt of the Northern Limestone Alps are now frequently overaged and poorly structured over large areas. Windthrow and bark beetle infestations have generated disturbance areas in which forests have lost their protective functions. Where unfavorable site conditions hamper regeneration for decades, severe soil loss may ensue. To help prioritize management interventions, we developed a geographic information system-based model for assessing sensitivity to site degradation and applied it to 4 test areas in the Northern Limestone Alps of Austria and Bavaria. The model consists of (1 analysis of site conditions and forest stand structures that could increase sensitivity to degradation, (2 evaluation of the sensitivity of sites and stands, and (3 evaluation and mapping of mountain forests' sensitivity to degradation. Site conditions were modeled using regression algorithms with data on site parameters from pointwise soil and vegetation surveys as responses and areawide geodata on climate, relief, and substrate as predictors. The resulting predictor–response relationships were applied to test areas. Stand structure was detected from airborne laser scanning data. Site and stand parameters were evaluated according to their sensitivity to site degradation. Sensitivities of sites and stands were summarized in intermediate-scale sensitivity maps. High sensitivity was identified in 3 test areas with pure limestone and dolomite as the prevailing sensitivity level. Moderately sensitive forests dominate in the final test area, Grünstein, where the bedrock in some strata contains larger amounts of siliceous components (marl, mudstone, and moraines; degraded and slightly sensitive forests were rare or nonexistent in all 4 test areas. Providing a comprehensive overview

  18. LBA-ECO CD-10 Forest Litter Data for km 67 Tower Site, Tapajos National Forest

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains a single text file which reports litter type and mass in the old-growth upland forest at the Para Western (Santarem) - km 67, Primary Forest...

  19. Site-occupany of bats in relation to forested corridors

    Science.gov (United States)

    Chris D Hein; Steven B Castleberry; Karl V. Miller

    2009-01-01

    Although use of corridors by some wildlife species has been extensively examined, use by bats is poorly understood. From 1 June to 31 August (2004~200S), we used Anabat II detectors to examine bat activity and species occupancy relative to forested corridors on an intensively managed forest landscape in southern South Carolina, USA. We...

  20. Surveying marbled murrelets at inland forested sites: a guide

    Science.gov (United States)

    Peter W.C. Paton; C. John Ralph; Harry R. Carter; S. Kim Nelson

    1990-01-01

    The marbled murrelet (Brachyramphus marmoratus), a seabird, nests in forested stands from southeast Alaska south to Santa Cruz, California. Because of this species' close association with old-growth forests, researchers and land managers need a method to assess murrelet distribution and use patterns throughout its range. This guide describes a...

  1. VARIABILITY IN NET PRIMARY PRODUCTION AND CARBON STORAGE IN BIOMASS ACROSS OREGON FORESTS - AN ASSESSMENT INTEGRATING DATA FROM FOREST INVENTORIES, INTENSIVE SITES, AND REMOTE SENSING. (R828309)

    Science.gov (United States)

    We used a combination of data from USDA Forest Service inventories, intensivechronosequences, extensive sites, and satellite remote sensing, to estimate biomassand net primary production (NPP) for the forested region of western Oregon. Thestudy area was divided int...

  2. Forest meteorology research within the Oak Ridge site, eastern deciduous forest biome, USIBP

    International Nuclear Information System (INIS)

    Hutchison, B.A.; Matt, D.R.

    1977-01-01

    The data presented here indicate that the diurnal trends in forest microclimate are dominated by the diurnal trend in incident solar radiation amounts and the diurnal changes in solar elevations. Absolute values of these microclimatic variables, on the other hand, reflect strongly, the synoptic climatic conditions present and, to a lesser degree, the interactions among synoptic climatic parameters, forest structure, forest physiology, and soil moisture conditions. The seasonal changes in forest microclimate are the result of changes in incident radiation amounts, earth-sun geometry, and phenological change in forest structure along with seasonal changes in synoptic climatic parameters. The temporal and spatial variations of solar radiation within and above a deciduous forest composed predominately of tulip poplar (biriodendron tulipifera) were documented and on attempt was made to relate the variations to forest structure

  3. Linking climate, gross primary productivity, and site index across forests of the western United States

    Science.gov (United States)

    Aaron R. Weiskittel; Nicholas L. Crookston; Philip J. Radtke

    2011-01-01

    Assessing forest productivity is important for developing effective management regimes and predicting future growth. Despite some important limitations, the most common means for quantifying forest stand-level potential productivity is site index (SI). Another measure of productivity is gross primary production (GPP). In this paper, SI is compared with GPP estimates...

  4. Evidence that soil aluminum enforces site fidelity of southern New England forest trees

    Science.gov (United States)

    S. W. Bigelow; C. D. Canham

    2010-01-01

    Tree species composition of hardwood forests of the northeastern United States corresponds with soil chemistry, and differential performance along soil calcium (Ca) gradients has been proposed as a mechanism for enforcing this fidelity of species to site. We conducted studies in a southern New England forest to test if surface-soil Ca is more important than other...

  5. 77 FR 4559 - Ecusta Mill Site, Pisgah Forest, Transylvania County, NC; Notice of Amended Settlement

    Science.gov (United States)

    2012-01-30

    ... ENVIRONMENTAL PROTECTION AGENCY [EPA-R4-SFUND 2012-; FRL-9624-1] Ecusta Mill Site, Pisgah Forest... settlement for resolution of past response and future costs concerning the Ecusta Mill Superfund Site located... settlement are available from Ms. Paula V. Painter. Submit your comments by Site name Ecusta Mill Superfund...

  6. LBA-ECO CD-04 Meteorological and Flux Data, km 83 Tower Site, Tapajos National Forest

    Data.gov (United States)

    National Aeronautics and Space Administration — Tower flux measurements of carbon dioxide,water vapor, heat, and meteorological variables were obtained at the Tapajos National Forest, km 83 site, Santarem, Para,...

  7. LBA-ECO CD-04 Leaf Litter Data, km 83 Tower Site, Tapajos National Forest, Brazil

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: Above-ground litter productivity was measured in a 18 ha plot adjacent to the eddy flux tower at the logged forest tower site, km 83, Tapajos National...

  8. LBA-ECO CD-10 Temperature Profiles at km 67 Tower Site, Tapajos National Forest

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: This data set contains a single text file which reports temperature measurements at the Para Western (Santarem) - km 67, Primary Forest Tower Site. This...

  9. Developing methodology for description of biosphere evolution at Olkiluoto disposal site utilising forest studies at other land uplift sites

    International Nuclear Information System (INIS)

    Ikondn, A.T.K.; Afo, L.

    2004-01-01

    In Finland, Olkiluoto Island has been selected as the site for final disposal of spent nuclear fuel, in addition to the existing repository for low and intermediate level waste. When creating biosphere models for safety assessments, local main features and processes need to be taken into account. A special characteristic of the site, as well as the coastal area of the Gulf of Bothnia in general, is the land uplift (6-9 mm/a). This continuously exposes new land to soil-formation processes and provides surfaces for colonization by plant communities. The forest vegetation succession on stony, fine-grained till soils starts from deciduous shoreline vegetation and ends in almost pure Norway spruce forests. This has enabled to study ecological and microbiological processes in soils and forests of different developmental stages, to monitor forest condition and the factors affecting it in sites locating close to each other. It has also made possible gradient studies of the succession of boreal mire ecosystems without a need to wait thousands of years. Applying a methodology described in the full paper, a descriptive model on the evolution of the biosphere will be established to indicate possible ecosystem distributions and main characteristics on the area on the basis of above-mentioned studies carried out by Finnish Forest Research Institute, and of results of the site investigations at Olkiluoto. In future, the evolution description will be used as a basis for selection of appropriate ecosystem modules and parameter values in the subsequent coupled assessment model systems. (author)

  10. Monitoring air quality with lichens: A comparison between mapping in forest sites and in open areas

    International Nuclear Information System (INIS)

    Policnik, Helena; Simoncic, Primoz; Batic, Franc

    2008-01-01

    Four different methods of epiphytic lichen mapping were used for the assessment of air quality in the region under the influence of the Sostanj Thermal Power Plant (Salek Valley, Slovenia). Three methods were based on the presence of different lichen species (VDI, EU and ICP-Forest), the fourth on a frequency and coverage assessment of different growth forms of epiphytic lichens, e.g. crustose, foliose and fruticose (SI). A comparison of the results from the assessment of air quality between forest sites (ICP-Forest, SI) and open areas (VDI, EU and SI), obtained by the different methods of epiphytic lichen mapping, is presented in the contribution. Data showed that lichen species richness is worse in forest sites in comparison with open areas. From the data obtained it can be concluded that epiphytic lichen mapping in open areas is a better method for the assessment of air pollution in a given area than mapping in forest sites. The species-based methods in open areas are more powerful and useful for air quality assessment in polluted research areas than the SI and ICP-Forest methods. - The mapping of epiphytic lichens in open areas is more suitable for air quality assessment than mapping in forest sites in the Salek Valley, Slovenia

  11. When the shifting agriculture is gone: functionality of Atlantic Coastal Forest in abandoned farming sites

    Directory of Open Access Journals (Sweden)

    Rogério Ribeiro de Oliveira

    Full Text Available Slash-and-burn agriculture has been practiced for a very long time by the traditional populations (caiçaras on Ilha Grande, Rio de Janeiro State, Brazil. After a few years of use the plots are abandoned to fallow. We examined the processes of litter production and decomposition and the relationships between forest lands used by caiçara populations and landscape functionality. Five and 25-year-old forests growing on areas once used for subsistence agriculture were compared to a near-climax forest site. No significant differences between the three areas were noted in terms of litter production over a 2-yr period; the average litter productions were 9,927, 8,707 and 10,031 kg/ha/yr for the 5-year, 25-year and climax forests respectively. N and K nutrient input through litter was greatest in the climax forest; P and Mg input was greatest in the 5-yr forest; and Na greatest in the 25-yr forest. Ground litter accumulation (3,040-3,730 kg/ha/yr was not significantly different in the three areas. Litter turnover times (1/K were 0.33, 0.42 and 0.38 for the 5-yr, 25-yr and climax forests respectively. These secondary forests cover almost all of Ilha Grande and demonstrate low species diversity, but they have production and decomposition systems similar to those of mature forests.

  12. One-Step Leapfrog LOD-BOR-FDTD Algorithm with CPML Implementation

    Directory of Open Access Journals (Sweden)

    Yi-Gang Wang

    2016-01-01

    Full Text Available An unconditionally stable one-step leapfrog locally one-dimensional finite-difference time-domain (LOD-FDTD algorithm towards body of revolution (BOR is presented. The equations of the proposed algorithm are obtained by the algebraic manipulation of those used in the conventional LOD-BOR-FDTD algorithm. The equations for z-direction electric and magnetic fields in the proposed algorithm should be treated specially. The new algorithm obtains a higher computational efficiency while preserving the properties of the conventional LOD-BOR-FDTD algorithm. Moreover, the convolutional perfectly matched layer (CPML is introduced into the one-step leapfrog LOD-BOR-FDTD algorithm. The equation of the one-step leapfrog CPML is concise. Numerical results show that its reflection error is small. It can be concluded that the similar CPML scheme can also be easily applied to the one-step leapfrog LOD-FDTD algorithm in the Cartesian coordinate system.

  13. Eogenetic caves in conglomerate: an example from Udin Boršt, Slovenia

    Directory of Open Access Journals (Sweden)

    Lipar Matej

    2011-01-01

    Full Text Available Udin Boršt is a karstified terrace of carbonate rock, which is of fluvioglacial origin, and is situated in the north-western part of Slovenia. There are 15 registered caves, which have been interpreted as caves in conglomerate, while karst of Udin Boršt itself was interpreted as conglomerate karst, shallow karst or isolated karst. In this article, caves in Udin Boršt have been interpreted as eogenetic caves. Based on porosity and bedding material, different types of caves and cave passages have developed. Four general types of eogenetic caves found in Udin Boršt are; linear stream caves, shelter caves, breakdown caves and vadose shafts.

  14. 76 FR 18713 - Malheur National Forest; Oregon; Malheur National Forest Site-Specific Invasive Plants Treatment...

    Science.gov (United States)

    2011-04-05

    ... species that currently are not found on the Forest. Treatment could be anywhere on Forest Service system.... Electronic comments in acceptable plain text (.txt), rich text (.rtf), or Word (.doc) may be submitted to... wildlife habitat, out-compete native plants, impair water quality and watershed health, and adversely...

  15. Cosmic-ray neutron transport at a forest field site

    DEFF Research Database (Denmark)

    Andreasen, Mie; Jensen, Karsten Høgh; Desilets, Darin

    2017-01-01

    -ray neutron intensity is essential (e.g., the effect of vegetation, litter layer and soil type). In this study the environmental effect is examined by performing a sensitivity analysis using neutron transport modeling. We use a neutron transport model with various representations of the forest and different...

  16. Deposition of nitrogen oxides and ozone to Danish forest sites

    DEFF Research Database (Denmark)

    Pilegaard, K.; Jensen, N.O.; Hummelshøj, P.

    1995-01-01

    of the influence of meteorological factors. The viscous sub-layer resistance is derived by a new theory, taking the bluff roughness elements of the forest and the dimension of the needles/leaves as well as the LAI into account. The fluxes of nitrogen dioxide and ozone are related to the fluxes of water vapour...

  17. LBA-ECO CD-10 Forest Litter Data for km 67 Tower Site, Tapajos National Forest

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: This data set contains a single text file which reports litter type and mass in the old-growth upland forest at the Para Western (Santarem) - km 67,...

  18. Integrating conservation objectives into forest management: coppice management and forest habitats in Natura 2000 sites

    Czech Academy of Sciences Publication Activity Database

    Mairota, P.; Buckley, P.; Suchomel, C.; Heinsoo, K.; Verheyen, K.; Hédl, Radim; Terzuolo, P. G.; Sindaco, R.; Carpanelli, A.

    2016-01-01

    Roč. 9, AUG 2016 (2016), s. 560-568 ISSN 1971-7458 Institutional support: RVO:67985939 Keywords : biodiversity * habitats directive * forest habitat types Subject RIV: GK - Forestry Impact factor: 1.623, year: 2016

  19. Fidelity of bats to forest sites revealed from mist-netting recaptures

    Science.gov (United States)

    Roger W. Perry

    2011-01-01

    Although site fidelity to permanent roost structures by bats is generally known, long-term fidelity to areas such as foraging or drinking sites is unknown. Furthermore, mist-net recaptures of bats over multiple years are rarely reported. Extensive mist-net surveys were conducted over the course of 8 y in the Ouachita National Forest of central Arkansas, United States...

  20. Sugar maple: abundance and site relationships in the pre- and post- settlement forest

    Science.gov (United States)

    Gordon G. Whitney

    1999-01-01

    A review of the available historical evidence provides a picture of sugar maple's site relationstiips in the presettlement forest and its changing statis over the last 300 years. Sugar maple was widely distributed throughout the Northeast during the presettlerment period. it was particularly abundant on the richer, better drained, silt-rich sites. A comparison of...

  1. Summer droughts limit tree growth across 10 temperate species on a productive forest site

    NARCIS (Netherlands)

    Weemstra, M.; Eilmann, B.; Sass-Klaassen, U.; Sterck, F.J.

    2013-01-01

    Studies on climate impacts on tree annual growth are mainly restricted to marginal sites. To date, the climate effects on annual growth of trees in favorable environments remain therefore unclear despite the importance of these sites in terms of forest productivity. Because species respond

  2. Occurrence and formation of chloroform at Danish forest sites

    DEFF Research Database (Denmark)

    Haselmann, K.F.; Ketola, R.A.; Laturnus, F.

    2000-01-01

    the initial soil air concentration after 38 h, while the concentrations of the other volatile chlorinated compounds investigated remained fairly constant. The observed chloroform concentration profiles and release rates may indicate a biogenic formation of chloroform in the upper soil layer of spruce forests...... of the annual anthropogenic chloroform emissions, and, therefore, the terrestrial environment can be considered as an important contributor to the atmospheric chloroform input. (C) 1999 Elsevier Science Ltd. All rights reserved....

  3. Evaluating leaf litter beetle data sampled by Winkler extraction from Atlantic forest sites in southern Brazil

    Directory of Open Access Journals (Sweden)

    Philipp Werner Hopp

    2011-06-01

    Full Text Available Evaluating leaf litter beetle data sampled by Winkler extraction from Atlantic forest sites in southern Brazil. To evaluate the reliability of data obtained by Winkler extraction in Atlantic forest sites in southern Brazil, we studied litter beetle assemblages in secondary forests (5 to 55 years after abandonment and old-growth forests at two seasonally different points in time. For all regeneration stages, species density and abundance were lower in April compared to August; but, assemblage composition of the corresponding forest stages was similar in both months. We suggest that sampling of small litter inhabiting beetles at different points in time using the Winkler technique reveals identical ecological patterns, which are more likely to be influenced by sample incompleteness than by differences in their assemblage composition. A strong relationship between litter quantity and beetle occurrences indicates the importance of this variable for the temporal species density pattern. Additionally, the sampled beetle material was compared with beetle data obtained with pitfall traps in one old-growth forest. Over 60% of the focal species captured with pitfall traps were also sampled by Winkler extraction in different forest stages. Few beetles with a body size too large to be sampled by Winkler extraction were only sampled with pitfall traps. This indicates that the local litter beetle fauna is dominated by small species. Hence, being aware of the exclusion of large beetles and beetle species occurring during the wet season, the Winkler method reveals a reliable picture of the local leaf litter beetle community.

  4. Validation of 3D-CMCC Forest Ecosystem Model (v.5.1) against eddy covariance data for 10 European forest sites

    DEFF Research Database (Denmark)

    Collalti, A.; Marconi, S.; Ibrom, Andreas

    2016-01-01

    This study evaluates the performances of the new version (v.5.1) of 3D-CMCC Forest Ecosystem Model (FEM) in simulating gross primary productivity (GPP), against eddy covariance GPP data for 10 FLUXNET forest sites across Europe. A new carbon allocation module, coupled with new both phenological...... over Europe without a site-related calibration, the model has been deliberately parametrized with a single set of species-specific parametrizations for each forest ecosystem. The model consistently reproduces both in timing and in magnitude daily and monthly GPP variability across all sites...... sites we evaluate whether a more accurate representation of forest structural characteristics (i.e. cohorts, forest layers) and species composition can improve model results. In two of the three sites results reveal that model slightly increases its performances although, statistically speaking...

  5. Site quality influence over understory plant diversity in old-growth and harvested Nothofagus pumilio forests

    Directory of Open Access Journals (Sweden)

    E. A. Gallo

    2013-04-01

    Full Text Available Aim of study: The effects and interactions of shelterwood forest harvesting and site qualities over understory plant species diversity and composition were compared among primary and harvested Nothofagus pumilio forests.Area of study: Tierra del Fuego (Argentina, on three pure conditions (one and six year-old harvested, and primary without previous harvesting forests and three site qualities (high, medium and low.Material and Methods: Understory richness and cover (% were registered in five replicates of 1 hectare each per treatment. Taxonomic species were classified in categories (groups, origin and life forms. Two-way ANOVAs and multivariate analyses were conducted.Main results: Shelterwood harvesting and site quality significantly influenced understory cover and richness, which allow the introduction of native and exotic species and increasing of dicot and monocot covers. In dicots, monocots, exotics and total groups, higher richness and covers were related to time. Meanwhile, cover reached similar high values in all site qualities on dicot, native and total groups. On the other hand, monocot and exotic richness and cover remain similar in primary and recently harvested forests, and greatly increased in old harvested forests. Mosses and ferns were among the most sensitive groups.Research highlights: Impacts of shelterwood cut depend on site quality of the stands and time since harvesting occurs. For this, different site quality stands should received differential attention in the development of conservation strategies, as well as variations in the shelterwood implementation (as irregularity and patchiness should be considered to better promote understory plant species conservation inside managed areas.Key words: plant species conservation; years after harvesting; forest management; Tierra del Fuego.

  6. Soil microbial diversity, site conditions, shelter forest land, saline water drip-irrigation, drift desert.

    Science.gov (United States)

    Jin, Zhengzhong; Lei, Jiaqiang; Li, Shengyu; Xu, Xinwen

    2013-10-01

    Soil microbes in forest land are crucial to soil development in extreme areas. In this study, methods of conventional culture, PLFA and PCR-DGGE were utilized to analyze soil microbial quantity, fatty acids and microbial DNA segments of soils subjected to different site conditions in the Tarim Desert Highway forest land. The main results were as follows: the soil microbial amount, diversity indexes of fatty acid and DNA segment differed significantly among sites with different conditions (F 84%), followed by actinomycetes and then fungi (<0.05%). Vertical differences in the soil microbial diversity were insignificant at 0-35 cm. Correlation analysis indicated that the forest trees grew better as the soil microbial diversity index increased. Therefore, construction of the Tarim Desert Highway shelter-forest promoted soil biological development; however, for enhancing sand control efficiency and promoting sand development, we should consider the effects of site condition in the construction and regeneration of shelter-forest ecological projects. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  7. Accident hazard evaluation and control decisions on forested recreation sites

    Science.gov (United States)

    Lee A. Paine

    1971-01-01

    Accident hazard associated with trees on recreation sites is inherently concerned with probabilities. The major factors include the probabilities of mechanical failure and of target impact if failure occurs, the damage potential of the failure, and the target value. Hazard may be evaluated as the product of these factors; i.e., expected loss during the current...

  8. Evolutionary divergence of plant borate exporters and critical amino acid residues for the polar localization and boron-dependent vacuolar sorting of AtBOR1

    KAUST Repository

    Wakuta, Shinji; Mineta, Katsuhiko; Amano, Taro; Toyoda, Atsushi; Fujiwara, Toru; Naito, Satoshi; Takano, Junpei

    2015-01-01

    Boron (B) is an essential micronutrient for plants but is toxic when accumulated in excess. The plant BOR family encodes plasma membrane-localized borate exporters (BORs) that control translocation and homeostasis of B under a wide range

  9. Preliminary analysis of levels of arsenic and other metalic elements in PM10 sampled near Copper Smelter Bor (Serbia

    Directory of Open Access Journals (Sweden)

    Renata Kovačević

    2010-09-01

    Full Text Available In this paper, the levels of twenty one elements (Ag, Al, As, B, Ba, Ca, Cd, Cr, Cu, Fe, K, Mg, Mn, Mo, Na, Ni, Pb, S, Se, Sr and Zn in PM10 are presented, as well as SO2 concentration, measured at the sampling site in an urban area of the town of Bor (40,000 inhabitants in eastern Serbia. The sampling site was located in a densely populated city center about 0.65 km away from one of the largest copper mines and copper smelters in Europe. For the first time PM10 was collected using the European standard sampler, during a preliminary campaign in duration of 7 days in early spring 2009. PM10 were sampled on PTFE membrane filters and element concentrations were quantified by GF AAS and ICP AES. Concentration levels and correlations within trace elements, PM10 and SO2 indicated that industrial activities underpinned with meteorological conditions of low wind speed (calm are the main factors that influence air pollution in a densely populated area. It was evident that both PM10 mass concentration and SO2 concentration once exceeded the daily limit values during a measuring period of seven days. Strong relationship was found between PM10 and Mn, Mg, Ca and B daily average concentrations. On the other hand, SO2 correlated strongly with As, Pb, Cd, Cu and S daily average concentrations. These results confirm the relationship between emissions of SO2 from the Copper Smelter Bor and calm meteorological conditions (wind speed less than 0.5 m/sec with the concentration levels of carcinogenic substances of arsenic, lead and cadmium in ambient air.

  10. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz

    2013-01-01

    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  11. IUFRO Symposium on forest site and continuous productivity: Seattle, Washington, August 22-28, 1982.

    Science.gov (United States)

    Russell Ballard; Stanley P. Gessel

    1983-01-01

    This Symposium was planned by members of the IUFRO Site Group (S1.02) as part of their on-going activities to facilitate the worldwide exchange of ideas among individual research workers and to promote the dissemination of research results in the area of forest site productivity. The Symposium consisted of three days of indoor sessions followed by a 2-1/2-day field...

  12. Towards understanding household-level forest reliance in Cambodia - study sites, methods, and preliminary findings

    DEFF Research Database (Denmark)

    Ra, Koy; Pichdara, Lonn; Dararath, Yem

    There is growing international interest in the role of forests in poverty prevention and reduction. In consequence, this broad area of investigation has been subject to increased research; one major international research project is that facilitated by the Poverty Environment Network (PEN). This ......). This project covers a large number of sites in 26 countries throughout the tropics. The present report contains contextual details, methodological information and preliminary findings for the PEN sites in Cambodia....

  13. Use of Municipal Sewage Sludge for Improvement of Forest Sites in the Southeast

    Science.gov (United States)

    Charles R. Berry

    1987-01-01

    In eight field experiments dried municipal sewage sludge was applied to forest sites before planting of seedlings. In all cases, tree growth was faster on sludge-amended plots than on plots that received fertilizer and lime or no amendment. Deep subsoiling was beneficial regardless of Soil amendment. Where weeds were plentiful at the outset, they became serious...

  14. Observation and Analysis of Particle Nucleation at a Forest Site in Southeastern US

    Science.gov (United States)

    This study examines the characteristics of new particle formation at a forest site in the Southeast U.S. Particle size distributions above a Loblolly pine plantation were measured between November, 2005 and September, 2007 and analyzed by event type and frequency as well as relat...

  15. Application of two forest succession models at sites in Northeast Germany

    International Nuclear Information System (INIS)

    Lasch, P.; Lindner, M.

    1995-06-01

    In order to simulate potential impacts of climate change on forests, two succession models were applied to sites in the Northeast German lowlands. The models, which had been developed for Alpine (FORECE) and Boreal (FORSKA) forests differ from each other in the way they represent tree growth processes and the impact of environmental factors on establishment and growth. Both models were adjusted and compared with each other at sites that are situated along an ecological gradient from maritime to subcontinental climate. These sites are extending the former environmental space of model application towards water limited conditions, which under a predicted climatic change may have increasing importance for European forests. First results showed that FORECE was unrealistically sensitive to changes in soil moisture. On the other hand, FORSKA generally simulated very low biomasses. Since the structure of FORSKA seemed to be better suited for the simulation of changing environmental conditions, this model was chosen for further model development, applications and sensitivity analyses. Among other changes, establishment rates were increased and some environmental response factors were analysed. The function of account for resource depletion was modified. After the modifications for Central European conditions were made, there was a decrease in performance for the Boreal site. Both simulated total biomasses and species composition had changed. We conclude, that with currently available models, realistic forest dynamics within different climatic zones of Europe cannot be simulated without more substantial model modifications. (orig.)

  16. Organic Matter Decomposition following Harvesting and Site Preparation of a Forested Wetland

    Science.gov (United States)

    Carl C. Trettin; M. Davidian; M.F. Jurgensen; R. Lea

    1996-01-01

    Organic matter accumulation is an important process that affects ecosystem function in many northern wetlands. The cotton strip assay (CSA)was used to measure the effect of harvesting and two different site preparation treatments, bedding and trenching, on organic matter decomposition in a forested wetland. A Latin square experimental design was used to determine the...

  17. Estimating actual evapotranspiration for forested sites: modifications to the Thornthwaite Model

    Science.gov (United States)

    Randall K. Kolka; Ann T. Wolf

    1998-01-01

    A previously coded version of the Thornthwaite water balance model was used to estimate annual actual evapotranspiration (AET) for 29 forested sites between 1900 and 1993 in the Upper Great Lakes area. Approximately 8 percent of the data sets calculated AET in error. Errors were detected in months when estimated AET was greater than potential evapotranspiration. Annual...

  18. Foliar and soil chemistry at red spruce sites in the Monongahela National Forest

    Science.gov (United States)

    Stephanie J. Connolly

    2010-01-01

    In 2005, soil and foliar chemistry were sampled from 10 sites in the Monongahela National Forest which support red spruce. Soils were sampled from hand-dug pits, by horizon, from the O-horizon to bedrock or 152 cm, and each pit was described fully. Replicate, archived samples also were collected.

  19. Longleaf pine site response to repeated fertilization and forest floor removal by raking and prescribed burning

    Science.gov (United States)

    Kim Ludovici; Robert Eaton; Stanley Zarnoch

    2018-01-01

    Removal of forest floor litter by pine needle raking and prescribed burning is a common practice in longleaf pine (Pinus palustris Mill.) stands on Coastal Plain sites in the Southeastern United States. Repeated removal of litter by raking and the loss of surface organic matter from controlled burns can affect the...

  20. Biogeochemical cycling of carbon, nitrogen, and sulfur at the Howland Integrated Forest Study site, Howland, Maine

    Science.gov (United States)

    James W. McLaughlin; Ivan J. Fernandez; Stewart M. Goltz; Lindsey E. Rustad; Larry Zibilske

    1996-01-01

    The biogeochemistry of C, N, and S was studied for six years at the Howland Integrated Forest Study (HIFS) site by measuring those constituents in major above- and below-ground pools and fluxes. Leaching losses of C from the solum were much less than CO2 efflux, with a mean annual leaching rate of 31.2 kg ha-1 yr

  1. Forest Soil Productivity on the Southern Long-Term Soil Productivity Sites at Age 5

    Science.gov (United States)

    D. Andrew Scott; Allan E. Tiarks; Felipe G. Sanchez; Michael Elliott-Smith; Rick Stagg

    2004-01-01

    Forest management operations have the potential to reduce soil productivity through organic matter and nutrient removal and soil compaction. We measured pine volume, bulk density, and soil and foliar nitrogen and phosphorus at age 5 on the 13 southern Long-Term Soil Productivity study sites. The treatments were organic matter removal [bole only (BO), whole tree (WT),...

  2. Evolutionary divergence of plant borate exporters and critical amino acid residues for the polar localization and boron-dependent vacuolar sorting of AtBOR1

    KAUST Repository

    Wakuta, Shinji

    2015-01-24

    Boron (B) is an essential micronutrient for plants but is toxic when accumulated in excess. The plant BOR family encodes plasma membrane-localized borate exporters (BORs) that control translocation and homeostasis of B under a wide range of conditions. In this study, we examined the evolutionary divergence of BORs among terrestrial plants and showed that the lycophyte Selaginella moellendorffii and angiosperms have evolved two types of BOR (clades I and II). Clade I includes AtBOR1 and homologs previously shown to be involved in efficient transport of B under conditions of limited B availability. AtBOR1 shows polar localization in the plasma membrane and high-B-induced vacuolar sorting, important features for efficient B transport under low-B conditions, and rapid down-regulation to avoid B toxicity. Clade II includes AtBOR4 and barley Bot1 involved in B exclusion for high-B tolerance. We showed, using yeast complementation and B transport assays, that three genes in S. moellendorffii, SmBOR1 in clade I and SmBOR3 and SmBOR4 in clade II, encode functional BORs. Furthermore, amino acid sequence alignments identified an acidic di-leucine motif unique in clade I BORs. Mutational analysis of AtBOR1 revealed that the acidic di-leucine motif is required for the polarity and high-B-induced vacuolar sorting of AtBOR1. Our data clearly indicated that the common ancestor of vascular plants had already acquired two types of BOR for low- and high-B tolerance, and that the BOR family evolved to establish B tolerance in each lineage by adapting to their environments. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists.

  3. Ongoing change of site conditions important for sustainable forest management planning

    Science.gov (United States)

    Bidló, András; Horváth, Adrienn; Gulyás, Krisztina; Gálos, Borbála

    2016-04-01

    Observed tree mortality of the last decades has shown that the vulnerable forest ecosystems are especially affected by the recurrent, long lasting droughts, heat waves and their consequences. From all site conditions climate is changing the fastest, in this way it can be the largest threatening factor in the 21st century. Beyond climate, soil characteristics are playing an important influencing role. Until now, silvicultural technologies and species preferences of many countries are prescribed by binding regulation based on climate conditions that are assumed to be constant over time. Therefore the aim of our research was to investigate the ongoing and projected change of site conditions that are considered to be of primary importance in terms of tree species selection. For a case study region in Hungary (Keszthely Mountains, near to Lake Balaton) long-term climate tendencies have been determined for the period 1961-2100, as well as a detailed soil sample analysis has been carried out including ~100 sites. Results show a 0.5 degree increase of temperature and a 6-7 % decrease of the precipitation amount for the summer months in the last decades. For the future, significant warming and drying of summers is expected. Decrease of the summer precipitation sum can exceed 25 % until the end of the century, probability of extreme hot days may increase. These tendencies together with the unfavourable soil conditions and biotic damages can be the reason of the ongoing forest dieback. One of the characteristic soil type of the region is rendzina with a thin topsoil layer and an unfavourable water holding capacity. These properties are limiting the amount of available water for plants, especially in case of intense precipitation events. Black pine stands planted on rendzinas after many years of grazing; therefore erosion may have played a significant role. Not only microclimate conditions but also soil types show a large diversity within a relatively small distance. However

  4. A new approach to the spectral analysis of liquid membrane oscillators by Gábor transformation

    DEFF Research Database (Denmark)

    Płocharska-Jankowska, E.; Szpakowska, M.; Mátéfi-Tempfli, Stefan

    2006-01-01

    Liquid membrane oscillators very frequently have an irregular oscillatory behavior. Fourier transformation cannot be used for these nonstationary oscillations to establish their power spectra. This important point seems to be overlooked in the field of chemical oscillators. A new approach...... is presented here based on Gábor transformation allowing one to obtain power spectra of any kind of oscillations that can be met experimentally. The proposed Gábor analysis is applied to a liquid membrane oscillator containing a cationic surfactant. It was found that the power spectra are strongly influenced...

  5. Forests

    Science.gov (United States)

    Louis R. Iverson; Mark W. Schwartz

    1994-01-01

    Originally diminished by development, forests are coming back: forest biomass is accumulating. Forests are repositories for many threatened species. Even with increased standing timber, however, biodiversity is threatened by increased forest fragmentation and by exotic species.

  6. Effect of the degree of anthropization in the structure, at three sites fragmented evergreen piedmont forest

    Directory of Open Access Journals (Sweden)

    Hugo Gabriel Sánchez Villacis

    2017-08-01

    Full Text Available The Ecuadorian Amazon is recognized worldwide for its extraordinary megadiversity and multiplicity of forest goods and services. However, the inadequate practices of extractive use of non-timber forest products, the clearing of extensive areas of forests for the development of oil activity and the unsustainable use of timber as economic sustenance of communities have led to structural and functional changes In ecosystems. The study was carried out in three sites of a degraded evergreen forest of the eastern Amazon (Mera, Shell and Puyo in order to evaluate the effect of the degree of intervention on the forest structure. A floristic inventory was carried out with 60 plots of 25 x 25 m2 and tree species ≥ 2.5 cm d1.30 and species in natural regeneration phase with h <2 m were measured. We found 35 families, 65 genera, 101 species and 2 298 individuals, with Arecaceae, Fabaceae and Moraceae being the most representative botanical families. The degree of anthropization was highly modified where Mera was the best state of conservation. It was evidenced a low floristic diversity with patterns of alteration in the vertical and horizontal structure, distinguished phytosociologically by two strata in the sites of Shell and Puyo and by three in Mera, indicator of structural changes.

  7. Characterization of aerosol particles at the forested site in Lithuania

    Science.gov (United States)

    Rimselyte, I.; Garbaras, A.; Kvietkus, K.; Remeikis, V.

    2009-04-01

    Atmospheric particulate matter (PM), especially fine particles (particles with aerodynamic diameter less than 1 m, PM1), has been found to play an important role in global climate change, air quality, and human health. The continuous study of aerosol parameters is therefore imperative for better understanding the environmental effects of the atmospheric particles, as well as their sources, formation and transformation processes. The particle size distribution is particularly important, since this physical parameter determines the mass and number density, lifetime and atmospheric transport, or optical scattering behavior of the particles in the atmosphere (Jaenicke, 1998). Over the years several efforts have been made to improve the knowledge about the chemical composition of atmospheric particles as a function of size (Samara and Voutsa, 2005) and to characterize the relative contribution of different components to the fine particulate matter. It is well established that organic materials constitute a highly variable fraction of the atmospheric aerosol. This fraction is predominantly found in the fine size mode in concentrations ranging from 10 to 70% of the total dry fine particle mass (Middlebrook et al., 1998). Although organic compounds are major components of the fine particles, the composition, formation mechanism of organic aerosols are not well understood. This is because particulate organic matter is part of a complex atmospheric system with hundreds of different compounds, both natural and anthropogenic, covering a wide range of chemical properties. The aim of this study was to characterize the forest PM1, and investigate effects of air mass transport on the aerosol size distribution and chemical composition, estimate and provide insights into the sources and characteristics of carbonaceous aerosols through analysis ^13C/12C isotopic ratio as a function of the aerosol particles size. The measurements were performed at the Rugšteliškis integrated

  8. Quercus rubra-associated ectomycorrhizal fungal communities of disturbed urban sites and mature forests.

    Science.gov (United States)

    Karpati, Amy S; Handel, Steven N; Dighton, John; Horton, Thomas R

    2011-08-01

    The presence and quality of the belowground mycorrhizal fungal community could greatly influence plant community structure and host species response. This study tests whether mycorrhizal fungal communities in areas highly impacted by anthropogenic disturbance and urbanization are less species rich or exhibit lower host root colonization rates when compared to those of less disturbed systems. Using a soil bioassay, we sampled the ectomycorrhizal fungal (EMF) communities associating with Quercus rubra (northern red oak) seedlings in soil collected from seven sites: two mature forest reference sites and five urban sites of varying levels of disturbance. Morphological and polymerase chain reaction-restriction fragment length polymorphism analyses of fungi colonizing root tips revealed that colonization rates and fungal species richness were significantly lower on root systems of seedlings grown in disturbed site soils. Analysis of similarity showed that EMF community composition was not significantly different among several urban site soils but did differ significantly between mature forest sites and all but one urban site. We identified a suite of fungal species that occurred across several urban sites. Lack of a diverse community of belowground mutualists could be a constraint on urban plant community development, especially of late-successional woodlands. Analysis of urban EMF communities can add to our understanding of urban plant community structure and should be addressed during ecological assessment before pragmatic decisions to restore habitats are framed.

  9. Seed Bank Variation under Contrasting Site Quality Conditions in Mixed Oak Forests of Southeastern Ohio, USA

    International Nuclear Information System (INIS)

    Small, Ch.J.; McCarthy, B.C.

    2010-01-01

    Seed bank composition was sampled in 192-2.5 m 2 quadrats, established in six regenerating clearcut (∼7 years) and six second-growth ((∼125 years) mixed-oak forest stands in southeastern Ohio. Seed bank and aboveground composition diverged markedly (Sorensen's coefficient <10%), emphasizing the importance of fast-growing, early-successional germinants to early ecosystem recovery. Seed richness was significantly (ρ<.01) higher in clearcut stands, suggesting declining richness with stand age. Richness estimations 28%-60% higher than observed values demonstrated high seed bank heterogeneity, emphasizing the need for intensive sampling to assess temperate forest seed bank variation. Site quality (topographic aspect) strongly influenced seed bank composition, with greater importance of early-successional trees, thicket-forming shrubs, and nonnative species on mesic sites. Thus, forest seed banks are likely to play an important, site-dependent role in shaping competitive environments for commercially important timber species after harvesting and soil disturbance and have the potential for marked influence on post harvest forest development.

  10. Seed Bank Variation under Contrasting Site Quality Conditions in Mixed Oak Forests of Southeastern Ohio, USA

    Directory of Open Access Journals (Sweden)

    Christine J. Small

    2010-01-01

    Full Text Available Seed bank composition was sampled in 192–2.5 m2 quadrats, established in six regenerating clearcut (∼7 years and six second-growth (∼125 years mixed-oak forest stands in southeastern Ohio. Seed bank and aboveground composition diverged markedly (Sørensen's coefficient <10%, emphasizing the importance of fast-growing, early-successional germinants to early ecosystem recovery. Seed richness was significantly (P<.01 higher in clearcut stands, suggesting declining richness with stand age. Richness estimations 28%–60% higher than observed values demonstrated high seed bank heterogeneity, emphasizing the need for intensive sampling to assess temperate forest seed bank variation. Site quality (topographic aspect strongly influenced seed bank composition, with greater importance of early-successional trees, thicket-forming shrubs, and nonnative species on mesic sites. Thus, forest seed banks are likely to play an important, site-dependent role in shaping competitive environments for commercially important timber species after harvesting and soil disturbance and have the potential for marked influence on postharvest forest development.

  11. Bird Pollinator Visitation is Equivalent in Island and Plantation Planting Designs in Tropical Forest Restoration Sites

    Directory of Open Access Journals (Sweden)

    Ginger M. Thurston

    2013-03-01

    Full Text Available Active restoration is one strategy to reverse tropical forest loss. Given the dynamic nature of climates, human populations, and other ecosystem components, the past practice of using historical reference sites as restoration targets is unlikely to result in self-sustaining ecosystems. Restoring sustainable ecological processes like pollination is a more feasible goal. We investigated how flower cover, planting design, and landscape forest cover influenced bird pollinator visits to Inga edulis trees in young restoration sites in Costa Rica. I. edulis trees were located in island plantings, where seedlings had been planted in patches, or in plantation plantings, where seedlings were planted to cover the restoration area. Sites were located in landscapes with scant (10–21% or moderate (35–76% forest cover. Trees with greater flower cover received more visits from pollinating birds; neither planting design nor landscape forest cover influenced the number of pollinator visits. Resident hummingbirds and a migratory bird species were the most frequent bird pollinators. Pollination in the early years following planting may not be as affected by details of restoration design as other ecological processes like seed dispersal. Future work to assess the quality of various pollinator species will be important in assessing this idea.

  12. A Basal Area Increment-Based Approach of Site Productivity Evaluation for Multi-Aged and Mixed Forests

    Directory of Open Access Journals (Sweden)

    Liyong Fu

    2017-04-01

    Full Text Available Accurate estimates of forest site productivity are essential for environmental planning and forest management. In this study, we developed a new productivity index, hereafter termed basal area potential productivity index (BAPP, to estimate site productivity for irregular and complex forests characterized by multi-aged, multi-species, and multi-layer stands. We presented the biological relevance of BAPP with its computational details. We also compared BAPP against basal area realized productivity (BARP in order to verify the practicability and reliability of BAPP. Time-series data of the national forest inventory on 1912 permanent sample plots that were located in two main forest types and consisted of oak-dominated mixed forests and other broadleaf forests in northeast China were used to demonstrate the application of BAPP. The results showed that the value of BAPP for each sample plot was larger than or equal to the corresponding BARP value for each forest type. For appropriately managed stands with relatively better site conditions, the values of both BARP and BAPP were almost identical. The values of the difference between BAPP and BARP could therefore be used to effectively assess forest site productivity. Meanwhile, BAPP also provides much reliable and valuable information that can aid decision-making in forest management.

  13. Seeing the forest through the trees: Considering roost-site selection at multiple spatial scales

    Science.gov (United States)

    Jachowski, David S.; Rota, Christopher T.; Dobony, Christopher A.; Ford, W. Mark; Edwards, John W.

    2016-01-01

    Conservation of bat species is one of the most daunting wildlife conservation challenges in North America, requiring detailed knowledge about their ecology to guide conservation efforts. Outside of the hibernating season, bats in temperate forest environments spend their diurnal time in day-roosts. In addition to simple shelter, summer roost availability is as critical as maternity sites and maintaining social group contact. To date, a major focus of bat conservation has concentrated on conserving individual roost sites, with comparatively less focus on the role that broader habitat conditions contribute towards roost-site selection. We evaluated roost-site selection by a northern population of federally-endangered Indiana bats (Myotis sodalis) at Fort Drum Military Installation in New York, USA at three different spatial scales: landscape, forest stand, and individual tree level. During 2007–2011, we radiotracked 33 Indiana bats (10 males, 23 females) and located 348 roosting events in 116 unique roost trees. At the landscape scale, bat roost-site selection was positively associated with northern mixed forest, increased slope, and greater distance from human development. At the stand scale, we observed subtle differences in roost site selection based on sex and season, but roost selection was generally positively associated with larger stands with a higher basal area, larger tree diameter, and a greater sugar maple (Acer saccharum) component. We observed no distinct trends of roosts being near high-quality foraging areas of water and forest edges. At the tree scale, roosts were typically in American elm (Ulmus americana) or sugar maple of large diameter (>30 cm) of moderate decay with loose bark. Collectively, our results highlight the importance of considering day roost needs simultaneously across multiple spatial scales. Size and decay class of individual roosts are key ecological attributes for the Indiana bat, however, larger-scale stand structural

  14. Sleeping sites and latrines of spider monkeys in continuous and fragmented rainforests: implications for seed dispersal and forest regeneration.

    Directory of Open Access Journals (Sweden)

    Arturo González-Zamora

    Full Text Available Spider monkeys (Ateles geoffroyi use sites composed of one or more trees for sleeping (sleeping sites and sleeping trees, respectively. Beneath these sites/trees they deposit copious amounts of dung in latrines. This behavior results in a clumped deposition pattern of seeds and nutrients that directly impacts the regeneration of tropical forests. Therefore, information on the density and spatial distribution of sleeping sites and latrines, and the characteristics (i.e., composition and structure of sleeping trees are needed to improve our understanding of the ecological significance of spider monkeys in influencing forest composition. Moreover, since primate populations are increasingly forced to inhabit fragmented landscapes, it is important to assess if these characteristics differ between continuous and fragmented forests. We assessed this novel information from eight independent spider monkey communities in the Lacandona rainforest, Mexico: four continuous forest sites and four forest fragments. Both the density of sleeping sites and latrines did not differ between forest conditions. Latrines were uniformly distributed across sleeping sites, but the spatial distribution of sleeping sites within the areas was highly variable, being particularly clumped in forest fragments. In fact, the average inter-latrine distances were almost double in continuous forest than in fragments. Latrines were located beneath only a few tree species, and these trees were larger in diameter in continuous than fragmented forests. Because latrines may represent hotspots of seedling recruitment, our results have important ecological and conservation implications. The variation in the spatial distribution of sleeping sites across the forest indicates that spider monkeys likely create a complex seed deposition pattern in space and time. However, the use of a very few tree species for sleeping could contribute to the establishment of specific vegetation associations

  15. Sleeping sites and latrines of spider monkeys in continuous and fragmented rainforests: implications for seed dispersal and forest regeneration.

    Science.gov (United States)

    González-Zamora, Arturo; Arroyo-Rodríguez, Víctor; Oyama, Ken; Sork, Victoria; Chapman, Colin A; Stoner, Kathryn E

    2012-01-01

    Spider monkeys (Ateles geoffroyi) use sites composed of one or more trees for sleeping (sleeping sites and sleeping trees, respectively). Beneath these sites/trees they deposit copious amounts of dung in latrines. This behavior results in a clumped deposition pattern of seeds and nutrients that directly impacts the regeneration of tropical forests. Therefore, information on the density and spatial distribution of sleeping sites and latrines, and the characteristics (i.e., composition and structure) of sleeping trees are needed to improve our understanding of the ecological significance of spider monkeys in influencing forest composition. Moreover, since primate populations are increasingly forced to inhabit fragmented landscapes, it is important to assess if these characteristics differ between continuous and fragmented forests. We assessed this novel information from eight independent spider monkey communities in the Lacandona rainforest, Mexico: four continuous forest sites and four forest fragments. Both the density of sleeping sites and latrines did not differ between forest conditions. Latrines were uniformly distributed across sleeping sites, but the spatial distribution of sleeping sites within the areas was highly variable, being particularly clumped in forest fragments. In fact, the average inter-latrine distances were almost double in continuous forest than in fragments. Latrines were located beneath only a few tree species, and these trees were larger in diameter in continuous than fragmented forests. Because latrines may represent hotspots of seedling recruitment, our results have important ecological and conservation implications. The variation in the spatial distribution of sleeping sites across the forest indicates that spider monkeys likely create a complex seed deposition pattern in space and time. However, the use of a very few tree species for sleeping could contribute to the establishment of specific vegetation associations typical of the

  16. The Evaluation of Alkali Grass (Puccinellia ciliata Bor Populations in Aydin Province of Turkey

    Directory of Open Access Journals (Sweden)

    İlkay Yavaş

    2017-08-01

    Full Text Available Alkali grass grows in waterlogged, saline and alaline soils. The main problem in these soils is minerals at toxic level. The toxic ions are chloride, sodium and boron. A number of techniques have been investigated for removing toxic metals from the soil. Today, the cost-effective and environmentally technique is phytoremediation, using hyperaccumulator plants. Alkali grass (Puccinellia ciliata Bor is suggested as a hyperaccumulator plant by the combination of more favourable characteristics with salt and waterlogging tolerance, high biomass value and convincing nutritive value for adverse environmental conditions. For this reason, we collected alkali grass and soil samples from five different locations in Aydın-Muğla highway, Turanlar and Sınırteke villages in Germencik-Aydın. In the soil analysis, we observed that K accumulation varies between root, shoot and panicle at least whereas Na and B shows more variation on whole plant portions among locations. Intense aerenchyma development on the root tips of Puccinellia plant was observed and it is determined as radial lysogenic aerenchyma formation. Average plant height and dry matter values were between 47.2-74.4 cm and 15.61-80.85 g/plant according to locations. The highest plant height value was obtained from the first location whereas the highest dry matter yield was detected in the fifth location. In conclusion, plants from fifth location can be regarded as fodder plants in these areas. Our results indicated that alkali grass can be effective for phytoextraction of sodium and boron from contaminated sites.

  17. Empirical test of the influence of global warming and forest disturbance on ant fauna at the Gwangneung Forest Long Term Ecological Research site, South Korea

    Directory of Open Access Journals (Sweden)

    Tae-Sung Kwon

    2014-09-01

    Full Text Available This study examined the effects of forest disturbance and climate change on the ant fauna at the Long Term Ecological Research site in Gwangneung Forest, Korea in 2003 and 2012. After forest disturbance, the occurrence and abundance of ants belonging to the functional groups of forest ground forager and soil and litter dweller are predicted to decrease, while the occurrence and abundance of ants belonging to the open land forager and forest vegetation forager functional groups are predicted to increase. In terms of the effects of climate change, if the optimum temperature of the ants is lower than the annual average temperature in the survey area, the occurrence and abundance of the ants are predicted to decrease and vice versa. Ant surveys were carried out using pitfall traps. Changes in the dominant species, occurrence, and abundance mostly corresponded to the predictions for forest disturbance, but did not match the prediction for an increase in temperature.

  18. Transgenic tobacco plants expressing BoRS1 gene from Brassica ...

    Indian Academy of Sciences (India)

    Water stress is by far the leading environmental stress limiting crop yields worldwide. Genetic engineering techniques hold great promise for developing crop cultivars with high tolerance to water stress. In this study, the Brassica oleracea var. acephala BoRS1 gene was transferred into tobacco through ...

  19. Aspects of energy reduction by autogenous copper production in the copper smelting plant Bor

    International Nuclear Information System (INIS)

    Najdenov, Ivan; Raić, Karlo T.; Kokeza, Gordana

    2012-01-01

    This work presents a comparative analysis of the energy consumption during copper production by the “standard” procedure (roasting in a fluo–solid reactor and smelting in a reverberatory furnace) in the Smelting Plant in Bor with modern autogenous procedures. All forms of expended energy were reduced to primary energy or to the same energy form, i.e., to the energy equivalent of the process (EEP), the raw material and the process materials. In addition, the energy equivalent of the process and waste products (water vapour, thermal energy and similar) were balanced. To complete the consumption of all energy generating products in copper production, they were reduced to conditional fuel (coal equivalent = 29.3 MJ/kg). Additionally, this study suggests replacement of the existing technology by an appropriate autogenous procedure and considers the prospects for further development of mining and metallurgy in Bor. Estimates of development perspectives for copper production should be comprehensive, based on complete and relevant data, as well as on real considerations of future development in world production. -- Highlights: ► “Standard” autogenous copper production in the Smelting Plant, Bor, Serbia. ► Comparation of energy consumption in “standard” with other autogenous procedures. ► All forms of energy are reduced to energy equivalent and conditional fuel. ► Replacement of existing technology with the appropriate autogenous procedure. ► Perspectives of further development of mining and metallurgy in Bor.

  20. Soil organic matter status in forest soils - possible indicators for climate change induced site shifts

    Science.gov (United States)

    Koch, Nadine; Thiele-Bruhn, Sören

    2010-05-01

    The quantity and quality of soil organic matter (SOM) and SOM pools and thus the soil properties related to carbon sequestration and water retention are not constant but exhibit considerable variation through changing climate. In total changes in soil fertility and an increase in plant stress are expected. This is relevant for northwest Europe as well and may have economic and social impacts since functions of forests for wood production, groundwater recharge, soil protection and recreation might be affected. The study is done by comparative investigation of selected sites at four watersheds that represent typical forest stands in the region of Luxembourg and South West Germany. The aim is to identify SOM storage and stability in forest soils and its dependence on site properties and interaction with tree stand conditions. According to state of the art fractionation schemes functional C pools in forest soils and their stabilization mechanisms are investigated. In particular, distribution patterns are determined depending on location, tree stand and climatic conditions. Aim is to identify characteristics of SOM stability through fractionation of SOM according to density, particle size and chemical extractability and their subsequent analytical characterization. So far, reasons about the origin, composition and stabilization mechanisms underlying the different SOM pools are not fully understood. Presented are different patterns of distribution of SOM in relation to land use and site conditions, as well as similarities and differences between the different forest soils and results in addition to passive OM pool, which is mainly responsible for long-term stabilization of carbon in soils. These are aligned with selected general' soil properties such as pH, CEC and texture.

  1. Polarized localization and borate-dependent degradation of the Arabidopsis borate transporter BOR1 in tobacco BY-2 cells.

    Science.gov (United States)

    Yamauchi, Noboru; Gosho, Tadashi; Asatuma, Satoru; Toyooka, Kiminori; Fujiwara, Toru; Matsuoka, Ken

    2013-01-01

    In Arabidopsis the borate transporter BOR1, which is located in the plasma membrane, is degraded in the presence of excess boron by an endocytosis-mediated mechanism. A similar mechanism was suggested in rice as excess boron decreased rice borate transporter levels, although in this case whether the decrease was dependent on an increase in degradation or a decrease in protein synthesis was not elucidated. To address whether the borate-dependent degradation mechanism is conserved among plant cells, we analyzed the fate of GFP-tagged BOR1 (BOR1-GFP) in transformed tobacco BY-2 cells. Cells expressing BOR1-GFP displayed GFP fluorescence at the plasma membrane, especially at the membrane between two attached cells. The plasma membrane signal was abolished when cells were incubated in medium with a high concentration of borate (3 to 5 mM). This decrease in BOR1-GFP signal was mediated by a specific degradation of the protein after internalization by endocytosis from the plasma membrane. Pharmacological analysis indicated that the decrease in BOR1-GFP largely depends on the increase in degradation rate and that the degradation was mediated by a tyrosine-motif and the actin cytoskeleton. Tyr mutants of BOR1-GFP, which has been shown to inhibit borate-dependent degradation in Arabidopsis root cells, did not show borate-dependent endocytosis in tobacco BY-2 cells. These findings indicate that the borate-dependent degradation machinery of the borate transporter is conserved among plant species.

  2. Use of Municipal Sewage Sludge for Improvement of Forest Sites in the Southeast

    Energy Technology Data Exchange (ETDEWEB)

    Charles R. Berry

    1987-09-01

    In eight field experiments dried municipal sewage sludge was applied to forest sites before planting of seedlings. In all cases, tree growth was faster on sludge-amended plots than on plots that received fertilizer and lime or no amendment. In all studies, concentrations of total nitrogen in the soil were higher on sludge plots than on control or fertilizer plots, even on good forest sites. In seven of the eight studies, concentrations of phosphorus also were higher on sludge plots than on control or fertilizer plots. Nitrogen and phosphorus tended to be higher in foliage from trees growing on sludge plots. Deep subsoiling was beneficial regardless of soil amendment. Where weeds were plentiful at the outset, they became serious competitors on plots receiving sludge.

  3. Observation and Analysis of Particle Nucleation at a Forest Site in Southeastern US

    OpenAIRE

    Pillai, Priya; Khlystov, Andrey; Walker, John; Aneja, Viney

    2013-01-01

    This study examines the characteristics of new particle formation at a forest site in southeastern US. Particle size distributions above a Loblolly pine plantation were measured between November 2005 and September 2007 and analyzed by event type and frequency, as well as in relation to meteorological and atmospheric chemical conditions. Nucleation events occurred on 69% of classifiable observation days. Nucleation frequency was highest in spring. The highest daily nucleation (class A and B ev...

  4. Foliage litter quality and annual net N mineralization: comparison across North American forest sites.

    Science.gov (United States)

    Scott, Neal A; Binkley, Dan

    1997-07-01

    The feedback between plant litterfall and nutrient cycling processes plays a major role in the regulation of nutrient availability and net primary production in terrestrial ecosystems. While several studies have examined site-specific feedbacks between litter chemistry and nitrogen (N) availability, little is known about the interaction between climate, litter chemistry, and N availability across different ecosystems. We assembled data from several studies spanning a wide range of vegetation, soils, and climatic regimes to examine the relationship between aboveground litter chemistry and annual net N mineralization. Net N mineralization declined strongly and non-linearly as the litter lignin:N ratio increased in forest ecosystems (r 2  = 0.74, P mineralization decreased linearly as litter lignin concentration increased, but the relationship was significant (r 2  = 0.63, P mineralization across this range of sites (r 2  litter lignin:N ratio and net N mineralization from forest floor and mineral soil was similar. The litter lignin:N ratio explained more of the variation in net N mineralization than climatic factors over a wide range of forest age classes, suggesting that litter quality (lignin:N ratio) may exert more than a proximal control over net N mineralization by influencing soil organic matter quality throughout the soil profile independent of climate.

  5. Atmospheric deposition of nitrogen at five subtropical forested sites in South China

    International Nuclear Information System (INIS)

    Chen, Xi Yun; Mulder, Jan

    2007-01-01

    Elevated concentrations of reactive nitrogen (N) in precipitation have been reported for many cities in China. Due to increased use of fossil fuels and expansion in agriculture, further increases in deposition of ammonia (NH x ) and reactive N oxides (NO y ) are predicted. Increased deposition of reactive N is likely to affect N dynamics and N runoff in forest ecosystems. Yet, in China little work has been done to quantify the levels of atmospheric N deposition in such systems. Here, we assess the deposition of inorganic N (ammonium, NH 4 + and nitrate, NO 3 - ) for five subtropical forest ecosystems in remote and urban areas of South China. Annual volume-weighted concentrations in bulk precipitation range from 0.18 to 1.55 mg NH 4 + -N L - 1 and from 0.12 to 0.74 mg NO 3 - -N L - 1 . These values are large and several times greater than those reported for remote sites of the world. The fluxes of total inorganic N (TIN) in wet-only deposition range from 0.8 to 2.3 g N m - 2 yr - 1 , with NH 4 + -N contributing 54% to 77%. Both the tree canopy and the ground vegetation layer are important in determining the net N flux reaching the forest floor, but the net effect varies from site to site. At TieShanPing (TSP), close to Chongqing city, and at CaiJiaTang (CJT), near Shaoshan (Hunan province), the canopy represents a net source of N, probably due to dry deposition. At the other three sites (LiuChongGuan (LCG), LeiGongShan (LGS), both in Guizhou province, and LiuXiHe (LXH) in Guangdong), a net loss of reactive N from precipitation water occurs in the canopy, probably due to uptake processes. The total annual atmospheric TIN load is estimated to range from at least 0.8 g N m - 2 yr - 1 to 4.0 g N m - 2 yr - 1 , with a considerable contribution from dry deposition. Concentrations and fluxes of inorganic N in tree canopy throughfall are greater than those in North America. Also the contribution of NH 4 + -N to TIN fluxes in throughfall (40% to 70%) is greater than in North

  6. The Italian forest sites of FunDivEUROPE: a new FP7 project on the functional significance of forest biodiversity in Europe

    Directory of Open Access Journals (Sweden)

    Bussotti F

    2012-12-01

    Full Text Available The Italian forest sites of FunDivEUROPE: a new FP7 project on the functional significance of forest biodiversity in Europe. FunDivEUROPE is a new project aiming at a deeper understanding of the role of forest diversity on ecosystem functions and service provisioning for society. This project combines three scientific platforms: experimental, exploratory and inventory. The exploratory platform is based on the observation of a broad range of properties, traits and ecological processes on a network of ca. 240 natural forest sites representing a gradient of tree species diversity in six focal regions of Europe (Spain, Italy, Germany, Poland, Finland and Romania. The Italian sites are located on the hills of central and Southern Tuscany and represent the category “thermophilous deciduous forest”. Almost one year of fieldwork was needed to select and characterize 36 plots measuring 30 x 30 m. Selection was based on criteria concerning tree mixtures and richness, structural parameters and main environmental variables. The main features of these sites are synthetically presented in this paper together with a short description of the project structure and scope. The aim is also to enhance dissemination of the potential implications for a sustainable forest management in Italy.

  7. A multi-sites analysis on the ozone effects on Gross Primary Production of European forests

    Energy Technology Data Exchange (ETDEWEB)

    Proietti, C. [Department of Environmental Biology, Sapienza University of Rome, Piazzale Aldo Moro, 5, 00185 Rome (Italy); Anav, A. [Italian National Agency for New Technologies, Energy and the Environment (ENEA), C.R. Casaccia, Via Anguillarese 301, 00123 S. Maria di Galeria, Rome (Italy); University of Exeter, College of Engineering, Mathematics and Physical Sciences, Exeter (United Kingdom); De Marco, A. [Italian National Agency for New Technologies, Energy and the Environment (ENEA), C.R. Casaccia, Via Anguillarese 301, 00123 S. Maria di Galeria, Rome (Italy); Sicard, P. [ACRI-HE, 260 route du Pin Montard BP234, 06904 Sophia Antipolis-cedex (France); Vitale, M., E-mail: marcello.vitale@uniroma1.it [Department of Environmental Biology, Sapienza University of Rome, Piazzale Aldo Moro, 5, 00185 Rome (Italy)

    2016-06-15

    Ozone (O{sub 3}) is both a greenhouse gas and a secondary air pollutant causing adverse impacts on forests ecosystems at different scales, from cellular to ecosystem level. Specifically, the phytotoxic nature of O{sub 3} can impair CO{sub 2} assimilation that, in turn affects forest productivity. This study aims to evaluate the effects of tropospheric O{sub 3} on Gross Primary Production (GPP) at 37 European forest sites during the time period 2000–2010. Due to the lack of carbon assimilation data at O{sub 3} monitoring stations (and vice-versa) this study makes a first attempt to combine high resolution MODIS Gross Primary Production (GPP) estimates and O{sub 3} measurement data. Partial Correlations, Anomalies Analysis and the Random Forests Analysis (RFA) were used to quantify the effects of tropospheric O{sub 3} concentration and its uptake on GPP and to evaluate the most important factors affecting inter-annual GPP changes. Our results showed, along a North-West/South-East European transect, a negative impact of O{sub 3} on GPP ranging from 0.4% to 30%, although a key role of meteorological parameters respect to pollutant variables in affecting GPP was found. In particular, meteorological parameters, namely air temperature (T), soil water content (SWC) and relative humidity (RH) are the most important predictors at 81% of test sites. Moreover, it is interesting to highlight a key role of SWC in the Mediterranean areas (Spanish, Italian and French test sites) confirming that, soil moisture and soil water availability affect vegetation growth and photosynthesis especially in arid or semi-arid ecosystems such as the Mediterranean climate regions. Considering the pivotal role of GPP in the global carbon balance and the O{sub 3} ability to reduce primary productivity of the forests, this study can help in assessing the O{sub 3} impacts on ecosystem services, including wood production and carbon sequestration. - Highlights: • Assessment of the surface O{sub 3

  8. Evaluation of signal processing for boiling noise detection. Further analysis of BOR-60 reactor noise data

    International Nuclear Information System (INIS)

    Ledwidge, T.J.; Black, J.L.

    1989-01-01

    The present paper deals with investigations of acoustic signals from a boiling experiment performed on the BOR 60 reactor in the USSR. Signals have been analysed in frequency as well as in time domain. Signal characteristics successfully used to detect the boiling process have been found in time domain. A proposal for in-service boiling monitoring by acoustic means is described. (author). 3 refs, 16 figs

  9. Structure of Bor1 supports an elevator transport mechanism for SLC4 anion exchangers.

    Science.gov (United States)

    Thurtle-Schmidt, Bryan H; Stroud, Robert M

    2016-09-20

    Boron is essential for plant growth because of its incorporation into plant cell walls; however, in excess it is toxic to plants. Boron transport and homeostasis in plants is regulated in part by the borate efflux transporter Bor1, a member of the solute carrier (SLC) 4 transporter family with homology to the human bicarbonate transporter Band 3. Here, we present the 4.1-Å resolution crystal structure of Arabidopsis thaliana Bor1. The structure displays a dimeric architecture in which dimerization is mediated by centralized Gate domains. Comparisons with a structure of Band 3 in an outward-open state reveal that the Core domains of Bor1 have rotated inwards to achieve an occluded state. Further structural comparisons with UapA, a xanthine transporter from the nucleobase-ascorbate transporter family, show that the downward pivoting of the Core domains relative to the Gate domains may access an inward-open state. These results suggest that the SLC4, SLC26, and nucleobase-ascorbate transporter families all share an elevator transport mechanism in which alternating access is provided by Core domains that carry substrates across a membrane.

  10. Basic principles of accounting and control of nuclear materials in the BOR-60 experimental fast reactor

    International Nuclear Information System (INIS)

    Gryazev, V.M.; Gadzhiev, G.I.; Alekseev, I.N.

    1979-01-01

    Under a contract with the International Atomic Energy Agency, the V.I. Lenin Atomic Reactor Research Institute is currently carrying out a study of ways of organizing a nuclear materials accounting and control system for the BOR-60 fast reactor. Some results of this study are presented in the paper. The special physical and technological features of fast reactors create additional difficulties in safeguards systems and give rise to a number of new possibilities for the illicit removal of nuclear materials. These questions are discussed with reference to the BOR-60 reactor but the conclusions are probably applicable to all fast reactors. The proposed accounting and control system is based on non-destructive measurements of the amount of fissile materials in the operating fuel assemblies and screened bundles of the reactor, on the independent control of the principal facility parameters (a list of which is given) and on an automated information collection and evaluation system. Visual means of inspection can be very effective in fast reactor safeguards systems, especially for controlling storage, but they are not used with the BOR-60 reactor. (author)

  11. Inventory of forest and rangeland resources, including forest stress. [Atlanta, Georgia, Black Hills, and Manitou, Colorado test sites

    Science.gov (United States)

    Heller, R. C.; Aldrich, R. C.; Weber, F. P.; Driscoll, R. S. (Principal Investigator)

    1974-01-01

    The author has identified the following significant results. Some current beetle-killed ponderosa pine can be detected on S190-B photography imaged over the Bear Lodge mountains in the Black Hills National Forest. Detections were made on SL-3 imagery (September 13, 1973) using a zoom lens microscope to view the photography. At this time correlations have not been made to all of the known infestation spots in the Bear Lodge mountains; rather, known infestations have been located on the SL-3 imagery. It was determined that the beetle-killed trees were current kills by stereo viewing of SL-3 imagery on one side and SL-2 on the other. A successful technique was developed for mapping current beetle-killed pine using MSS imagery from mission 247 flown by the C-130 over the Black Hills test site in September 1973. Color enhancement processing on the NASA/JSC, DAS system using three MSS channels produced an excellent quality detection map for current kill pine. More importantly it provides a way to inventory the dead trees by relating PCM counts to actual numbers of dead trees.

  12. Survival and growth of restored Piedmont riparian forests as affected by site preparation, planting stock, and planting aids

    Science.gov (United States)

    Chelsea M. Curtis; W. Michael Aust; John R. Seiler; Brian D. Strahm

    2015-01-01

    Forest mitigation sites may have poor survival and growth of planted trees due to poor drainage, compacted soils, and lack of microtopography. The effects of five replications of five forestry mechanical site preparation techniques (Flat, Rip, Bed, Pit, and Mound), four regeneration sources (Direct seed, Bare root, Tubelings, and Gallon), and three planting aids (None...

  13. A breeding site record of Long-billed Vulture Gyps indicus (Aves: Accipitriformes: Accipitridae from Bejjur Reserve Forest, Telangana, India

    Directory of Open Access Journals (Sweden)

    Swetha Stotrabhashyam

    2015-01-01

    Full Text Available The Long-billed Vulture Gyps indicus is, Critically Endangered with few known breeding sites in peninsular India.  We present a previously undocumented Long-billed Vulture breeding site in Bejjur Reserve Forest, Adilabad District, northern Telangana.

  14. Prediction of protein-protein interaction sites in sequences and 3D structures by random forests.

    Directory of Open Access Journals (Sweden)

    Mile Sikić

    2009-01-01

    Full Text Available Identifying interaction sites in proteins provides important clues to the function of a protein and is becoming increasingly relevant in topics such as systems biology and drug discovery. Although there are numerous papers on the prediction of interaction sites using information derived from structure, there are only a few case reports on the prediction of interaction residues based solely on protein sequence. Here, a sliding window approach is combined with the Random Forests method to predict protein interaction sites using (i a combination of sequence- and structure-derived parameters and (ii sequence information alone. For sequence-based prediction we achieved a precision of 84% with a 26% recall and an F-measure of 40%. When combined with structural information, the prediction performance increases to a precision of 76% and a recall of 38% with an F-measure of 51%. We also present an attempt to rationalize the sliding window size and demonstrate that a nine-residue window is the most suitable for predictor construction. Finally, we demonstrate the applicability of our prediction methods by modeling the Ras-Raf complex using predicted interaction sites as target binding interfaces. Our results suggest that it is possible to predict protein interaction sites with quite a high accuracy using only sequence information.

  15. Sources of long-lived atmospheric VOCs at the rural boreal forest site, SMEAR II

    Science.gov (United States)

    Patokoski, J.; Ruuskanen, T. M.; Kajos, M. K.; Taipale, R.; Rantala, P.; Aalto, J.; Ryyppö, T.; Nieminen, T.; Hakola, H.; Rinne, J.

    2015-12-01

    In this study a long-term volatile organic compound (VOCs) concentration data set, measured at the SMEAR II (Station for Measuring Ecosystem-Atmosphere Relations) boreal forest site in Hyytiälä, Finland during the years 2006-2011, was analyzed in order to identify source areas and profiles of the observed VOCs. VOC mixing ratios were measured using proton transfer reaction mass spectrometry. Four-day HYSPLIT 4 (Hybrid Single Particle Lagrangian Integrated Trajectory) backward trajectories and the Unmix 6.0 receptor model were used for source area and source composition analysis. Two major forest fire events in Russia took place during the measurement period. The effect of these fires was clearly visible in the trajectory analysis, lending confidence to the method employed with this data set. Elevated volume mixing ratios (VMRs) of non-biogenic VOCs related to forest fires, e.g. acetonitrile and aromatic VOCs, were observed. Ten major source areas for long-lived VOCs (methanol, acetonitrile, acetaldehyde, acetone, benzene, and toluene) observed at the SMEAR II site were identified. The main source areas for all the targeted VOCs were western Russia, northern Poland, Kaliningrad, and the Baltic countries. Industrial areas in northern continental Europe were also found to be source areas for certain VOCs. Both trajectory and receptor analysis showed that air masses from northern Fennoscandia were less polluted with respect to both the VOCs studied and other trace gases (CO, SO2 and NOx), compared to areas of eastern and western continental Europe, western Russia, and southern Fennoscandia.

  16. Remote Sensing for Mapping RAMSAR Heritage Site at Sungai Pulai Mangrove Forest Reserve, Johor, Malaysia

    International Nuclear Information System (INIS)

    Hasmadi, I.M.; Pakhriazad, H.Z.; Norlida, K.

    2011-01-01

    The Sungai Pulai Mangrove Forest Reserve (SPMFR) is the largest reverin mangrove system in Johore. In 2003 about 9,126 ha of the Sungai Pulai mangrove was designated as a RAMSAR site. RAMSAR sites are wetland areas that are deemed to have international importance and are included in the List of Wetlands of International Importance. The SPMFR plays a significant socio-economic role to the adjacent 38 villages. Satellite remote sensing is a useful source of information where it provides timely and complete coverage for vegetation mapping especially in mangroves where the accessibility is difficult. This study was carried out to identify and map land cover types using SPOT-4 imagery at the Sungai Pulai-RAMSAR site and its surrounding areas. Through unsupervised classification technique a total of seven classes of land cover type were mapped, where about 90 % mapping accuracy was gained from the accuracy assessment. Later, vegetation densities were classified into five levels namely very high, high, medium, low and very low based on crown density scale using vegetation indices model such as NDVI, AVI and OSAVI. Results from NDVI and OSAVI model were almost similar but AVI model detected more on medium vegetation which did not show the real ground condition. The study concludes that SPOT-4 imagery was able to discriminate mangrove area clearly from other land covers type. Vegetation indices model can be used as a tool for mapping vegetation density level in the SPMFR and its surrounding area. Therefore VIs models from remote sensing are useful to monitor and manage the mangrove forest for sustainable management and preserve the SPMFR as a RAMSAR site in Peninsular Malaysia. (author)

  17. Cracking behavior and microstructure of austenitic stainless steels and alloy 690 irradiated in BOR-60 reactor, phase I.

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Y.; Chopra, O. K.; Soppet, W. K.; Shack, W. J.; Yang, Y.; Allen, T. R.; Univ. of Wisconsin at Madison

    2010-02-16

    Cracking behavior of stainless steels specimens irradiated in the BOR-60 at about 320 C is studied. The primary objective of this research is to improve the mechanistic understanding of irradiation-assisted stress corrosion cracking (IASCC) of core internal components under conditions relevant to pressurized water reactors. The current report covers several baseline tests in air, a comparison study in high-dissolved-oxygen environment, and TEM characterization of irradiation defect structure. Slow strain rate tensile (SSRT) tests were conducted in air and in high-dissolved-oxygen (DO) water with selected 5- and 10-dpa specimens. The results in high-DO water were compared with those from earlier tests with identical materials irradiated in the Halden reactor to a similar dose. The SSRT tests produced similar results among different materials irradiated in the Halden and BOR-60 reactors. However, the post-irradiation strength for the BOR-60 specimens was consistently lower than that of the corresponding Halden specimens. The elongation of the BOR-60 specimens was also greater than that of their Halden specimens. Intergranular cracking in high-DO water was consistent for most of the tested materials in the Halden and BOR-60 irradiations. Nonetheless, the BOR-60 irradiation was somewhat less effective in stimulating IG fracture among the tested materials. Microstructural characterization was also carried out using transmission electron microscopy on selected BOR-60 specimens irradiated to {approx}25 dpa. No voids were observed in irradiated austenitic stainless steels and cast stainless steels, while a few voids were found in base and grain-boundary-engineered Alloy 690. All the irradiated microstructures were dominated by a high density of Frank loops, which varied in mean size and density for different alloys.

  18. Sustainable forest management of Natura 2000 sites: a case study from a private forest in the Romanian Southern Carpathians

    Directory of Open Access Journals (Sweden)

    Helge Walentowski

    2013-07-01

    Full Text Available Biodiversity and forest management are analyzed for a 500 ha privately owned forest within the Natura 2000 area “ROSCI0122 Muntii Fagaras”. Habitat types and indicator species are identified to measure environmental quality. Working towards an integrated approach to conservation, a range of options that will result in sustainable forest management are then considered. For beech forests light heterogeneity emerges as a crucial management target to ensure tree species richness and structural diversity as a basis for saving indicator species such as Morimus funereus, Cucujus cinnaberinus, Bolitophagus reticulatus and Xestobium austriacum. For spruce forests thinning over a broad range of diameters and maintenance of veteran trees would provide habitats for indicator species such asOlisthaerus substriatus. The populations of a number of bird species would be increased by strip-harvesting slopes: species such as Tetrao urogallus, Bonasia bonasia and Ficedula parva prefer forest margins. Steep slopes, and the areas around springs and watercourses, as well as rock faces, should remain unmanaged. Future management should start with a grid-based inventory to create an objective database of forest structure and life. An example is presented for high-elevation spruce forest. The inventory should quantify the variations in diameter, height and volume of trees per unit area. Such data would allow the advanced planning of forest operations. We discuss a wide range of administrative and organizational changes; changes that are needed for the sustainable forest management of the vast close-to-natural forests of the Muntii Fagaras, the maintenance of the Nardusgrasslands and the protection of wetland vegetation around springs and streams in this Natura 2000-area. 

  19. Forests

    International Nuclear Information System (INIS)

    Melin, J.

    1997-01-01

    Forests have the capacity to trap and retain radionuclides for a substantial period of time. The dynamic behaviour of nutrients, pollution and radionuclides in forests is complex. The rotation period of a forest stand in the Nordic countries is about 100 years, whilst the time for decomposition of organic material in a forest environment can be several hundred years. This means that any countermeasure applied in the forest environment must have an effect for several decades, or be reapplied continuously for long periods of time. To mitigate the detrimental effect of a contaminated forest environment on man, and to minimise the economic loss in trade of contaminated forest products, it is necessary to understand the mechanisms of transfer of radionuclides through the forest environment. It must also be stressed that any countermeasure applied in the forest environment must be evaluated with respect to long, as well as short term, negative effects, before any decision about remedial action is taken. Of the radionuclides studied in forests in the past, radiocaesium has been the main contributor to dose to man. In this document, only radiocaesium will be discussed since data on the impact of other radionuclides on man are too scarce for a proper evaluation. (EG)

  20. Determination of the Sites with Conservation Priority in Research Forests of Yasouj University Based on Physiographic Factors

    Directory of Open Access Journals (Sweden)

    R. Zolfaghari

    2013-03-01

    Full Text Available Regarding high economic and conservative values of Zagros forests, and livelihood dependency of local people these recourses, determination of sites with higher conservation index can help us to maintain biodiversity of these forests more efficiently. Therefore, 49 plots with 450 m2 in area accompanied by 1, 10 and 45 m2 subplots were taken as systematic random design in research forests of Yasouj University. The number of species in each plot and subplot was recorded. The conservation values for different physiographic regions of forest were calculated using integrative parameters such as the number of species per plot, number of rare species per plot, number of tree species per plot, Jaccards similarity coefficient and slope of species-log(area. Comparing the conservation index in different physiographic sites revealed that the areas located in the north, hills and lower altitudes can be considered for in situ conservation due to higher number of trees, rare species and total plant species, species-log (area slope and lower amount of Jaccard similarity coefficient. But, vegetative sites located in lower slopes and south, because of lower conservation index, can be used for other multipurpose forestry activities. Using this index for different forest areas can be potentially conducted for better conservation and management of Zagros forests.

  1. Sustainable forest management of Natura 2000 sites: a case study from a private forest in the Romanian Southern Carpathians

    Directory of Open Access Journals (Sweden)

    H. Walentowski

    2013-05-01

    Full Text Available Biodiversity and forest management are analyzed for a 500 haprivately owned forest within the Natura 2000 area “ROSCI0122 MunţiiFăgăraş”. Habitat types and indicator species are identified to measure environmental quality. Working towards an integrated approach to conservation, a range of options that will result in sustainable forest management are then considered. For beech forests light heterogeneity emerges as a crucial management target to ensure tree species richness and structural diversity as a basis for saving indicator species such as Morimus funereus, Cucujus cinnaberinus,Bolitophagus reticulatus and Xestobium austriacum. For spruceforests thinning over a broad range of diameters and maintenance of veteran trees would provide habitats for indicator species such as Olisthaerus substriatus. The populations of a number of bird species would be increased by strip-harvesting slopes: species such as Tetrao urogallus, Bonasia bonasia and Ficedula parva prefer forest margins. Steep slopes, and the areas around springs and watercourses, as well as rock faces, should remain unmanaged. Future management should start with a grid-based inventory to create an objective database of forest structure and life. An example is presented for high-elevation spruce forest. The inventory should quantify the variations in diameter, height and volume of trees per unit area. Such data would allowthe advanced planning of forest operations. We discuss a wide range ofadministrative and organizational changes; changes that are needed for the sustainable forest management of the vast close-to-natural forests of the Munţii Făgăraş, the maintenance of the Nardus grasslands and the protection of wetland vegetation around springs and streams in this Natura 2000-area.

  2. Fundamentals of the spatially distributed simulation of the water balance of forest sites in a low-range mountain area

    Directory of Open Access Journals (Sweden)

    K. Schwärzel

    2007-05-01

    Full Text Available For a sustainable forest management, a site-specific knowledge on the water balance is a prerequisite. A simple and popular field method for assessing the water balance of forest sites is based on overlaying relief and soil information. Furthermore, climatic influence on the water balance is often restricted to longtime average values of precipitation and air temperature (whole year and/or growing season. However, the impacts of climate change and climatic extremes, as well as silvicultural changes, are inadequately considered. To overcome these short-comings, we integrated the 1D-SVAT model BROOK90 and a radiation model in a GIS to simulate the spatially distributed components of water balance of forest sites. In this paper, we present the model concept and show an approach to describe the influence of a complex terrain on parameters controlling the spatial distribution of energy and water fluxes.

  3. Ozone concentrations at a selected high-elevation forest site downwind Mexico City

    Science.gov (United States)

    Torres-JArdon, R.

    2013-05-01

    Torres-Jardón, R.*, Rosas-Pérez, I., Granada-Macías, L. M., Ruiz-Suárez, L. G. Centro de Ciencias de la Atmósfera, UNAM, México D. F. México * rtorres@unam.mx For many years, the vegetation of forest species such as Abies religiosa in natural parks located in the southwest mountains of Mexico City has attracted much attention since these parks have been experiencing a severe decline of unclear etiology. The high ozone levels in the area and the observed naked eye macroscopic, histological and cytological injuries on these species, strongly suggest an important contribution of tropospheric ozone to this deterioration process. Apart of historical short monitoring campaigns for measuring ozone levels in these mountains, it is known just a little is known about the present exposure levels at which the local vegetation is exposed. A continuous ozone analyzer has been in operation since 2011 at a high-elevation forest site (Parque Nacional Miguel Hidalgo, PNMH; 3110 m above mean sea level) located downwind of Mexico City Metropolitan Area (MCMA), in order to characterize the local ozone diel amplitude and its seasonal trend, as well as the influence of MCMA on the local O3 concentrations. Hourly average ozone data in PNMH shows that in general, the diel of ozone concentrations in the forest site has a statistical significant correlation with the pattern of ozone levels observed in several monitoring sites (smog receptor sites) within the MCMA, although the high elevation O3 levels are relatively lower than those in the urban area (around 2200 m above mean sea level). It is possible that a part of the oxidants in the air masses are removed by sink deposition processes during the air mass transport across the hills. The diel amplitude of ozone concentrations is small in the cold season, increasing as the seasons advance to June. As in the city, the highest ozone concentrations occur in April or May and the lowest levels during the rainy season, which extends from

  4. Dispersal of radioactivity by wildlife from contaminated sites in a forested landscape

    International Nuclear Information System (INIS)

    Garten, C.T. Jr.

    1992-01-01

    Oak Ridge National Laboratory (ORNL) is located within the Ridge and Valley physiographic province of eastern Tennessee (USA). This area is characterized by deciduous forests dominated by hardwood and mixed mesophytic tree species. Wildlife populations have access to some radioactively contaminated sites at ORNL, and contaminated animals or animal nests within the Laboratory's boundaries have been found to contain on the order of 10 -12 to 10 -6 Ci/g of 90 Sr or 137 Cs, and trace amounts of other radionuclides (including transuranic elements). Theoretical calculations indicate that nanocurie levels of 90 Sr in bone can arise from relatively small amounts (1%) of contaminated browse vegetation in a deer's diet. Measures that have been undertaken at ORNL to curtail the dispersal of radioactivity by animals are briefly reviewed

  5. Forest decline research in Northrhine-Westphalia at the regional research site Eggegebirge/Velmerstot

    International Nuclear Information System (INIS)

    Prinz, B.; Koeth, I.; Krause, G.H.M.; Thiele, V.

    1989-01-01

    In 1984 Northrhine Westfalia established a research program 'Air Pollution and Forest Decline'. Results of various experiments, carried out on the level of 1. epidemiological observations, 2. semi-controlled experiments in open-to-chambers as well as 3. controlled fumigation experiments are presented as an overview. Emphasis is put on field experiments at the regional research site Eggegebirge/Velmerstot, where the Landesanstalt fuer Immissionsschutz analysed among others yearly nutrient cycling and leaching phenomena of injured and healthy spruce trees (type: montanious yellowing). Deposition measurements were carried on a horizontal and vertical trajectory outside and inside a young spruce stand. Preliminary results showed that atmospheric acidic deposition accounts only for 1/3 of the acidification of the soil within the stand, where acidification processes are most prevalent. (orig.) [de

  6. Influences of climate, fire, and topography on contemporary age structure patterns of Douglas-fir at 205 old forest sites in western Oregon

    Science.gov (United States)

    Nathan J. Poage; Peter J. Weisberg; Peter C. Impara; John C. Tappeiner; Thomas S. Sensenig

    2009-01-01

    Knowledge of forest development is basic to understanding the ecology, dynamics, and management of forest ecosystems. We hypothesized that the age structure patterns of Douglas-fir at 205 old forest sites in western Oregon are extremely variable with long and (or) multiple establishment periods common, and that these patterns reflect variation in regional-scale climate...

  7. Carbon storage as affected by different site preparation techniques two years after mixed forest stand installation

    Energy Technology Data Exchange (ETDEWEB)

    Fonseca, F.; Figueiredo, T. de; Martins, A.

    2014-06-01

    Aim of study: This study aims at evaluating the impact of site preparation techniques prior to plantation on carbon storage and distribution in a young mixed stand of Pseudotsuga menziesii (PM) and Castanea sativa (CS). Area of study: The experimental field was established near Macedo de Cavaleiros, Northern Portugal, at 700 m elevation, mean annual temperature 12 degree centigrade and mean annual rainfall 678 mm. Material and methods: The experimental layout includes three replicates, where the different treatments corresponding to different tillage intensities were randomly distributed (high, moderate and slight intensity), in plots with an area of 375 m{sup 2} each. Twenty six months after forest stand installation, samples of herbaceous vegetation (0.49 m{sup 2} quadrat), forest species (8 PM and 8 CS) and mineral soil (at 0-5, 5-15, 15-30 and 30-60 cm depth) were collected in 15 randomly selected points in each treatment, processed in laboratory and analyzed for carbon by elemental carbon analyzer. Main results: The results obtained showed that: (i) more than 90% of the total carbon stored in the system is located in the soil, increasing in depth with tillage intensity; (ii) the contribution of herbaceous vegetation and related roots to the carbon storage is very low; (iii) the amount of carbon per tree is higher in CS than in PM; (iv) the global carbon storage was affected by soil tillage generally decreasing with the increase of tillage intensity. Accordingly, carbon storage capacity as affected by the application of different site preparation techniques should be a decision support tool in afforestation schemes. (Author)

  8. Characterization of BOR-60 Irradiated 14YWT-NFA1 Tubes

    Energy Technology Data Exchange (ETDEWEB)

    Saleh, Tarik A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Maloy, Stuart Andrew [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Aydogan, Eda [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Quintana, Matthew Estevan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Romero, Tobias J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-02-15

    Tubes of FCRD 14YWT-NFA1 Alloy were placed in the BOR-60 reactor and irradiated under a fast flux neutron environment to two conditions: 7 dpa at 360-370 °C and 6 dpa at 385-430 °C. Small sections of the tube were cut and sent to UC Berkeley for nanohardness testing and focused ion beam (FIB) milling of TEM specimens. FIB specimens were sent back to LANL for final FIB milling and TEM imaging. Hardness data and TEM images are presented in this report. This is the first fast reactor neutron irradiated information on the 14YWT-NFA1 alloy.

  9. Vegetation Succession on Degraded Sites in the Pomacochas Basin (Amazonas, N Peru—Ecological Options for Forest Restoration

    Directory of Open Access Journals (Sweden)

    Helge Walentowski

    2018-02-01

    Full Text Available The Andes of northern Peru are still widely covered with forests, but increasingly suffer from habitat fragmentation. Subsequent soil degradation often leads to the abandonment of overused forests and pastures. Ecological knowledge on the restoration potential, e.g., on dependencies of soil conditions and altitude, is scarce. Therefore, we compared soil and vegetation patterns along nine transects within the upper Pomacochas Basin, which is an important biodiversity corridor along the Andes, between remaining forests, succession sites and pastures. Anthropogenic successional and disturbance levels, geological substrate, and altitude have the most important ecological impacts on vegetation and tree species composition. Species responded to sandstone versus calcareous substrates, but also to depths of the organic soil layer, and light conditions. The absence of organic layers under pastures contrasted with the accumulation of thick organic layers under forest cover. Vegetation composition at succession sites revealed certain starting points (herbal stage, bush stage, or secondary forest for restoration that will determine the length of regeneration paths. Pre-forest patches of Alchornea sp. and Parathesis sp. may act as habitat stepping stones for expeditiously restoring biocorridors for wildlife. The key findings can contribute to the sustainable use and conservation of biodiversity in a fragile ecoregion.

  10. Atmospheric particulate mercury at the urban and forest sites in central Poland.

    Science.gov (United States)

    Siudek, Patrycja; Frankowski, Marcin; Siepak, Jerzy

    2016-02-01

    Particulate mercury concentrations were investigated during intensive field campaigns at the urban and forest sites in central Poland, between April 2013 and October 2014. For the first time, quantitative determination of total particulate mercury in coarse (PHg2.2) and fine (PHg0.7) aerosol samples was conducted in Poznań and Jeziory. The concentrations in urban fine and coarse aerosol fractions amounted to mercury concentrations. A strong impact of meteorological conditions (wind velocity, air mass direction, air temperature, and precipitation amount) on particulate mercury concentrations was also observed. In particular, higher variation and concentration range of PHg0.7 and PHg2.2 was reported for wintertime measurements. An increase in atmospheric particulate mercury during the cold season in the study region indicated that coal combustion, i.e., residential and industrial heating, is the main contribution factor for the selected particle size modes. Coarse particulate Hg at the urban site during summer was mainly attributed to anthropogenic sources, with significant contribution from resuspension processes and long-range transport. The highest values of PHg0.7 and PHg2.2 were found during westerly and southerly wind events, reflecting local emission from highly polluted areas. The period from late fall to spring showed that advection from the southern part of Poland was the main factor responsible for elevated Hg concentrations in fine and coarse particles in the investigated region. Moreover, September 2013 could be given as an example of the influence of additional urban activities which occurred approx. 10 m from the sampling site-construction works connected with replacement of the road surface, asphalting, etc. The concentrations of particulate Hg (>600.0 pg m(-3)) were much higher than during the following months when any similar situation did not occur. Our investigations confirmed that Hg in urban aerosol samples was predominantly related to local

  11. Bayesian spatial prediction of the site index in the study of the Missouri Ozark Forest Ecosystem Project

    Science.gov (United States)

    Xiaoqian Sun; Zhuoqiong He; John Kabrick

    2008-01-01

    This paper presents a Bayesian spatial method for analysing the site index data from the Missouri Ozark Forest Ecosystem Project (MOFEP). Based on ecological background and availability, we select three variables, the aspect class, the soil depth and the land type association as covariates for analysis. To allow great flexibility of the smoothness of the random field,...

  12. Development of floristic diversity in 10-year-old restoration forests on a bauxite mined site in Amazonia.

    Science.gov (United States)

    J. A. Parrotta; O. H. Knowles; J.M. Wunderle Jr.

    1997-01-01

    Patterns of plant and animal diversity were studied in a 10-year-old native species reforestation area at a bauxite-mined site at porto Trombetas in western Para State, Brazil. Understorey and overstorey floristic composition and structure, understorey light conditions, forest floor development and soil properties were evaluated in a total of 38 78.5-m2

  13. Direct radiative feedback due to biogenic secondary organic aerosol estimated from boreal forest site observations

    International Nuclear Information System (INIS)

    Lihavainen, Heikki; Asmi, Eija; Aaltonen, Veijo; Makkonen, Ulla; Kerminen, Veli-Matti

    2015-01-01

    We used more than five years of continuous aerosol measurements to estimate the direct radiative feedback parameter associated with the formation of biogenic secondary organic aerosol (BSOA) at a remote continental site at the edge of the boreal forest zone in Northern Finland. Our upper-limit estimate for this feedback parameter during the summer period (ambient temperatures above 10 °C) was −97 ± 66 mW m −2 K −1 (mean ± STD) when using measurements of the aerosol optical depth (f AOD ) and −63 ± 40 mW m −2 K −1 when using measurements of the ‘dry’ aerosol scattering coefficient at the ground level (f σ ). Here STD represents the variability in f caused by the observed variability in the quantities used to derive the value of f. Compared with our measurement site, the magnitude of the direct radiative feedback associated with BSOA is expected to be larger in warmer continental regions with more abundant biogenic emissions, and even larger in regions where biogenic emissions are mixed with anthropogenic pollution. (letter)

  14. Peculiarities of 137Cs accumulation by macromycetes in dry bors of Ukrainian Polessye

    International Nuclear Information System (INIS)

    Orlov, O.O.; Kurbet, T.B.; Kalyish, O.B.; Prishchepa, O.L.

    2001-01-01

    The main ecological peculiarities of dry bor in Ukrainian Polessye were given. Research were carried out in Central Polessie of Ukraine during 1997 - 1999. Results were obtained due to spectrometric measurement of specific activity of 137 Cs in fruit bodies of mushrooms and in the soil. Species composition of macromycetes was divided on homogeneous groups on intensity of 13 7Cs accumulation. Amanita porphyria, A. muscaria and Tricholoma portentosum belong to the group of weak 137 Cs accumulation from the soil (TF = 15 - 20); Amanita pantherina, A. phalloides, Cantharellus cibarius, Boletus edulis, Tricholoma flavovirens and Laccaria laccata - to the group of moderate radionuclide accumulation (TF = 30 - 55). The group of strong 137 Cs accumulation (TF = 100 - 180) consists of Suillus variegates, S. bovines and Hydnum imbricatum; and group of very strong accumulation (TF 200 - 280) - of Xerocomus badius, Lactarius rufus, Russula xerampelina, Cortinarius varius and Paxillus involutus. Cortinarius sanguineus (with TF 400) is an accumulator of 137 Cs. Comparative evaluation of dry bor was given from the point of view of purchase of edible macromycetes in it

  15. Final Technical Report: The effects of climate, forest age, and disturbance history on carbon and water processes at AmeriFlux sites across gradients in Pacific Northwest forests

    Energy Technology Data Exchange (ETDEWEB)

    Law, Beverly E. [Oregon State Univ., Corvallis, OR (United States)

    2016-12-03

    Investigate the effects of disturbance and climate variables on processes controlling carbon and water processes at AmeriFlux cluster sites in semi-arid and mesic forests in Oregon. The observations were made at three existing and productive AmeriFlux research sites that represent climate and disturbance gradients as a natural experiment of the influence of climatic and hydrologic variability on carbon sequestration and resulting atmospheric CO2 feedback that includes anomalies during the warm/ dry phase of the Pacific Decadal Oscillation.

  16. Lacustrine sedimentation in an altitude forest site, central Andes, Bolivia. Palaeo-climatic implications

    International Nuclear Information System (INIS)

    Sifeddine, A.; Bertaux, J.; Mourguiart, Ph.; Disnar, J.R.; Laggoun-Defarge, F.; Argollo, J.

    1998-01-01

    A sedimentological study of a 755 cm length core sampled in the middle of a marshy depression surrounded by a cloud forest in the central Andes reveals that this site has recorded important environmental variations during the last 50 000 years. For the most part (625 cm) the core is composed of detrital rich sediments deposited during the Upper Pleistocene. The highest amount of detrital influx underlines the Last Glacial Maximum which ranges from ca 29,000 14 C yr B.P. to ca 16,000 14 C yr B.P. (ca 18,500 cal yr B.P.), between two relatively humid phases. The sedimentation of the present Interglacial, starting at ca 12,500 14 C yr B.P. (14,500 cal yr B.P.), is mainly organic, as a consequence of the great development of soils and the forest vegetal cover the catchment area. The maximum extension of this vegetal cover ranging from 12,500 to ca 10,500 14 C yr B.P. (14,500 and 12,400 cal yr B.P.) is followed from 10,500 to 8,000 14 C yr B.P. (12,400 and 8,800 cal yr B.P.) by a drier period is revealed by the occurrence of micro-charcoals in the sediment. Between ca 8,000 and 4,000 14 C yr B.P. (8,800 and 4,500 cal yr B.P.), the sharp increase of micro-charcoals content, likely related to palaeo-fires, underlines an intensification of this dry trend. (authors)

  17. Changing forest water yields in response to climate warming: results from long-term experimental watershed sites across North America

    Science.gov (United States)

    Creed, Irena F; Spargo, Adam T; Jones, Julia A; Buttle, Jim M; Adams, Mary B; Beall, Fred D; Booth, Eric G; Campbell, John L; Clow, Dave; Elder, Kelly; Green, Mark B; Grimm, Nancy B; Miniat, Chelcy; Ramlal, Patricia; Saha, Amartya; Sebestyen, Stephen; Spittlehouse, Dave; Sterling, Shannon; Williams, Mark W; Winkler, Rita; Yao, Huaxia

    2014-01-01

    Climate warming is projected to affect forest water yields but the effects are expected to vary. We investigated how forest type and age affect water yield resilience to climate warming. To answer this question, we examined the variability in historical water yields at long-term experimental catchments across Canada and the United States over 5-year cool and warm periods. Using the theoretical framework of the Budyko curve, we calculated the effects of climate warming on the annual partitioning of precipitation (P) into evapotranspiration (ET) and water yield. Deviation (d) was defined as a catchment's change in actual ET divided by P [AET/P; evaporative index (EI)] coincident with a shift from a cool to a warm period – a positive d indicates an upward shift in EI and smaller than expected water yields, and a negative d indicates a downward shift in EI and larger than expected water yields. Elasticity was defined as the ratio of interannual variation in potential ET divided by P (PET/P; dryness index) to interannual variation in the EI – high elasticity indicates low d despite large range in drying index (i.e., resilient water yields), low elasticity indicates high d despite small range in drying index (i.e., nonresilient water yields). Although the data needed to fully evaluate ecosystems based on these metrics are limited, we were able to identify some characteristics of response among forest types. Alpine sites showed the greatest sensitivity to climate warming with any warming leading to increased water yields. Conifer forests included catchments with lowest elasticity and stable to larger water yields. Deciduous forests included catchments with intermediate elasticity and stable to smaller water yields. Mixed coniferous/deciduous forests included catchments with highest elasticity and stable water yields. Forest type appeared to influence the resilience of catchment water yields to climate warming, with conifer and deciduous catchments more susceptible to

  18. Nitrogen in soil water at five nitrogen-enriched forest sites in Sweden

    International Nuclear Information System (INIS)

    Ring, Eva

    2001-01-01

    Increased inputs of N to forest land may increase acidification and eutrophication. This thesis deals with N in soil water at 50 cm depth in N-enriched coniferous forests in Sweden. The experimental sites were enriched in N, either by fertilization or deposition. Soil water was collected by suction cups at varying degrees of N enrichment, after clear felling at two sites in central (Billingsjoen) and S Sweden (Farabol), and in three closely situated Norway spruce stands in SW Sweden. Billingsjoen was fertilized with ammonium nitrate at totals of 360-1800 kg N ha -1 , and Farabol with urea at totals of 600 kg N ha -1 . At clearfelling, which was performed six and seven years after the last fertilization, the soil N storage was increased by fertilization at Billingsjoen but not at Farabol. At Billingsjoen, the soil-water concentration of nitrate increased with increasing N dose. The increased nitrate concentrations reduced pH by up to nearly two units. In the eighth year after clear felling, the effects on all major cations and anions in the control, the 360 and 1800 kg N ha -1 treatments were examined. At the high N dose, nitrate and aluminium had significantly increased, and the pH and acid-neutralizing capacity had decreased, compared with the control and the low N dose. At Farabol, the estimated total leaching of nitrate-N in the control surpassed that of the N treatment by approximately 40%. The difference in leaching appears attributable to the greater biomass and N storage of the field-layer vegetation in the N treatment than in the control. At Farabol, the field-layer vegetation seems to have acted as an important sink for N as opposed to the Billingsjoen clearcut where the field layer was sparse. The Norway spruce stands in SW Sweden had a similar N deposition, but the concentrations of nitrate in soil water and estimated leaching rates differed substantially. In the soil with the highest leaching rate, potential nitrification was largest and the C to N

  19. Energy Efficiency, Water Efficiency, and Renewable Energy Site Assessment: San Juan National Forest - Dolores Ranger District, Colorado

    Energy Technology Data Exchange (ETDEWEB)

    Kandt, Alicen J. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Kiatreungwattana, Kosol [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2018-01-26

    This report summarizes the results from an energy efficiency, water efficiency, and renewable energy site assessment of the Dolores Ranger District in the San Juan National Forest in Colorado. A team led by the U.S. Department of Energy's National Renewable Energy Laboratory (NREL) conducted the assessment with United States Forest Service (USFS) personnel on August 16-17, 2016, as part of ongoing efforts by USFS to reduce energy and water use and implement renewable energy technologies. The assessment is approximately an American Society of Heating, Refrigerating, and Air-Conditioning Engineers Level 2 audit and meets Energy Independence and Security Act requirements.

  20. Finanční analýza podniku BRISK Tábor, a.s.

    OpenAIRE

    Hašek, Jan

    2008-01-01

    Diploma is focused on Financial analysis, importance of it, users, implementation analysis on factual company -- BRISK Tábor, a.s., evaluation based on analysis financial statements, ratio indicators, working capital, balance order, scheme of indicators, analysis of financial arm and comparison intercompany.

  1. Finanční analýza podniku IDEAL AUTOMOTIVE Bor, s.r.o.

    OpenAIRE

    Velebová, Štěpánka

    2009-01-01

    The aim of this bachelor thesis is to identify the financial situation of IDEAL AUTOMOTIVE Bor, Ltd., determine the strenghts and weaknesses of the company, and suggest some ideas of what to do in the future, so that the company could prosper

  2. Monitoring the Effect of Internet Use on Students Behavior Case Study: Technical Faculty Bor, University of Belgrade

    Science.gov (United States)

    Niculovic, Milica; Zivkovic, Dragana; Manasijevic, Dragan; Strbac, Nada

    2012-01-01

    A large number of criteria for evaluating Internet addiction have been developed recently. The research of Internet addiction among students of the Technical faculty in Bor, University of Belgrade has been conducted and its results are presented in this paper. The study included 270 students using criteria of Young's Internet Addiction Test. In…

  3. Charcoal kiln sites, associated landscape attributes and historic forest conditions: DTM-based investigations in Hesse (Germany

    Directory of Open Access Journals (Sweden)

    Marcus Schmidt

    2016-03-01

    Full Text Available Background An examination of the distribution of ancient charcoal kiln sites in the forest landscape seems to be worthwhile, since general trends in the selection of suitable kiln site locations in the past might become obvious. In this way forest landscape elements with a more intense usage by charcoal burning can be identified. By doing this, we can expect to gain information on the former condition and tree species composition of woodland. Investigations on the spatial distribution of charcoal kiln sites in relation to landscape attributes are sparse, however, probably due to the high on-site mapping effort. The outstanding suitability of LiDAR-derived digital terrain models (DTMs for the detection of charcoal kiln sites has been recently proved. Hence, DTM-based surveys of charcoal kiln sites represent a promising attempt to fill this research gap. Methods Based on DTM-based surveys, we analyzed the spatial distribution of charcoal kiln sites in two forest landscapes in the German federal state of Hesse: Reinhardswald and Kellerwald-Edersee National Park. In doing so, we considered the landscape attibutes "tree species composition", “water supply status”, “nutrient supply status”, “soil complex classes”, “altitude”, “exposition”, and “inclination”. Results We found that charcoal kiln sites were established preferably on hillside locations that provided optimal growing and regeneration conditions for European beech (Fagus sylvatica due to their acidic brown soils and sufficient water supply. These results are in line with instructions for the selection of appropriate kiln site locations, found in literature from the 18th to the 19th century. Conclusions We conclude that there were well-stocked, beech-dominated deciduous forest stands in northern Hesse before 1800, particularly at poorly accessible hillside locations. These large stocks of beech wood were utilized by the governments of the different Hessian territories

  4. Macromycetes diversity of pine-tree plantings on a post-fire forest site in Notecka Forest (NW Poland

    Directory of Open Access Journals (Sweden)

    Stefan Friedrich

    2014-08-01

    Full Text Available The article presents the results of a study on fungi in pine-tree plantings after the last great fire in Notecka Forest. The occurrence of 134 species of fungi and 3 species of myxomycetes was recorded in 25 permanent study areas investigated between 1993 and 1998. The particpalion of bio-ecological of macromycetes was described in the context of vegetation changes in the years following the fire.

  5. Tethered balloon measurements of biogenic volatile organic compounds at a Boreal forest site

    Directory of Open Access Journals (Sweden)

    C. Spirig

    2004-01-01

    Full Text Available Measurements of biogenic volatile organic compounds (VOCs were performed at Hyytiälä, a Boreal forest site in Southern Finland as part of the OSOA (origin and formation of secondary organic aerosol project in August 2001. At this site, frequent formation of new particles has been observed and the role of biogenic VOCs in this process is still unclear. Tethered balloons served as platforms to collect VOC samples within the planetary boundary layer at heights up to 1.2 km above ground during daytime. Mean mixed layer concentrations of total monoterpenes varied between 10 and 170 pptv, with a-pinene, limonene and D3-carene as major compounds, isoprene was detected at levels of 2-35 pptv. A mixed layer gradient technique and a budget approach are applied to derive surface fluxes representative for areas of tens to hundreds of square kilometres. Effects of spatial heterogeneity in surface emissions are examined with a footprint analysis. Depending on the source area considered, mean afternoon emissions of the sum of terpenes range between 180 and 300 mg m-2 h-1 for the period of 2-12 August 2001. Surface fluxes close to Hyytiälä were higher than the regional average, and agree well with mean emissions predicted by a biogenic VOC emission model. Total rates of monoterpene oxidation were calculated with a photochemical model. The rates did not correlate with the occurrence of new particle formation, but the ozone pathway was of more importance on days with particle formation. Condensable vapour production from the oxidation of monoterpenes throughout the mixed layer can only account for a fraction of the increase in aerosol mass observed at the surface.

  6. Challenges for Community-Based Forest Management in the KoloAla Site Manompana

    Science.gov (United States)

    Urech, Zora Lea; Sorg, Jean-Pierre; Felber, Hans Rudolph

    2013-03-01

    Following the IUCN 5th World Congress on Protected Areas in 2003, the then-President of Madagascar decided to increase the area of Madagascar's protected areas from 1.7 to 6 million ha. To combine the aims of protection and timber production, a new concept was developed through the establishment of community-based forest management (CBFM) sites, called KoloAla. However, experience shows that similar management transfers to communities in Madagascar have only been successful in a very few cases. We aimed to explore the success to be expected of this new approach in the particular case of the Manompana corridor at Madagascar's eastern coast. In a first step, the readiness of the corridor's resource users for CBFM has been analysed according to the seven resource users' attributes developed by Ostrom that predict an effective self-organized resource management. In a second step, we explored how KoloAla addresses known challenges of Madagascar's CBFM. Analyses lead in a rather sober conclusion. Although KoloAla attempts to address the goals of poverty alleviation, biodiversity conservation and timber production under a single umbrella, it does so in a rather non-innovative way. Challenges with regard to the state's environmental governance, agricultural inefficiency and thus deforestation remain unsolved.

  7. LBA-ECO TG-02 Biogenic VOC Emissions from Brazilian Amazon Forest and Pasture Sites

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set reports concentrations of biogenic volatile organic compounds (BVOCs) collected from tethered balloon-sampling platforms above selected forest and...

  8. Effect of Disturbance Regimes on Spatial Patterns of Tree Species in Three Sites in a Tropical Evergreen Forest in Vietnam

    Directory of Open Access Journals (Sweden)

    Do Thi Ngoc Le

    2016-01-01

    Full Text Available The effects of disturbance regimes on the spatial patterns of the five most abundant species were investigated in three sites in a tropical forest at Xuan Nha Nature Reserve, Vietnam. Three permanent one-ha plots were established in undisturbed forest (UDF, lightly disturbed forest (LDF, and highly disturbed forest (HDF. All trees ≥5 cm DBH were measured in twenty-five 20 m × 20 m subplots. A total of 57 tree species belonging to 26 families were identified in the three forest types. The UDF had the highest basal area (30 m2 ha−1, followed by the LDF (17 m2 ha−1 and the HDF (13.0 m2 ha−1. The UDF also had the highest tree density (751 individuals ha−1 while the HDF held the lowest (478 individuals ha−1. Across all species, there were 417 “juveniles,” 267 “subadults,” and 67 “adults” in the UDF, while 274 “juveniles,” 230 “subadults,” and 36 “adults” were recorded in the LDF. 238 “juveniles,” 227 “subadults,” and 13 “adults” were obtained in the HDF. The univariate and bivariate data with pair- and mark-correlation functions of intra- and interspecific interactions of the five most abundant species changed in the three forest types. Most species indicated clumping or regular distributions at small scale, but a high ratio of negative interspecific small-scale associations was recorded in both the LDF and HDF sites. These were, however, rare in the UDF.

  9. DRP1-Dependent Endocytosis is Essential for Polar Localization and Boron-Induced Degradation of the Borate Transporter BOR1 in Arabidopsis thaliana.

    Science.gov (United States)

    Yoshinari, Akira; Fujimoto, Masaru; Ueda, Takashi; Inada, Noriko; Naito, Satoshi; Takano, Junpei

    2016-09-01

    Boron (B) is essential for plants but toxic in excess. The borate efflux transporter BOR1 is expressed in various root cells and localized to the inner/stele-side domain of the plasma membrane (PM) under low-B conditions. BOR1 is rapidly degraded through endocytosis upon sufficient B supply. The polar localization and degradation of BOR1 are considered important for efficient B translocation and avoidance of B toxicity, respectively. In this study, we first analyzed the subcellular localization of BOR1 in roots, cotyledons and hypocotyls, and revealed a polar localization in various cell types. We also found that the inner polarity of BOR1 is established after completion of cytokinesis in the root meristem. Moreover, variable-angle epifluorescence microscopy visualized BOR1-green fluorescent protein (GFP) as particles in the PM with significant lateral movements but in restricted areas. Importantly, a portion of BOR1-GFP particles co-localized with DYNAMIN-RELATED PROTEIN 1A (DRP1A), which is involved in scission of the clathrin-coated vesicles, and they disappeared together from the PM. To examine the contribution of DRP1A-mediated endocytosis to BOR1 localization and degradation, we developed an inducible expression system of the DRP1A K47A variant. The DRP1A variant prolonged the residence time of clathrin on the PM and inhibited endocytosis of membrane lipids. The dominant-negative DRP1A blocked endocytosis of BOR1 and disturbed its polar localization and B-induced degradation. Our results provided insight into the endocytic mechanisms that modulate the subcellular localization and abundance of a mineral transporter for nutrient homeostasis in plant cells. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  10. Modeling dynamics of {sup 137}Cs in forest surface environments: Application to a contaminated forest site near Fukushima and assessment of potential impacts of soil organic matter interactions

    Energy Technology Data Exchange (ETDEWEB)

    Ota, Masakazu, E-mail: ohta.masakazu@jaea.go.jp; Nagai, Haruyasu; Koarashi, Jun

    2016-05-01

    A process-based model for {sup 137}Cs transfer in forest surface environments was developed to assess the dynamic behavior of Fukushima-derived {sup 137}Cs in a Japanese forest. The model simulation successfully reproduced the observed data from 3 year migration of {sup 137}Cs in the organic and mineral soil layers at a contaminated forest near Fukushima. The migration of {sup 137}Cs from the organic layer to the mineral soil was explained by the direct deposition pattern on the forest floor and the turnover of litter materials in the organic layer under certain ecological conditions. Long-term predictions indicated that more than 90% of the deposited {sup 137}Cs would remain within the top 5 cm of the soil for up to 30 years after the accident, suggesting that the forest acts as an effective long-term reservoir of {sup 137}Cs with limited transfer via the groundwater pathway. The model was also used to explore the potential impacts of soil organic matter (SOM) interactions on the mobility and bioavailability of {sup 137}Cs in the soil–plant system. The simulation results for hypothetical organic soils with modified parameters of {sup 137}Cs turnover revealed that the SOM-induced reduction of {sup 137}Cs adsorption elevates the fraction of dissolved {sup 137}Cs in the soil solution, thereby increasing the soil-to-plant transfer of {sup 137}Cs without substantially altering the fractional distribution of {sup 137}Cs in the soil. Slower fixation of {sup 137}Cs on the flayed edge site of clay minerals and enhanced mobilization of the clay-fixed {sup 137}Cs in organic-rich soils also appeared to elevate the soil-to-plant transfer of {sup 137}Cs by increasing the fraction of the soil-adsorbed (exchangeable) {sup 137}Cs. A substantial proportion (approximate 30%–60%) of {sup 137}Cs in these organic-rich soils was transferred to layers deeper than 5 cm decades later. These results suggested that SOM influences the behavior of {sup 137}Cs in forests over a prolonged

  11. Mechanical properties and TEM examination of RAFM steels irradiated up to 70 dpa in BOR-60

    Energy Technology Data Exchange (ETDEWEB)

    Gaganidze, E., E-mail: Ermile.Gaganidze@kit.edu [Karlsruher Institut fuer Technologie, Institut fuer Angewandte Materialien, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Petersen, C.; Materna-Morris, E.; Dethloff, C.; Weiss, O.J.; Aktaa, J. [Karlsruher Institut fuer Technologie, Institut fuer Angewandte Materialien, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Povstyanko, A.; Fedoseev, A.; Makarov, O.; Prokhorov, V. [Joint Stock Company ' State Scientific Centre Research Institute of Atomic Reactors' , 433510 Dimitrovgrad-10, Ulyanovsk Region (Russian Federation)

    2011-10-01

    Mechanical properties of Reduced Activation Ferritic/Martensitic (RAFM) steels were studied after irradiation in BOR-60 reactor to a neutron displacement damage of 70 dpa at 330-340 deg. C. Yield stress and Ductile-to-Brittle-Transition-Temperature of EUROFER97 indicate saturation of hardening and embrittlement. The phenomenological models for description of microstructure evolution and resulting irradiation hardening and embrittlement are discussed. The evolution of yield stress with dose is qualitatively understood within a Whapham and Makin model. Dislocation loops examined in TEM are considered a main source for low-temperature irradiation hardening. The analysis of the fatigue data in terms of the inelastic strain reveals comparable fatigue behaviour both for unirradiated and irradiated conditions, which can be described by a common Manson-Coffin relation. The study of helium effects in B-doped model steels indicated progressive material embrittlement with helium content. Post-irradiation annealing of RAFM steels yielded substantial recovery of mechanical properties.

  12. Engineering evaluation of a formerly utilized MED/AEC site. Site A and Plot M, Palos Forest Preserve, Palos Park, Illinois

    International Nuclear Information System (INIS)

    1979-09-01

    This engineering evaluation report (EER) addresses one of these MED/AEC sites known as Site A/Plot M, located in Palos Park, Illinois. The EER describes in technical detail a number of options for remedial action that could be taken with respect to the contamination at Site A/Plot M and presents estimates of the costs associated with these options. A companion document, Environmental Analysis Report on a Formerly Utilized MED/AEC Site, Site A and Plot M, Palos Forest Preserve, Palos Park, Illinois (ANL/ES-79), has also been prepared. It describes in detail the existing site environment and evaluates the environmental impacts of the various remedial options discussed in this report. This EER contributes to a better understanding of the mitigation or resolution of environmental problems posed by the subject MED/AEC site and serves as a basis for determining whether or not remedial actions are warranted. The knowledge derived from the evaluation of a number of remedial options should be helpful in the final disposition of other MED/AEC sites located elsewhere

  13. Volcanogenic Turonian and epiclastics of senonian in the Timok magmatic complex between Bor and the Tupižnica mountain, eastern Serbia

    Directory of Open Access Journals (Sweden)

    Đorđević Miodrag

    2005-01-01

    Full Text Available In the light of the findings presented in this paper, among the volcanic products of the Upper Cretaceous, referred to as "the first volcanic phase" (Drovenik, 1961, two lithostratigraphic units can be singled out within the Timok Magmatic Complex (TMC: - The lower one, consisting of volcanogenic, subaerial, dominantly hornblende andésite volcaniclastic, formed on land, and less abundant volcanic and sub-volcanic-hypoabyssal rocks. It is the main source of sulfide mine­ralization in Bor. It was formed before the Upper Turonian and consists of hornblende andésite and occasionally low biotite. Minor constituents are biotite-hornblende dacite and some andésite and dacite materials con­taining augite in addition to hornblende and biotite. - The upper one, from the Upper Turonian period when the volcanic activity of the region had ended, is marine deposited and epiclastic. Intercalated with Senonian marls, it is composed of land deposited Turonian volcanogenic material of all generations. Fresh material mostly consisting of hornblende andésite volcanoclastics prevails in it. Fresh epiclastics include ore mineral epiclasts. Epiclastics composed of epiclasts of hydro thermally altered rocks were observed which also include ore epiclasts. The ore epiclasts originate from copper ore. The boundary between the volcanogenic Turonian and the epiclastic deposits is a well-recognized unconformity. Table 1 in the text summarizes the main characteristics of the Turonian volcanogenic rocks, primarily those of volcaniclastics, as well as those of epiclastic deposits.

  14. Using Florida Keys Reference Sites As a Standard for Restoration of Forest Structure in Everglades Tree Islands

    International Nuclear Information System (INIS)

    Ross, M.S.; Sah, J.P.; Ruiz, P.L.; Ross, M.S.; Ogurcak, D.E.

    2010-01-01

    In south Florida, tropical hardwood forests (hammocks) occur in Everglades tree islands and as more extensive forests in coastal settings in the nearby Florida Keys. Keys hammocks have been less disturbed by humans, and many qualify as old-growth, while Everglades hammocks have received much heavier use. With improvement of tree island condition an important element in Everglades restoration efforts, we examined stand structure in 23 Keys hammocks and 69 Everglades tree islands. Based on Stand Density Index and tree diameter distributions, many Everglades hammocks were characterized by low stocking and under-representation in the smaller size classes. In contrast, most Keys forests had the dense canopies and open under stories usually associated with old-growth hardwood hammocks. Subject to the same caveats that apply to off-site references elsewhere, structural information from mature Keys hammocks can be helpful in planning and implementing forest restoration in Everglades tree islands. In many of these islands, such restoration might involve supplementing tree stocking by planting native trees to produce more complete site utilization and a more open under story.

  15. DEPENDENCE OF GRASS COVER TAXONOMIC AND ECOLOGICAL STRUCTURE ON THE ANTHROPOGENIC IMPACT IN FOREST ECOSYSTEMS

    Directory of Open Access Journals (Sweden)

    N. V. Miroshnik

    2016-01-01

    Full Text Available Pine forests Chigirinsky Bor grow on fresh sod-podzolic soils formed on ancient alluvial deposits. Pine forests are characterized by stringent moisture regimes and constantly suffer from lack of productive moisture in soil.  Industrial development of Cherkasy in 60th years of ХХ century leaded air pollution and emissions of SO2, NOx, NH3, and dust. This contributed to significant negative influence on the surrounding forest ecosystems from enterprises of  Cherkassy industrial agglomeration. The grass cover in pine stands of Chigirinsky Bor transforms into xerophytic grasses and ruderal communities under the impact of negative biotic and abiotic factors. They are namely the anthropogenic violation of forest conditions, stands decline, recreational and industrial tree crowns understocking, xerophytic and heliophytic transformations of forest conditions. All the above mentioned caused strong ruderal and adventive transformation of grass cover. We registered the changes in nitrophilous plant spread regards the Cherkasy industrial agglomeration approaching which emits toxic with nitrogen-containing gases. Adventive and other non-forest species displace ferns and mosses, the ratio of ecomorfs is also changes due to increase of the quantity and development activation of annuals, xerophytic, ruderal, and nitrofil plants. The Asteraceae/Brassicaceae 3:1 ratio indicates significant anthropogenic violations in the region. We fixed the xerophytic, ruderal, and adventive transformation of grass cover in forest ecosystems. It is also founded the tendency of expanding the fraction of mesophilic plant species due to alterations in water regime (creation of Kremenchug reservoir and draining of floodplain Tyasmyn. When approaching the Cherkasy industrial agglomeration the grass cover degradation is clearly observed on the environmental profile. All this causes the forest ecosystem degradation and gradual loss of forest vegetation typical characteristics. We

  16. The dependence of natural regeneration of forest trees on upper soil conditions and acidity at damaged sites in the Black Forest, Germany

    International Nuclear Information System (INIS)

    Littek, T.

    1993-06-01

    It was the goal of this study to investigate the influence of different upper soil conditions on the germination and establishment, as well as the growth, of young plants of various tree species. For this purpose, four test plots in the region of the Black Forest were laid out, in which, by various means of site preparation and fertilization, the upper soils were changed. Natural seeding of common spruce, European silver-fir, beech, sycamore maple, European mountainash, and grey alder was simulated by means of controlled sowing. For comparison, a greenhouse experiment was carried out, examining the germination and development of the same tree species in various soil substrata, using different fertilizers, and under the influence of artificial acid rain. The most important results - with a high level of variation depending on the tree species examined - can be summarized as follows: Based on the results of field and greenhouse experiments, as well as on the investigations of other authors, it can be concluded that natural regeneration of forest stands is considerably impeded under conditions of increasing soil acidity and by high acid depositions. This is seen directly as the result of unfavorable chemical conditions in the upper soil, as well as indirectly due to deteriorating competitiveness against other vegetation. Site preparation and lime or dolomite fertilization can be important measures in the practice of forestry, to encourage natural regeneration in highly acidic sites with an unfavourable humus layer and a high presence of competing vegetation. (orig./UWA). 2 figs., 85 tabs., 269 refs [de

  17. Public Preferences Across Europe for Different Forest Stand Types as Sites for Recreation

    Directory of Open Access Journals (Sweden)

    David M. Edwards

    2012-03-01

    Full Text Available A Delphi survey involving experts in forest preference research was carried out to derive scores for the recreational value of 240 forest stand types across Europe. The survey was organized around four regional panels: Great Britain, Nordic Region, Central Europe, and Iberia. In each region, 60 forest stand types were defined according to five forest management alternatives (FMAs on a continuum of management intensity, four phases of development (establishment, young, medium, and adult, and three tree species types (conifer, broadleaved, and mixed stands of conifer and broadleaved. The resulting scores were examined using conjoint analysis to determine the relative importance of the three structural attributes (FMA, phase of development, and tree species type, and each level or component of the attributes. The findings quantify the extent to which forest visitors prefer a degree of management to unmanaged forest nature reserves across the four regions. Phase of development was shown to make the highest contribution to the recreational value of forests while the contribution of tree species type was shown to be relatively unimportant. While the results are indicative, they provide evidence to support long-term retention and low-impact silviculture in forests where recreation is a primary objective of management.

  18. Opportunities and uses of biochar on forest sites in North America [Chapter 15

    Science.gov (United States)

    Deborah S. Page-Dumroese; Mark D. Coleman; Sean C. Thomas

    2017-01-01

    Biochar may be useful for restoring or revitalizing degraded forest soils and help with carbon sequestration, nutrient leaching losses, and reducing greenhouse gas emissions. However, biochar is not currently widely used on forested lands across North America. This chapter provides an overview of several biochar experiments conducted in North America and discusses the...

  19. Initial Response of Pine Seedlings and Weeds to Dried Sewage Sludge in Rehabilitation of an Eroded Forest Site

    Science.gov (United States)

    Charles R. Berry

    1977-01-01

    Dried sewage sludge was applied at rates of 0, 17, 34, and 69 metric tons/ha on a badly eroded forest site in the Piedmont region of northeast Georgia. Production of weed bio mass varied directly with amount of sludge applied. Heigh growth for both shortleafand loblolly pine seedlings appeared to be greater on plots receiving 17 metric tons of sludge/ha, bu differences...

  20. Allometric Scaling and Resource Limitations Model of Total Aboveground Biomass in Forest Stands: Site-scale Test of Model

    Science.gov (United States)

    CHOI, S.; Shi, Y.; Ni, X.; Simard, M.; Myneni, R. B.

    2013-12-01

    Sparseness in in-situ observations has precluded the spatially explicit and accurate mapping of forest biomass. The need for large-scale maps has raised various approaches implementing conjugations between forest biomass and geospatial predictors such as climate, forest type, soil property, and topography. Despite the improved modeling techniques (e.g., machine learning and spatial statistics), a common limitation is that biophysical mechanisms governing tree growth are neglected in these black-box type models. The absence of a priori knowledge may lead to false interpretation of modeled results or unexplainable shifts in outputs due to the inconsistent training samples or study sites. Here, we present a gray-box approach combining known biophysical processes and geospatial predictors through parametric optimizations (inversion of reference measures). Total aboveground biomass in forest stands is estimated by incorporating the Forest Inventory and Analysis (FIA) and Parameter-elevation Regressions on Independent Slopes Model (PRISM). Two main premises of this research are: (a) The Allometric Scaling and Resource Limitations (ASRL) theory can provide a relationship between tree geometry and local resource availability constrained by environmental conditions; and (b) The zeroth order theory (size-frequency distribution) can expand individual tree allometry into total aboveground biomass at the forest stand level. In addition to the FIA estimates, two reference maps from the National Biomass and Carbon Dataset (NBCD) and U.S. Forest Service (USFS) were produced to evaluate the model. This research focuses on a site-scale test of the biomass model to explore the robustness of predictors, and to potentially improve models using additional geospatial predictors such as climatic variables, vegetation indices, soil properties, and lidar-/radar-derived altimetry products (or existing forest canopy height maps). As results, the optimized ASRL estimates satisfactorily

  1. MODIS snow cover mapping accuracy in a small mountain catchment – comparison between open and forest sites

    Directory of Open Access Journals (Sweden)

    G. Blöschl

    2012-07-01

    Full Text Available Numerous global and regional validation studies have examined MODIS snow mapping accuracy by using measurements at climate stations, which are mainly at open sites. MODIS accuracy in alpine and forested regions is, however, still not well understood. The main objective of this study is to evaluate MODIS (MOD10A1 and MYD10A1 snow cover products in a small experimental catchment by using extensive snow course measurements at open and forest sites. The MODIS accuracy is tested in the Jalovecky creek catchment (northern Slovakia in the period 2000–2011. The results show that the combined Terra and Aqua images enable snow mapping at an overall accuracy of 91.5%. The accuracies at forested, open and mixed land uses at the Červenec sites are 92.7%, 98.3% and 81.8%, respectively. The use of a 2-day temporal filter enables a significant reduction in the number of days with cloud coverage and an increase in overall snow mapping accuracy. In total, the 2-day temporal filter decreases the number of cloudy days from 61% to 26% and increases the snow mapping accuracy to 94%. The results indicate three possible factors leading to misclassification of snow as land: patchy snow cover, limited MODIS geolocation accuracy and mapping algorithm errors. Out of a total of 27 misclassification cases, patchy snow cover, geolocation issues and mapping errors occur in 12, 12 and 3 cases, respectively.

  2. Characterization of organic nitrogen in aerosols at a forest site in the southern Appalachian Mountains

    Science.gov (United States)

    Chen, Xi; Xie, Mingjie; Hays, Michael D.; Edgerton, Eric; Schwede, Donna; Walker, John T.

    2018-05-01

    This study investigates the composition of organic particulate matter in PM2.5 in a remote montane forest in the southeastern US, focusing on the role of organic nitrogen (N) in sulfur-containing secondary organic aerosol (nitrooxy-organosulfates) and aerosols associated with biomass burning (nitro-aromatics). Bulk water-soluble organic N (WSON) represented ˜ 14 % w/w of water-soluble total N (WSTN) in PM2.5 on average across seasonal measurement campaigns conducted in the spring, summer, and fall of 2015. The largest contributions of WSON to WSTN were observed in spring ( ˜ 18 % w/w) and the lowest in the fall ( ˜ 10 % w/w). On average, identified nitro-aromatic and nitrooxy-organosulfate compounds accounted for a small fraction of WSON, ranging from ˜ 1 % in spring to ˜ 4 % in fall, though were observed to contribute as much as 28 % w/w of WSON in individual samples that were impacted by local biomass burning. The highest concentrations of oxidized organic N species occurred during summer (average of 0.65 ng N m-3) along with a greater relative abundance of higher-generation oxygenated terpenoic acids, indicating an association with more aged aerosol. The highest concentrations of nitro-aromatics (e.g., nitrocatechol and methyl-nitrocatechol), levoglucosan, and aged SOA tracers were observed during fall, associated with aged biomass burning plumes. Nighttime nitrate radical chemistry is the most likely formation pathway for nitrooxy-organosulfates observed at this low NOx site (generally chemistry and deposition of reactive N.

  3. Forest road and fuel break siting with respect to reference fire intensities

    Energy Technology Data Exchange (ETDEWEB)

    Eastaugh, C. S.; Molina, D. M.

    2012-11-01

    Forest roads and permanent fuel breaks are an important part of fire suppression infrastructure, but due to maintenance and environmental costs many forest agencies seek to reduce the extent of these networks. The question of which roads should be retained or where fuel breaks should be established is contentious, and few quantified methods exist to aid management decisions. This study uses GIS procedures and develops a metric for road network vulnerability, which may be used to determine the relative effectiveness of a road network or a particular fuel break as a fire control line. The method constructs reference fire intensities, and compares the fire intensity at roadsides or fuel breaks with the overall forest average. In the case study area in Victoria's Central Highlands (southeast Australia), average fire intensities on the forest road network are found to closely match the forest average, indicating that roads in their current locations are not skewed towards more dangerous parts of the forest. The fuel break network however is likely to face fire intensities substantially greater than those in the average forest area. (Author) 33 refs.

  4. Observation and Analysis of Particle Nucleation at a Forest Site in Southeastern US

    Directory of Open Access Journals (Sweden)

    Viney Aneja

    2013-04-01

    Full Text Available This study examines the characteristics of new particle formation at a forest site in southeastern US. Particle size distributions above a Loblolly pine plantation were measured between November 2005 and September 2007 and analyzed by event type and frequency, as well as in relation to meteorological and atmospheric chemical conditions. Nucleation events occurred on 69% of classifiable observation days. Nucleation frequency was highest in spring. The highest daily nucleation (class A and B events frequency (81% was observed in April. The average total particle number concentration on nucleation days was 8,684 cm−3 (10 < Dp < 250 nm and 3,991 cm−3 (10 < Dp < 25 nm with a mode diameter of 28 nm with corresponding values on non-nucleation days of 2,143 cm−3, 655 cm−3, and 44.5 nm, respectively. The annual average growth rate during nucleation events was 2.7 ± 0.3 nm·h−1. Higher growth rates were observed during summer months with highest rates observed in May (5.0 ± 3.6 nm·h−1. Winter months were associated with lower growth rates, the lowest occurring in February (1.2 ± 2.2 nm·h−1. Consistent with other studies, nucleation events were more likely to occur on days with higher radiative flux and lower relative humidity compared to non-nucleation days. The daily minimum in the condensation sink, which typically occurred 2 to 3 h after sunrise, was a good indicator of the timing of nucleation onset. The intensity of the event, indicated by the total particle number concentration, was well correlated with photo-synthetically active radiation, used here as a surrogate for total global radiation, and relative humidity. Even though the role of biogenic VOC in the initial nuclei formation is not understood from this study, the relationships with chemical precursors and secondary aerosol products associated with nucleation, coupled with diurnal boundary layer dynamics and seasonal meteorological patterns, suggest that H2SO4 and biogenic

  5. Inventory of forest and rangeland and detection of forest stress. [Manitou, Colorado, Atlanta, Georgia, and Black Hills test sites

    Science.gov (United States)

    Heller, R. C.; Aldrich, R. C.; Weber, F. P.; Driscoll, R. S. (Principal Investigator)

    1973-01-01

    The author has identified the following significant results. Eucalyptus tree stands killed by low temperatures in December 1972 were outlined by image enhancement of two separate dates of ERTS-1 images (January 22, 1973-I.D. 1183-18175 and April 22, 1973-I.D. 1273-18183). Three stands larger than 500 meters in size were detected very accurately. In Colorado, range and grassland communities were analyzed by visual interpretation of color composite scene I.D. 1028-17135. It was found that mixtures of plant litter, amount and kind of bare soil, and plant foliage cover made classification of grasslands very difficult. Changes in forest land use were detected on areas as small as 5 acres when ERTS-1 color composite scene 1264-15445 (April 13, 1973) was compared with 1966 ASCS index mosaics (scale 1:60,000). Verification of the changes were made from RB-57 underflight CIR transparencies (scale 1:120,000).

  6. How does litter quality and site heterogeneity interact on decomposer food webs of a semi-natural forest?

    DEFF Research Database (Denmark)

    Strandmark, Lisa Bjørnlund; Christensen, Søren

    2005-01-01

    The relative importance of litter quality and site heterogeneity on population dynamics of decomposer food webs was investigated in a semi-natural mixed deciduous forest in Denmark. Litterbags containing beech or ash leaves were placed in four plots. Plots were located within gaps and under closed...... at the end of the study period. At the first sampling, where bacterial activity prevailed, the relative abundance of the two dominant bacterial-feeders, Rhabditidae (fast growing) and Plectus spp. (slower growing), depended more on site than litter type. At the second sampling where fungal activity became...... in the decomposer food web, site effects were also detected and nematode functional groups responded more to site than to litter quality early on in the decomposition process....

  7. Jointly optimizing selection of fuel treatments and siting of forest biomass-based energy production facilities for landscape-scale fire hazard reduction.

    Science.gov (United States)

    Peter J. Daugherty; Jeremy S. Fried

    2007-01-01

    Landscape-scale fuel treatments for forest fire hazard reduction potentially produce large quantities of material suitable for biomass energy production. The analytic framework FIA BioSum addresses this situation by developing detailed data on forest conditions and production under alternative fuel treatment prescriptions, and computes haul costs to alternative sites...

  8. Black-chinned hummingbird nest-site selection and nest survival in response to fuel reduction in a southwestern riparian forest

    Science.gov (United States)

    D. Max Smith; Deborah M. Finch; David L. Hawksworth

    2009-01-01

    Despite widespread efforts to avert wildfire by reducing the density of flammable vegetation, little is known about the effects of this practice on the reproductive biology of forest birds. We examined nest-site selection and nest survival of the Black-chinned Hummingbird (Archilochus alexandri) in New Mexico riparian forests treated or not for fuel...

  9. Evaluating Site-Specific and Generic Spatial Models of Aboveground Forest Biomass Based on Landsat Time-Series and LiDAR Strip Samples in the Eastern USA

    Science.gov (United States)

    Ram Deo; Matthew Russell; Grant Domke; Hans-Erik Andersen; Warren Cohen; Christopher Woodall

    2017-01-01

    Large-area assessment of aboveground tree biomass (AGB) to inform regional or national forest monitoring programs can be efficiently carried out by combining remotely sensed data and field sample measurements through a generic statistical model, in contrast to site-specific models. We integrated forest inventory plot data with spatial predictors from Landsat time-...

  10. Concentrations and content of mercury in bark, wood, and leaves in hardwoods and conifers in four forested sites in the northeastern USA

    Science.gov (United States)

    Yang Yang; Ruth D. Yanai; Charles T. Driscoll; Mario Montesdeoca; Kevin T. Smith

    2018-01-01

    Mercury (Hg) is deposited from the atmosphere to remote areas such as forests, but the amount of Hg in trees is not well known. To determine the importance of Hg in trees, we analyzed foliage, bark and bole wood of eight tree species at four sites in the northeastern USA (Huntington Forest, NY; Sleepers River, VT; Hubbard Brook, NH; Bear Brook, ME). Foliar...

  11. Using model analyses and surface-atmosphere exchange measurements from the Howland AmeriFlux Site in Maine, USA, to improve understanding of forest ecosystem C cycling

    Energy Technology Data Exchange (ETDEWEB)

    Hollinger, David Y.; Davidson, Eric A.; Richardson, Andrew D.; Dail, D. B.; Scott, N.

    2013-03-25

    Summary of research carried out under Interagency Agreement DE-AI02-07ER64355 with the USDA Forest Service at the Howland Forest AmeriFlux site in central Maine. Includes a list of publications resulting in part or whole from this support.

  12. NPP Tropical Forest: Consistent Worldwide Site Estimates, 1967-1999, R1

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains documented field measurements of NPP components for 39 old-growth tropical forests distributed worldwide between latitudes 23.58 N and 23.58...

  13. A meta-database comparison from various European Research and Monitoring Networks dedicated to forest sites

    Czech Academy of Sciences Publication Activity Database

    Danielewska, A.; Clarke, N.; Olejnik, Janusz; Hansen, K.; de Vries, W.; Lundin, L.; Tuovinen, J-P.; Fischer, R.; Urbaniak, M.; Paoletti, E.

    2013-01-01

    Roč. 6, JAN 2013 (2013), s. 1-9 ISSN 1971-7458 Institutional support: RVO:67179843 Keywords : Research and Monitoring Network * Meta- database * Forest * Monitoring Subject RIV: EH - Ecology, Behaviour Impact factor: 1.150, year: 2013

  14. Control of dry season evapotranspiration over the Amazonian forest as inferred from observations at a southern Amazon forest site

    NARCIS (Netherlands)

    Negrón Juárez, R.I.; Hodnett, M.G.; Fu, R.; Goulden, M.L.; Randow, von C.

    2007-01-01

    The extent to which soil water storage can support an average dry season evapotranspiration (ET) is investigated using observations from the Rebio Jarú site for the period of 2000 to 2002. During the dry season, when total rainfall is less than 100 mm, the soil moisture storage available to root

  15. Climatic Characteristics of the Subtropical Mountainous Cloud Forest at the Yuanyang Lake Long-Term Ecological Research Site, Taiwan

    Directory of Open Access Journals (Sweden)

    I-Ling Lai

    2006-12-01

    Full Text Available To better understand the climatic characteristics in a subtropical mountainous cloud forest at the Yuanyang Lake long-term ecological research site, weather data collected from January 1994 to December 2004 were analyzed in the present study. The obvious seasonal changes in climatic factors were observed at this site. The annual mean air temperature was 12.7°C. The lowest temperature was recorded in February (monthly mean 5.9°C, and the highest one was taken in July (monthly mean 18.1°C. Winter featured light rain with a prolonged occurrence of fog, resulting in a large reduction of radiation. In summer, fog occurred once in the early morning and the other time from afternoon to evening. The latter one was associated with the wind direction changes and usually accompanied with short moderate to heavy convective rain. Consequently the photosynthetic photon flux density (PPFD was high in the morning but reduced drastically in the afternoon. Typhoons occurred in the summer had contributed to 37% of the annual rainfall, usually resulting in torrential rain events and sharp increases in the water level of this lake. As a matter of fact, perhumid environment of this site was attributed to abundant rainfall (mean annual precipitation 3396 mm and high frequency (up to 40% of foggy time. Such conditions would reduce the intensity of solar radiation and PPFD. The average annual solar radiation at the site was 2475 MJ m-2, and annual PPFD was 5713 mol m-2. The average degree of reduction of PPFD under foggy condition was up to 88%. Such climatic characteristics are suggested to constrain the growth of plants and play an important role in competition among plant species in this cloud forest. It is considered that the distinct seasonal fluctuation in environmental factors, perhumid and dim light conditions are the most distinguished characteristics of this subtropical mountainous cloud forest ecosystem.

  16. Influence of environmental variables on the shrub and tree species distribution in two Semideciduous Forest sites in Viçosa, Minas Gerais, Brazil.

    Science.gov (United States)

    Pinto, Sheila Isabel do C; Martins, Sebastião V; de Barros, Nairam F; Dias, Herly Carlos T; Kunz, Sustanis H

    2008-09-01

    The floristic variations of shrub and tree components were studied in two sites of Semideciduous Forest, initial forest and mature forest, located in the Mata do Paraíso Forest Reserve, in Viçosa, State of Minas Gerais, Southeastern Brazil, in order to analyze the floristic similarity and the correlations between environmental variables and the distribution of tree species in these forests. Individual trees with a diameter at breast height (DBH) > or = 4.8 cm were sampled in twenty 10 x 30 m plots (10 plots in each site). The plots were distributed systematically at 10 m intervals. The environmental variables analyzed were: the canopy openness and soil chemical and texture characteristics. The two forest sites showed clear differences in the levels of canopy openness and soil fertility, factors that reflect the floristic and successional differences of the shrub and tree component, revealed by the low similarity between these forests by cluster analysis. The canonical correspondence analysis (CCA) of environmental variables and species abundance indicated that the species in these forests studied are distributed under strong influence of canopy openness, moisture and soil fertility.

  17. Study of the accumulation and distribution of the radioactivity in the cooling circuit of the BOR-60 reactor

    International Nuclear Information System (INIS)

    Kizin, V.D.; Konyashov, V.V.; Lisitsyn, E.S.; Polyakov, V.I.; Chechetkin, Yu.V.

    1976-04-01

    The results of measurements of the radioactivity of the coolant and the deposits in the primary circuit of the BOR-60 reactor during its five years of operation are discussed. The values calculated for the exposure dose rate from the piping system and the contribution of the γ-radiation from the corrosion and fission product nuclides are given. The efficiency of coolant draining from the pipes in reducing the dose rate is estimated. (orig.) [de

  18. Species richness and structure of an anuran community in an Atlantic Forest site in southern Brazil

    Directory of Open Access Journals (Sweden)

    Adriele Karlokoski Cunha

    2010-06-01

    Full Text Available The species richness and spatial distribution of an anuran community were studied over 12 months in an Atlantic Forest area in São José dos Pinhais Municipality, Paraná State, southern Brazil. During field surveys, we registered 32 species from ten families: Brachycephalidae (2, Bufonidae (2, Centrolenidae (1, Cycloramphidae (1, Hemiphractidae (1, Hylidae (18, Hylodidae (1, Leiuperidae (2, Leptodactylidae (3, and Microhylidae (1. Sixteen species were registered in open areas, while seventeen species were found on forest borders and twenty species in forest areas. In relation to the microhabitat utilization, species were registered according to stratum of vocalization: 1 on the ground (eight; 2 in the water (two; 3 in the lower stratum (eleven; 4 in the intermediate stratum (five; 5 in the upper stratum (four. Five species were abundant (15.6%, while twelve were common (37.5%, and fifteen were considered rare (46.9%. The biological aspects of the majority of the species described in this work as related to forest areas are not well known. This fact reinforces the importance of Atlantic Forest conservation.

  19. Integrative measurements focusing on carbon, energy and water fluxes at the forest site 'Hohes Holz' and the grassland 'Grosses Bruch'

    Science.gov (United States)

    Rebmann, Corinna; Claudia, Schütze; Sara, Marañón-Jiménez; Sebastian, Gimper; Matthias, Zink; Luis, Samaniego; Matthias, Cuntz

    2017-04-01

    The reduction of greenhouse gas (GHG) emissions and the optimization of Carbon sequestration by ecosystems have become priority objectives for current climate change policies. In this context, the long term research project TERENO and the research infrastructure ICOS have been established. The eddy covariance technique allows obtaining an integrative estimate of the ecosystem carbon, water and energy balances at the ecosystem level. The relative contributions of evaporation and transpiration as well as carbon sources and sinks need, however, to be determined separately for thorough process understanding. Two different ecosystem observatories have recently been established in the Magdeburger Börde: a deciduous forest (Hohes Holz) and a meadow (Grosses Bruch). A comprehensive system of instrumentation provides continuous data for the evaluation of energy, water and carbon fluxes at the 1500 ha large forest site, including a 50 m high eddy covariance (EC) tower for micrometeorological investigations in different heights above and below canopy, throughfall and stem flow sensors, a soil moisture and temperature sensor network, soil respiration chambers, sap flow sensors, and ancillary analysis of trees such a dendrometer and leaf area index measurements. Eddy covariance measurements allow the assessment of the carbon (Net Ecosystem Exchange, NEE) and water balance at the ecosystem scale. To better understand the contributing processes we partition water und carbon fluxes of the forest ecosystem by different methods. Tower-based data of NEE are therefore complemented and validated by continuous automatic and manual campaign measurements of soil effluxes and their drivers. Water fluxes into the ecosystem are partitioned by stem flow and throughfall measurements and a distributed soil moisture network. Gap fraction in the forest has a strong influence on the distribution on the water fluxes and is therefore determined on a regular basis. Since the establishment of the

  20. Plant hydraulic strategies and their variability at high latitudes: insights from a southern Canadian boreal forest site

    Science.gov (United States)

    Pappas, C.; Matheny, A. M.; Maillet, J.; Baltzer, J. L.; Stephens, J.; Barr, A.; Black, T. A.; Sonnentag, O.

    2016-12-01

    Boreal forests cover about one third of the world's forested area with a large part of the boreal zone located in Canada. These high-latitude ecosystems respond rapidly to environmental changes. Plant water stress and the resulting drought-induced mortality has been recently hypothesised as a major driver of forest changes in western Canada. Although boreal forests often exhibit low floristic complexity, local scale abiotic heterogeneities may lead to highly variable plant functional traits and thus to diverging plant responses to environmental changes. However, detailed measurements of plant hydraulic strategies and their inter- and intra-specific variability are still lacking for these ecosystems. Here, we quantify plant water use and hydraulic strategies of black spruce (Picea mariana) and larch (Larix laricina), that are widespread in the boreal zone, at a long-term monitoring site located in central Saskatchewan (53.99° N, 105.12° W; elevation 628.94 m a.s.l.). The site is characterized by a mature black spruce overstorey that dominates the landscape with few larch individuals. The ground cover consists mainly of mosses with some peat moss and lichens over a rich soil organic layer. Tree-level sap flux density, measured with Granier-style thermal dissipation probes (N=39), and concurrently recorded radial stem dynamics, measured with high frequency dendrometers (N=13), are used to quantify plant hydraulic functioning during the 2016 growing season. Hydrometeorological measurements, including soil moisture and micrometeorological data, are used to describe environmental constraints in plant water use. Tree-level dynamics are then integrated to the landscape and compared with ecosystem-level evapotranspiration measurements from an adjacent eddy-covariance flux tower. This experimental design allows us to quantify the main environmental drivers that shape plant hydraulic strategies in this southern boreal zone and to provide new insights into the inter- and

  1. Integration of Remote Sensing Products with Ground-Based Measurements to Understand the Dynamics of Nepal's Forests and Plantation Sites

    Science.gov (United States)

    Gilani, H.; Jain, A. K.

    2016-12-01

    This study assembles information from three sources - remote sensing, terrestrial photography and ground-based inventory data, to understand the dynamics of Nepal's tropical and sub-tropical forests and plantation sites for the period 1990-2015. Our study focuses on following three specific district areas, which have conserved forests through social and agroforestry management practices: 1. Dolakha district: This site has been selected to study the impact of community-based forest management on land cover change using repeat photography and satellite imagery, in combination with interviews with community members. The study time period is during the period 1990-2010. We determined that satellite data with ground photographs can provide transparency for long term monitoring. The initial results also suggests that community-based forest management program in the mid-hills of Nepal was successful. 2. Chitwan district: Here we use high resolution remote sensing data and optimized community field inventories to evaluate potential application and operational feasibility of community level REDD+ measuring, reporting and verification (MRV) systems. The study uses temporal dynamics of land cover transitions, tree canopy size classes and biomass over a Kayar khola watershed REDD+ study area with community forest to evaluate satellite Image segmentation for land cover, linear regression model for above ground biomass (AGB), and estimation and monitoring field data for tree crowns and AGB. We study three specific years 2002, 2009, 2012. Using integration of WorldView-2 and airborne LiDAR data for tree species level. 3. Nuwakot district: This district was selected to study the impact of establishment of tree plantation on total barren/fallow. Over the last 40 year, this area has went through a drastic changes, from barren land to forest area with tree species consisting of Dalbergia sissoo, Leucaena leucocephala, Michelia champaca, etc. In 1994, this district area was registered

  2. Characteristics, sources and evolution of fine aerosol (PM1) at urban, coastal and forest background sites in Lithuania

    Science.gov (United States)

    Masalaite, A.; Holzinger, R.; Remeikis, V.; Röckmann, T.; Dusek, U.

    2017-01-01

    The chemical and isotopic composition of organic aerosol (OA) samples collected on PM1 filters was determined as a function of desorption temperature to investigate the main sources of organic carbon and the effects of photochemical processing on atmospheric aerosol. The filter samples were collected at an urban (54°38‧ N, 25°18‧ E), coastal (55°55‧ N, 21°00‧ E) and forest (55°27‧ N, 26°00' E) site in Lithuania in March 2013. They can be interpreted as winter-time samples because the monthly averaged temperature was -4 °C. The detailed chemical composition of organic compounds was analysed with a thermal desorption PTR-MS. The mass concentration of organic aerosol at the forest site was roughly by a factor of 30 lower than at the urban and coastal site. This fact could be an indication that in this cold month the biogenic secondary organic aerosol (SOA) formation was very low. Moreover, the organic aerosol collected at the forest site was more refractory and contained a larger fraction of heavy molecules with m/z > 200. The isotopic composition of the aerosol was used to differentiate the two main sources of organic aerosol in winter, i.e. biomass burning (BB) and fossil fuel (FF) combustion. Organic aerosol from biomass burning is enriched in 13C compared to OA from fossil fuel emissions. δ13COC values of the OA samples showed a positive correlation with the mass fraction of several individual organic compounds. Most of these organic compounds contained nitrogen indicating that organic nitrogen compounds formed during the combustion of biomass may be indicative of BB. Other compounds that showed negative correlations with δ13COC were possibly indicative of FF. These compounds included heavy hydrocarbons and were on the average less oxidized than the bulk organic carbon. The correlation of δ13COC and the O/C ratio was positive at low but negative at high desorption temperatures at the forest site. We propose that this might be due to

  3. Radiological survey of the low-level radioactive waste burial site at the Palos Forest Preserve, Illinois

    International Nuclear Information System (INIS)

    Hayes, K.A.

    1982-01-01

    Two landfill sites containing low-level radioactive waste material, Site A and Plot M, are located 14 miles southwest of Chicago, Illinois in the Palos Forest Preserve. Site A is the former location of the Argonne National Laboratory. Buried at Site A in 1956 were the dismantled reactor shells, building walls, and cooling towers from three of the world's first nuclear reactors. Plot M was used from 1943 to 1949 for burial of low-level radioactive wastes derived from Site A operations and from the University of Chicago Metallurgical Laboratory. Tritiated water was detected in 1973 in some of the Forest Preserve picnic wells located 500 to 1000 yards north of Plot M. An extensive surveillance program was initiated in 1976 to: (1) study the elevated tritium content of some picnic wells and its observed seasonal fluctuations, (2) establish if other radionuclides buried in Plot M or remaining at Site A have migrated, (3) establish the rate of groundwater movement in the glacial till and underlying dolomite aquifer, (4) determine the tritium content of the till and aquifer, and (5) predict future tritium levels in the well water. Several test wells were installed in the soil and dolomite bedrock to monitor radioactivity in groundwater, measure water levels, and provide other geohydrological information. Tritium has migrated from the Plot M burial trenches into the surrounding drift. The tritium plume, the contaminated zone in the drift in which tritium concentrations exceed 10 nanocuries per liter of water (nCi/L), has migrated at least 165 feet horizontally northward and 130 feet vertically downward to the bedrock surface. Small amounts of other radionuclides - uranium, plutonium, and strontium-90 - have been found in boreholes beneath the concrete cap covering Plot M, but not in the subsoil outside of the Plot. The radionuclide concentrations found to date are too low to result in any measureable radiation exposure to the public

  4. Effects Of Very Intensive Forest Biomass Harvesting On Short And Long Term Site Productivity

    DEFF Research Database (Denmark)

    Raulund-Rasmussen, Karsten; Stupak, Inge; Clarke, Nicholas

    2008-01-01

    Intensified forest biomass utilisation causes export of substantial amounts of nutrients from the forest ecosystem. Compared to conventional stems-only harvesting, the most intensive biomass sce nario causes increases in nutrient exports of up to 6-7 times whereas the biomass export increases only...... up to 2 times (Stupak et al. 2007a). High concentrations of nutrients in small branches, twigs, and leaves compared to stems are the main reason. The extensive export of nutrients related to intensive biomass extraction have for many years caused concern for the long-term fertility of the system...

  5. Mercury concentrations and pools in four Sierra Nevada forest sites, and relationships to organic carbon and nitrogen

    Directory of Open Access Journals (Sweden)

    D. Obrist

    2009-05-01

    Full Text Available This study presents data on mercury (Hg concentrations, stochiometric relations to carbon (C and nitrogen (N, and Hg pool sizes in four Sierra Nevada forest sites of similar exposure and precipitation regimes, and hence similar atmospheric deposition, to evaluate how ecosystem parameters control Hg retention in ecosystems. In all four sites, the largest amounts of Hg reside in soils which account for 94–98% of ecosystem pools. Hg concentrations and Hg/C ratios increase in the following order: Green Needles/Leavesr2=0.58 and N and C (r2=0.64 in decomposing litter, but a positive correlation between litter Hg and N (r2=0.70. These inverse relations may reflect preferential retention of N and Hg over C during decomposition, or may be due to older age of decomposed litter layers which are exposed to longer-term atmospheric Hg deposition in the field. The results indicate that litter Hg levels depend on decomposition stage and may not follow generally observed positive relationships between Hg and organic C.

    Mineral soil layers show strong positive correlations of Hg to C across all sites and soil horizons (r2=0.83, but Hg concentrations are even more closely related to N with a similar slope to that observed in litter (r2=0.92. Soil N levels alone explain over 90% of Hg pool sizes across the four Sierra Nevada forest sites. This suggests that soil organic N and C groups provide sorption sites for Hg to retain atmospheric deposition. However, the patterns could be due to indirect relationships where high soil N and C levels reflect high ecosystem productivity which leads to corresponding high atmospheric Hg deposition inputs via leaf litterfall and plant senescence. Our results also show that two of the sites previously affected by

  6. Interpenetrated Uranyl-Organic Frameworks with bor and pts Topology: Structure, Spectroscopy, and Computation.

    Science.gov (United States)

    Liu, Chao; Chen, Fang-Yuan; Tian, Hong-Rui; Ai, Jing; Yang, Weiting; Pan, Qing-Jiang; Sun, Zhong-Ming

    2017-11-20

    Two novel three-dimensional interpenetrated uranyl-organic frameworks, (NH 4 ) 4 [(UO 2 ) 4 (L 1 ) 3 ]·6H 2 O (1) and [(UO 2 ) 2 (H 2 O) 2 L 2 ]·2H 2 O (2), where L 1 = tetrakis(3-carboxyphenyl)silicon and L 2 = tetrakis(4-carboxyphenyl)silicon, were synthesized by a combination of two isomeric tetrahedral silicon-centered ligands with 3-connected triangular [(UO 2 )(COO) 3 ] - and 4-connected dinuclear [(UO 2 ) 2 (COO) 4 ] units, respectively. Structural analyses indicate that 1 possesses a 2-fold interpenetrating anion bor network, while 2 exhibits a 3-fold interpenetrated 4,4-connected neutral network with pts topology. Both compounds were characterized by thermogravimetric analysis and IR, UV-vis, and photoluminescence spectroscopy. A relativistic density functional theory (DFT) investigation on 10 model compounds of 1 and 2 shows good agreement of the structural parameters, stretching vibrational frequencies, and absorption with experimental results; the time-dependent DFT calculations unravel that low-energy absorption bands originate from ligand-to-uranium charge transfer.

  7. 1x2M steel performance in the BOR-60 steam generator

    International Nuclear Information System (INIS)

    Golovanov, V.N.; Shamardin, V.K.; Kondratiev, V.I.; Kryukov, F.N.; Chernobrovkin, Yu.V.; Bulanova, T.M.; Bai, V.F.

    The results from studies of 1x2M steel characteristics are presented. This steel was used as the material for the BOR-60 steam generator that had been in operation under the steam generating mode for 18,000 hs (35,000 hs in sodium). It was revealed that the pit corrosion depth on the water/steam side evaporative tube surfaces was about 0.25 μm and less and the total corrosion rate was less than 0.06 mm/y. The mechanical properties of the material were essentially similar both in the evaporator and superheater and met all the requirements imposed on. Based on the analysis of data on the decarbonizaton depth in sodium and on the corrosion damage in water and steam it was concluded that 1x2M steel can be successfully used as the steam generator material at the operating temperatures up to 470 deg. C and had sufficiently longer service-life as compared to 18,000 hs. (author)

  8. Acoustic noises of the BOR-60 reactor steam generators when simulating leaks with argon and steam

    International Nuclear Information System (INIS)

    Sokolov, V.M.; Golushko, V.V.; Afanas'ev, V.A.; Grebenkin, Yu.P.; Muralev, A.B.

    1985-01-01

    Background acoustic noises of stea generators in different operational regimes and noises of argon and steam small leads (about 0.1 g/s) are studied to determine the possibility of designing the acoustic system for leak detection in sodium-water steamgenerators. Investigations are carried out at the 30 MW micromodule steam generator being in operation at the BOR-60 reactor as well as at the 20 MW tank type steam generator. Immersed ransduceres made of lithium niobate 6 mm in-diameter and waveguide transducers made of a stainless steel in the form of rods 10 mm in-diameter and 500 mm long are used as acoustic monitors. It is shown that the leak noise is more wide-band than the background noise of the steam generator and both high and low frequencies appear in the spectrum. The use of monitors of different types results in similar conslusions inrelation to the character of background noises and leak signals (spectral density, signal to-noise ratio) in the ase of similar bandroidths of the transduceres. A conclusion is made that the change of operational regimes leads to changes of background noise level, which can be close to the reaction of

  9. Radiation risk in Finland due to the nuclear power plant at Sosnovyj Bor

    International Nuclear Information System (INIS)

    Ilvonen, M.; Rossi, J.; Salonoja, M.

    1994-06-01

    The present study is an application of the long range transport and dose model TRADOS developed jointly by the Finnish Meteorological Institute and Technical Research Centre of Finland. The aim of the study is to assess the radiation risk in Finland due to the nuclear power plant at Sosnovyj Bor near St. Petersburg in Russia. Probabilities of reaching different parts of the country, transport time and time spent over Finland by the trajectories are presented. Also breadth of the radioactive cloud and incidence of rain are estimated. The calculated radiation doses are based on one single hypothetical release, in which all noble gases are released, together with 10 % of easily vaporizing elements and 1 % of others. All results are based on the assumption that the probability of the release is 100 %. The dose pathways calculated are cloud gamma, fallout gamma, inhalation, and ingestion of milk, meat, green vegetables, grain and roots. External dose rates have been calculated. The necessity of countermeasures and the ratio of the avertable dose to the costs are also assessed. (13 refs., 156 figs., 12 tabs.)

  10. Spatial and functional city structure with examples of Valjevo, Bor and Knjaževac

    Directory of Open Access Journals (Sweden)

    Spasić Nenad

    2005-01-01

    Full Text Available Cities represent such social environments which develop under the influence of their resource hinterland, yet at the same time they vigorously affect changes in their immediate or broader surroundings, depending on dynamics of city limits change. From city origins to the present day, interdependences between its spatial and functional structures can be noticed. Historical context plays a significant role in city development, both in terms of its spatial structure formation as well as in terms of development of city functions and territorial distribution of urban services. Spatial structure of a city is also defined by a set of geographical, economic, social functional and other features in their interdependency. Functional structure of a city depends on its size and position it takes in the functional distribution on a regional level as well as it is related to the functional capacity of a city. This paper analyses concrete examples of spatial and functional structures featuring three Serbian towns: Valjevo, Bor and Knjaževac. From the analysis of their common attributes in this respect, the following can be noticed: formation of the case study towns happened around inherited historical city cores, which even now perform a number of public functions; basic road networks significantly influenced formation of spatial patterns of these towns; spatial development of the towns in the last decade or so was slowed down because of economic and social stagnation, which didn't show major influence on change of spatial and functional structures of the towns involved.

  11. Studying the processes of sodium-water interaction in the BOR-60 reactor micromodule steam generator

    International Nuclear Information System (INIS)

    Tsykanov, V.A.; Antipin, G.K.; Borisov, V.V.

    1981-01-01

    Main results of experimental studies of emergency regimes of micromodule steam generator (MSG) at small and big leaks of water into sodium, realized using the 30 MW MSG, operating in the BOR-o0 reactor, are considered. The aims of the study are as follows: the modelling of macroleak in ''Nadja'' steam generator for the BN-350 reactor; testing the conceptions of alarm signalling and MSG protection; testing under real conditions of new perspective systems of leak detection; gaining the experimence and development of the ways to eliminate the consequences of accident caused by big water leak into sodium; accumulation of knowledge on restoration of MSG operating ability after accident; experimental test of calculational techniques for big leak accidents to use them in future for calculational studies of similar situations at other reactors equipped with sodium-water steam generators; refinement of characteristics of hydrodynamic and thermal effects interaction zone for big leak in real circuit during the plant operation. A series of experiments with the imitation of water leak into sodium by means of argon and steam supply through injection devices, located before the steam superheater module of one of the sections and between evaporator module of the same section, is conducted. The range of steam flow rate is 0.02-0.45 g/s. Duration of steam supply is 100-400 s. A conclusion is made that the results obtained can be used for steam generator of the BN-350 reactor [ru

  12. New approach to the reclamation of the old flotation tailings in Bor

    Directory of Open Access Journals (Sweden)

    Dožić Stevan

    2010-01-01

    Full Text Available The old flotation tailings of the Bor copper mine have not been reclaimed for several decades, although it is a serious threat to the environment, especially to some parts of the town. To date, there have been no efficacious attempts of solving the problem by indirect rehabilitation, only several cases of direct reclamation. This paper presents some results of the experiment established on a part of the tailings in the vicinity of the town, where various variants of meliorated and sterile substrates were applied in the biological reclamation with several tree and grass species. The analysis shows that, in the rehabilitation of sterile substrate of the copper mine, it is possible to grow several woody species. The best results were achieved by the species that were planted in the fertile soil layer on the sterile copper mine substrate, and on the mixture of soil and waste. Among the woody species, Robinia pseudoaccacia, Fraxinus excelsior and Acer pseudoplatanus showed the best survival percent, growth, and physiological vitality and the poorest were spruce and common oak.

  13. Bioleaching of copper from old flotation tailings samples (Copper Mine Bor, Serbia

    Directory of Open Access Journals (Sweden)

    Stanković Srđan

    2015-01-01

    Full Text Available Bioleaching of samples taken from depths of 10, 15, and 20 meters from old flotation tailings of the Copper Mine Bor was conducted in shaken flasks using extremely acidic water of Lake Robuleas lixiviant. Yield of copper after five weeks of the bioleaching experiment was 68.34±1.21% for 15 m sample, 72.57±0.57% for 20 m sample and 97.78±5.50% for 10 m sample. The obtained results were compared to the results of acid leaching of the same samples and it was concluded that bioleaching was generally more efficient for the treatment of samples taken from depths of 10 m and 20 m. The content of pyrite in the 20 m sample, which contained the highest amount of this mineral, was reduced after bioleaching. Benefits of this approach are: recovery of substantial amounts of copper, reducing the environmental impact of flotation tailings and the application of abundant and free water from the Robule acidic lake as lixiviant. Results of the experiment showed that bioleaching can be more efficient than acid leaching for copper extraction from flotation tailings with higher sulfide contents. [Projekat Ministarstva nauke Republike Srbije, br. 176016 i br. 173048

  14. The Novo Okno copper deposit of olistostrome origin (Bor, Eastern Serbia

    Directory of Open Access Journals (Sweden)

    Antonijević Ivan

    2011-01-01

    Full Text Available The copper deposit Novo Okno, uncovered at present, with non-ore and ore clasts of massive sulphides (from 0.5 to 50 m3 in size, has many distinctive features that indicate its olistostrome origin. The deposit is chaotic in structure, unstratified, with the lower surface unconformable over the underlying parent rock of the basin. It is a lens-like body, with the longer axis directed east and west, variable in thickness from 15 to 28 metres, about 335 metres long and less than 140 metres wide. These and other characteristics of the body indicate a unified, reworked, olistostrome copper deposit formed from primary ore bodies of the Bor mineral deposit and vulcanite, destroyed by volcanic explosion into blocks and rocks of Turonian age and extrusion and concurrent deposition on the land surface. Gravitational massive sliding of the consolidated rocks down the slopes of the volcanic relief and chaotic accumulation of ore and non-ore clasts (olistoliths in a marine basin evolved in the Upper Turonian and the Lower Senonian.

  15. Comparison of horizontal and vertical advective CO2 fluxes at three forest sites

    Czech Academy of Sciences Publication Activity Database

    Feigenwinter, C.; Bernhofer, C.; Eichelmann, U.; Heinesch, B.; Hertel, M.; Janouš, Dalibor; Kolle, O.; Lagergren, F.; Lindroth, A.; Minerbi, S.; Moderow, U.; Mölder, M.; Montagnani, L.; Queck, R.; Rebmann, C.; Vestin, P.; Yernaux, M.; Zeri, M.; Ziegler, W.; Aubinet, M.

    2008-01-01

    Roč. 148, č. 1 (2008), s. 12-24 ISSN 0168-1923 Grant - others:-(XE) GOCE-CT-2003-505572 Institutional research plan: CEZ:AV0Z60870520 Keywords : forest ecosystems * advection * net ecosystem exchange * carbon balance * ADVEX Subject RIV: DG - Athmosphere Sciences, Meteorology Impact factor: 3.668, year: 2008

  16. Planted Black Walnut Does Well on Cleared Forest Sites -- if Competition is Controlled

    Science.gov (United States)

    John E. Krajicek

    1975-01-01

    After seven growing seasons, survival of black walnut seedlings planted in cleared forest openings did not differ by competition control treatments. The trees grew somewhat larger where all competing vegetation was controlled but almost as large where only herbaceous competition was controlled. Controlling only woody vegetation was no better than no control of any...

  17. Annual variation in canopy openness, air temperature and humidity inthe understory of three forested sites in southern Bahia State, Brazil

    Directory of Open Access Journals (Sweden)

    Marayana Prado Pinheiro

    2013-01-01

    Full Text Available Aiming at contributing to the knowledge of physical factors affecting community structure in Atlantic Forest remnants of southern Bahia state, Brazil, we analyzed the annual variation in the understory microclimate of a hillside forest fragment in the ‘Reserva Particular do Patrimônio Natural Serra do Teimoso’ (RST and a rustic cacao agroforestry system (Cabruca, located nearby the RST. Canopy openness (CO, air temperature (Ta, air relative humidity (RH and vapor pressure deficit (VPD data were collected between April, 2005 and April, 2006 at the base (RSTB, 340 m and the top (RSTT, 640 m of the RST and at the Cabruca (CB, 250 m. Data of rainfall, Ta, RH and VPD were also collected in an open area (OA, 270 m. The highest rainfalls (> 100 mm occurred in November, 2005 and April, 2006, whereas October, 2005 was the driest month (< 20 mm. CO ranged between 2.5 % in the CB (April, 2006 and 7.7 % in the RST (October, 2005. Low rainfall in October, 2005 affected VPDmax in all sites. Those effects were more pronounced in OA, followed by CB, RSTB and RSTT. During the period of measurements, the values of Ta, RH and VPD in CB were closer to the values measured in OA than to the values measured inside the forest.

  18. Use of ground-based radiometers for L-Band Freeze/Thaw retrieval in a boreal forest site

    Science.gov (United States)

    Roy, A.; Sonnentag, O.; Derksen, C.; Toose, P.; Pappas, C.; Mavrovic, A.; El Amine, M.; Royer, A.; Berg, A. A.; Rowlandson, T. L.; Barr, A.; Black, T. A.

    2017-12-01

    The boreal forest is the second largest land biome in the world and thus plays a major role in the global and regional climate systems. The extent, timing and duration of the seasonal freeze/thaw (F/T) state influences vegetation developmental stages (phenology) and, consequently, constitutes an important control on how boreal forest ecosystems exchange carbon, water and energy with the atmosphere. Recently, new L-Band satellite-derived F/T information has become available. However, disentangling the seasonally differing contributions from forest overstory and understory vegetation, and the ground surface to the satellite signal remains challenging. Here we present results from an ongoing campaign with two L-Band surface-based radiometers (SBR) installed on a micrometeorological tower at the Southern Old Black Spruce site (53.99°N / 105.12°W) in central Saskatchewan. One radiometer unit is installed on top of the tower viewing the multi-layer vegetation canopy from above. A second radiometer unit is installed within the multi-layer canopy, viewing the understory and the ground surface only. The objectives of our study are to (i) disentangle the L-Band F/T signal contribution of boreal forest overstory from the combined understory and ground surface contribution, and (ii) link the L-Band F/T signal to related boreal forest structural and functional characteristics. Analysis of these radiometer measurements made from September to November 2016 shows that when the ground surface is thawed, the main contributor to both radiometer signals is soil moisture. The Pearson correlation coefficient between brightness temperature (TB) at vertical polarization (V-pol) and soil permittivity is 0.79 for the radiometer above the canopy and 0.74 for the radiometer below the canopy. Under cold conditions when the soil was thawed (snow insulation) and the trees were frozen (below 0°C), TB at V-pol is negatively correlated with tree permittivity. The freezing tree contribution to

  19. Growth dynamics of fine roots in a coniferous fern forest site close to Forsmark in the central part of Sweden

    International Nuclear Information System (INIS)

    Persson, Hans; Stadenberg, Ingela

    2007-12-01

    The seasonal growth dynamics of live and dead roots for trees and the field layer species (g/m 2 , varying diameter fractions) and live/dead ratios were analysed at a fresh/moist coniferous fern forest site close to the nuclear power plant at Forsmark in the central eastern parts of Sweden. The changes in depth distribution of fine roots were observed at depth intervals of the top humus horizon down to 40 cm in the mineral soil profile. The bulk of living fine roots of trees ( 2 . The total quantity of fine roots (live + dead) amounted to 543, 434, 314 and 546 g/m 2 . Considerable quantities of fine roots (< 1 mm in diameter) were attributed to field-layer species (about 18% of the total biomass during the whole period of investigation). The turnover rate (the rate of construction of new roots) for tree fine roots < 1 mm in diameter amounted to at least the size of the average fine-root biomass. Our methods of estimating fine-root production and mortality, involved periodic measurements of live and dead dry weight of the fine roots from sequential core samples of the forest soil. The collected data give a proper and instant measure of the spatial and temporal distribution of fine roots in the undisturbed soil-profile. Data from other fine-root investigations suggest turnover rates in agreement with our present findings. Differences between root growth and turnover should be expected between trees of different age, tree species and different forest sites, but also between different years. Substantial variations in fine-root biomass, necromass and live/dead ratios are found in different forest sites. Correct methods for estimating the amount of live and dead fine-roots in the soil at regular time intervals are essential for any calculation of fine-root turnover. Definition of root vitality differs in literature, making it difficult to compare results from different root investigators. Our investigation clarifies the importance of using distinct morphological criteria

  20. Overview of the Manitou Experimental Forest Observatory: site description and selected science results from 2008 to 2013

    Science.gov (United States)

    Ortega, J.; Turnipseed, A.; Guenther, A. B.; Karl, T. G.; Day, D. A.; Gochis, D.; Huffman, J. A.; Prenni, A. J.; Levin, E. J. T.; Kreidenweis, S. M.; DeMott, P. J.; Tobo, Y.; Patton, E. G.; Hodzic, A.; Cui, Y. Y.; Harley, P. C.; Hornbrook, R. S.; Apel, E. C.; Monson, R. K.; Eller, A. S. D.; Greenberg, J. P.; Barth, M. C.; Campuzano-Jost, P.; Palm, B. B.; Jimenez, J. L.; Aiken, A. C.; Dubey, M. K.; Geron, C.; Offenberg, J.; Ryan, M. G.; Fornwalt, P. J.; Pryor, S. C.; Keutsch, F. N.; DiGangi, J. P.; Chan, A. W. H.; Goldstein, A. H.; Wolfe, G. M.; Kim, S.; Kaser, L.; Schnitzhofer, R.; Hansel, A.; Cantrell, C. A.; Mauldin, R. L.; Smith, J. N.

    2014-06-01

    The Bio-hydro-atmosphere interactions of Energy, Aerosols, Carbon, H2O, Organics & Nitrogen (BEACHON) project seeks to understand the feedbacks and inter-relationships between hydrology, biogenic emissions, carbon assimilation, aerosol properties, clouds and associated feedbacks within water-limited ecosystems. The Manitou Experimental Forest Observatory (MEFO) was established in 2008 by the National Center for Atmospheric Research to address many of the BEACHON research objectives, and it now provides a fixed field site with significant infrastructure. MEFO is a mountainous, semi-arid ponderosa pine-dominated forest site that is normally dominated by clean continental air but is periodically influenced by anthropogenic sources from Colorado Front Range cities. This article summarizes the past and ongoing research activities at the site, and highlights some of the significant findings that have resulted from these measurements. These activities include - soil property measurements; - hydrological studies; - measurements of high-frequency turbulence parameters; - eddy covariance flux measurements of water, energy, aerosols and carbon dioxide through the canopy; - determination of biogenic and anthropogenic volatile organic compound emissions and their influence on regional atmospheric chemistry; - aerosol number and mass distributions; - chemical speciation of aerosol particles; - characterization of ice and cloud condensation nuclei; - trace gas measurements; and - model simulations using coupled chemistry and meteorology. In addition to various long-term continuous measurements, three focused measurement campaigns with state-of-the-art instrumentation have taken place since the site was established, and two of these studies are the subjects of this special issue: BEACHON-ROCS (Rocky Mountain Organic Carbon Study, 2010) and BEACHON-RoMBAS (Rocky Mountain Biogenic Aerosol Study, 2011).

  1. Overview of the Manitou Experimental Forest Observatory: site description and selected science results from 2008-2013

    Science.gov (United States)

    Ortega, J.; Turnipseed, A.; Guenther, A. B.; Karl, T. G.; Day, D. A.; Gochis, D.; Huffman, J. A.; Prenni, A. J.; Levin, E. J. T.; Kreidenweis, S. M.; DeMott, P. J.; Tobo, Y.; Patton, E. G.; Hodzic, A.; Cui, Y.; Harley, P. C.; Hornbrook, R. H.; Apel, E. C.; Monson, R. K.; Eller, A. S. D.; Greenberg, J. P.; Barth, M.; Campuzano-Jost, P.; Palm, B. B.; Jimenez, J. L.; Aiken, A. C.; Dubey, M. K.; Geron, C.; Offenberg, J.; Ryan, M. G.; Fornwalt, P. J.; Pryor, S. C.; Keutsch, F. N.; DiGangi, J. P.; Chan, A. W. H.; Goldstein, A. H.; Wolfe, G. M.; Kim, S.; Kaser, L.; Schnitzhofer, R.; Hansel, A.; Cantrell, C. A.; Mauldin, R. L., III; Smith, J. N.

    2014-01-01

    The Bio-hydro-atmosphere interactions of Energy, Aerosols, Carbon, H2O, Organics & Nitrogen (BEACHON) project seeks to understand the feedbacks and inter-relationships between hydrology, biogenic emissions, carbon assimilation, aerosol properties, clouds and associated feedbacks within water-limited ecosystems. The Manitou Experimental Forest Observatory (MEFO) was established in 2008 by the National Center for Atmospheric Research to address many of the BEACHON research objectives, and it now provides a fixed field site with significant infrastructure. MEFO is a mountainous, semi-arid ponderosa pine-dominated forest site that is normally dominated by clean continental air, but is periodically influenced by anthropogenic sources from Colorado Front Range cities. This article summarizes the past and ongoing research activities at the site, and highlights some of the significant findings that have resulted from these measurements. These activities include: - soil property measurements, - hydrological studies, - measurements of high-frequency turbulence parameters, - eddy covariance flux measurements of water, energy, aerosols and carbon dioxide through the canopy, - biogenic and anthropogenic volatile organic compound emissions and their influence on regional atmospheric chemistry, - aerosol number and mass distributions, - chemical speciation of aerosol particles, - characterization of ice and cloud condensation nuclei, - trace gas measurements, and - model simulations using coupled chemistry and meteorology. In addition to various long-term continuous measurement, three focused measurement campaigns with state-of-the-art instrumentation have taken place since the site was established, and two of these are the subjects of this special issue: BEACHON-ROCS (Rocky Mountain Organic Carbon Study, 2010) and BEACHON-RoMBAS (Rocky Mountain Biogenic Aerosol Study, 2011).

  2. Influence of stocking, site quality, stand age, low-severity canopy disturbance, and forest composition on sub-boreal aspen mixedwood carbon stocks

    Science.gov (United States)

    Reinikainen, Michael; D’Amato, Anthony W.; Bradford, John B.; Fraver, Shawn

    2014-01-01

    Low-severity canopy disturbance presumably influences forest carbon dynamics during the course of stand development, yet the topic has received relatively little attention. This is surprising because of the frequent occurrence of such events and the potential for both the severity and frequency of disturbances to increase as a result of climate change. We investigated the impacts of low-severity canopy disturbance and average insect defoliation on forest carbon stocks and rates of carbon sequestration in mature aspen mixedwood forests of varying stand age (ranging from 61 to 85 years), overstory composition, stocking level, and site quality. Stocking level and site quality positively affected the average annual aboveground tree carbon increment (CAAI), while stocking level, site quality, and stand age positively affected tree carbon stocks (CTREE) and total ecosystem carbon stocks (CTOTAL). Cumulative canopy disturbance (DIST) was reconstructed using dendroecological methods over a 29-year period. DIST was negatively and significantly related to soil carbon (CSOIL), and it was negatively, albeit marginally, related to CTOTAL. Minima in the annual aboveground carbon increment of trees (CAI) occurred at sites during defoliation of aspen (Populus tremuloides Michx.) by forest tent caterpillar (Malacosoma disstria Hubner), and minima were more extreme at sites dominated by trembling aspen than sites mixed with conifers. At sites defoliated by forest tent caterpillar in the early 2000s, increased sequestration by the softwood component (Abies balsamea (L.) Mill. and Picea glauca (Moench) Voss) compensated for overall decreases in CAI by 17% on average. These results underscore the importance of accounting for low-severity canopy disturbance events when developing regional forest carbon models and argue for the restoration and maintenance of historically important conifer species within aspen mixedwoods to enhance stand-level resilience to disturbance agents and maintain

  3. Combined use of stable isotopes and fallout radionuclides as soil erosion indicators in a forested mountain site, South Korea

    International Nuclear Information System (INIS)

    Meusburger, K.; Mabit, L.; Alewell, C.; Park, J.H.; Sandor, T.

    2013-01-01

    The aim of this study is to assess and to validate the suitability of the stable nitrogen and carbon isotope signature as soil erosion indicators in a mountain forest site in South Korea. Our approach is based on the comparison of the isotope signature of ''stable'' landscape positions (reference sites), which are neither affected by erosion nor deposition, with eroding sites. For undisturbed soils we expect that the enrichment of δ 15 N and δ 13 C with soil depth, due to fractionation during decomposition, goes in parallel with a decrease in nitrogen and carbon content. Soil erosion processes potentially weaken this correlation. The 137 Cs method and the Revised Universal Soil Loss Equation (RUSLE) were applied for the soil erosion quantification. Erosion rates obtained with the 137 Cs method range from 0.9 t ha -1 yr -1 to 7 t ha -1 yr -1 . Considering the steep slopes of up to 40 and the erosive monsoon events (R factor of 6600 MJ mm ha -1 h -1 yr -1 ), the rates are plausible and within the magnitude of the RUSLE-modeled soil erosion rates, varying from 0.02 t ha -1 yr -1 to 5.1 t ha -1 yr -1 . The soil profiles of the reference sites showed significant (p < 0.0001) correlations between nitrogen and carbon content and its corresponding δ 15 N and δ 13 C signatures. In contrast, for the eroding sites this relationship was weaker and for the carbon not significant. These results confirm the usefulness of the stable carbon isotope signature as a qualitative indicator for soil disturbance. We could show further that the δ 15 N isotope signature can be used similarly for uncultivated sites. We thus propose that the stable δ 15 N and δ 13 C signature of soil profiles could serve as additional indicators confirming the accurate choice of the reference site in soil erosion studies using the 137 Cs method.

  4. Site properties for Crimean juniper (Juniperus excelsa) in semi-natural forests of south western Anatolia, Turkey.

    Science.gov (United States)

    Ozkan, Kürsad; Gulsoy, Serkan; Aerts, Raf; Muys, Bart

    2010-01-01

    We explored the semi-natural forests in south western Anatolia along a gradient between Mediterranean and continental climates to determine the site requirements of Juniperus excelsa in Turkey. We hypothesized that environmental variables and indicator species can be used to predict differences in occurrence and cover of J. excelsa and can therefore support decision making in reforestation management planning. Plant species composition and environmental variables were assessed in 153 plots. Association between J. excelsa and other plant species and environmental variables were analyzed using Fisher exact probability tests and stepwise discriminant analysis. High altitude (> 1000 m) as a proxy for an Oromediterranean climate, and high surface stoniness as a proxy for low competition by other tree species, are positive site properties for J. excelsa. The tree species avoids Eumediterranean and Supramediterranean plant communities. Twelve plant species, including the herbs Dianthus zonatus, Ajuga chamaepitys and Paronchia carica and the shrub Cotoneaster nummularia may be used as site indicators for J. excelsa restoration. Platanus orientalis, with similar site requirements but at present negatively associated to J. excelsa due to competitive effects, may be considered an additional indicator if stand conversion (harvesting and replacing P. orientalis) is part of the management plan.

  5. Validation of chemical analyses of atmospheric deposition in forested European sites

    Directory of Open Access Journals (Sweden)

    Erwin ULRICH

    2005-08-01

    Full Text Available Within the activities of the Integrated Co-operative Programme on Assessment and Monitoring of Air Pollution Effects on Forests (ICP Forests and of the EU Regulation 2152/2003, a Working Group on Quality Assurance/Quality Control of analyses has been created to assist the participating laboratories in the analysis of atmospheric deposition, soil and soil solution, and leaves/needles. As part of the activity of the WG, this study is a statistical analysis in the field of water analysis of chemical concentrations and relationships between ions, and between conductivity and ions for different types of samples (bulk or wet-only samples, throughfall, stemflow considered in forest studies. About 5000 analyses from seven laboratories were used to establish relationships representative of different European geographic and climatic situations, from northern Finland to southern Italy. Statistically significant differences between the relationships obtained from different types of solutions, interacting with different types of vegetation (throughfall and stemflow samples, broad-leaved trees and conifers and with varying influence of marine salt were tested. The ultimate aim is to establish general relationships between ions, and between conductivity and ions, with relative confidence limits, which can be used as a comparison with those established in single laboratories. The use of such techniques is strongly encouraged in the ICPF laboratories to validate single chemical analyses, to be performed when it is still possible to replicate the analysis, and as a general overview of the whole set of analyses, to obtain an indication of the laboratory performance on a long-term basis.

  6. IWGFR benchmark test on signal processing for boiling noise detection, stage 2: Analysis of data from BOR-60

    International Nuclear Information System (INIS)

    Rowley, R.; Waites, C.; Macleod, I.D.

    1989-01-01

    Data from boiling experiments in the BOR 60 reactor in USSR has been supplied by IAEA to enable analysis techniques to be compared. The signals have been analysed at RNL using two basic techniques, High Frequency RMS analysis and Pulse Counting analysis and two more sophisticated methods, Pattern Recognition and Pulse Timing Analysis. All methods indicated boiling successfully, pulse counting proved more sensitive than RMS for the detection of the onset of boiling. Pattern Recognition shows promise of a very reliable detector provided the background can be defined. Data from an Ionisation chamber was also supplied and there was good correlation between the neutronic and acoustic signals. (author). 25 figs, 4 tabs

  7. Neutron irradiation of V-Cr-Ti alloys in the BOR-60 fast reactor: Description of the fusion-1 experiment

    Energy Technology Data Exchange (ETDEWEB)

    Rowcliffe, A.F. [Oak Ridge National Laboratory, TN (United States); Tsai, H.C.; Smith, D.L. [Argonne National Lab., IL (United States)] [and others

    1997-08-01

    The FUSION-1 irradiation capsule was inserted in Row 5 of the BOR-60 fast reactor in June 1995. The capsule contains a collaborative RF/U.S. experiment to investigate the irradiation performance of V-Cr-Ti alloys in the temperature range 310 to 350{degrees}C. This report describes the capsule layout, specimen fabrication history, and the detailed test matrix for the U.S. specimens. A description of the operating history and neutronics will be presented in the next semiannual report.

  8. IAEA/IWGFR benchmark tests on sodium boiling noise detection. Part 2: Decision making and BOR-60 data

    International Nuclear Information System (INIS)

    Brown, C.J.; Hughes, G.; Overton, R.S.; Wey, B.O.

    1989-01-01

    The present paper deals with the second stage of investigations of acoustic signals from a boiling experiment performed on the KNS I loop at KfK Karlsruhe and first results of analysis of data from a series of boiling experiments carried out in the BOR 60 reactor in the USSR. Signals have been analysed in frequency as well as in time domain. Signal characteristics successfully used to detect the boiling process have been found in time domain. A proposal for in-service boiling monitoring by acoustic means is briefly described. (author). 5 refs, 23 figs

  9. Comparison between AOT40 and ozone uptake in forest trees of different species, age and site conditions

    Science.gov (United States)

    Matyssek, R.; Wieser, G.; Nunn, A. J.; Kozovits, A. R.; Reiter, I. M.; Heerdt, C.; Winkler, J. B.; Baumgarten, M.; Häberle, K.-H.; Grams, T. E. E.; Werner, H.; Fabian, P.; Havranek, W. M.

    The current AOT40 concept for inferring risks in forest trees by ozone (O 3) injury is based on an accumulated external O 3 exposure rather than an internal O 3 dose or uptake rate. AOT40 assumes O 3 concentrations below 40 nl l -1 and night-time exposure to be negligible. Hence, this concept is rather inconsistent with observed forest conditions. In contrast, the flux concept of cumulative O 3 uptake (CU) into the leaves has the potential of reflecting a physiologically meaningful internal O 3 dose experienced by trees. In this paper, we relate AOT40 to cumulative O 3 uptake into European beech ( Fagus sylvatica), Norway spruce ( Picea abies), European larch ( Larix decidua) and cembran pine ( Pinus cembra) trees differing in size, age and site conditions. We demonstrate that the flux concept can be extended to the tree and the stand level, making use of sap flow measurements through tree trunks. Although in both seedlings and adult trees AOT40 may show some linearity in correlations with average CU, the latter varies, at given AOT40, by 25±11% within and between species. This is because O 3 flux is primarily influenced by stomatal aperture, the latter being affected by climate, canopy position, leaf and tree age while varying between species. In particular, if weighed by detoxification capacity, we suggest, therefore, O 3 uptake related air quality indices to be promoted towards ecologically meaningful standards in forest protection, overcoming the shortcomings of exposure concepts. As O 3 injury results from the balance between O 3 uptake and detoxification in the leaf mesophyll, we conclude the flux concept in combination with measures of biochemical defence to have the capacity for predicting tree response to O 3 stress.

  10. Simple proxies for estimating the concentrations of monoterpenes and their oxidation products at a boreal forest site

    Directory of Open Access Journals (Sweden)

    J. Kontkanen

    2016-10-01

    Full Text Available The oxidation products of monoterpenes likely have a crucial role in the formation and growth of aerosol particles in boreal forests. However, the continuous measurements of monoterpene concentrations are usually not available on decadal timescales, and the direct measurements of the concentrations of monoterpene oxidation product have so far been scarce. In this study we developed proxies for the concentrations of monoterpenes and their oxidation products at a boreal forest site in Hyytiälä, southern Finland. For deriving the proxies we used the monoterpene concentration measured with a proton transfer reaction mass spectrometer (PTR-MS during 2006–2013. Our proxies for the monoterpene concentration take into account the temperature-controlled emissions from the forest ecosystem, the dilution caused by the mixing within the boundary layer and different oxidation processes. All the versions of our proxies captured the seasonal variation of the monoterpene concentration, the typical proxy-to-measurements ratios being between 0.8 and 1.3 in summer and between 0.6 and 2.6 in winter. In addition, the proxies were able to describe the diurnal variation of the monoterpene concentration rather well, especially in summer months. By utilizing one of the proxies, we calculated the concentration of oxidation products of monoterpenes by considering their production in the oxidation and their loss due to condensation on aerosol particles. The concentration of oxidation products was found to have a clear seasonal cycle, with a maximum in summer and a minimum in winter. The concentration of oxidation products was lowest in the morning or around noon and highest in the evening. In the future, our proxies for the monoterpene concentration and their oxidation products can be used, for example, in the analysis of new particle formation and growth in boreal environments.

  11. Comparison of the composition of forest soil litter derived from three different sites at various decompositional stages using FTIR spectroscopy

    International Nuclear Information System (INIS)

    Haberhauer, G.; Rafferty, B.; Strebl, F.; Gerzabek, M. H.

    1998-06-01

    Transmission Fourier transformed infrared spectroscopy was used to compare organic soil layers originating from three different sites in two climatic regions. A variety of bands characteristic of molecular structures and functional groups have been identified for these samples from a humic podsol, a dystric cambisol and a spodo dystric cambisol. Similar results were obtained for all three soils. From L to H soil horizons, an increase of the band at 1630 cm -1 and decrease of bands in the region from 1510 cm -1 to 1230 cm -1 were observed. The band at 1630 cm -1 can be assigned to carboxylic and aromatic groups. The decline of the peak intensity at 1510 cm -1 is significantly correlated to the total carbon content and C/N ratio. The mineral material of the Ah horizons leads to an increase of the band at 1050 cm -1 due to IR-absorbance of the Si-O bond and to an appearance of bands in the region from 900 to 400 cm -1 , which are characteristic for clay and quartz minerals. Analysis of the FTIR absorbance showed that intensities of distinct peaks (e.g., at 1510 cm -1 ) can be a measure of decomposition of forest litter. Therefore, the proposed simple FTIR method has potential for identification and differentiation of organic soil horizons originating from known tree litter. The similarity of the characteristics of the spectra of the three soil profiles investigated suggests a broad applicability of this method to distinguish organic forest soil horizons. On the basis of the data presented in this study, it may be concluded that FTIR spectroscopy offers a simple, powerful, non-destructive tool for the investigation of decomposition of L to H horizons in forest soils. (author)

  12. NPP Temperate Forest: OTTER Project Sites, Oregon, USA, 1989-1991, R1

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set provides net primary productivity (NPP) estimates and associated field measurements for six sites located along the 250-km, west-east transect of the...

  13. Forest report 2013; Waldzustandsbericht 2013

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2013-07-01

    This forest report of Lower Saxony (Germany) contains the following topics: weather and climate, forest protection, crown defoliation, infiltrated substances, environmental monitoring, insects and fungi, forest soil survey and forest site mapping, and nutritional status of beech on loess.

  14. Plant traits, productivity, biomass and soil properties from forest sites in the Pacific Northwest, 1999–2014

    Science.gov (United States)

    Berner, Logan T.; Law, Beverly E.

    2016-01-01

    Plant trait measurements are needed for evaluating ecological responses to environmental conditions and for ecosystem process model development, parameterization, and testing. We present a standardized dataset integrating measurements from projects conducted by the Terrestrial Ecosystem Research and Regional Analysis- Pacific Northwest (TERRA-PNW) research group between 1999 and 2014 across Oregon and Northern California, where measurements were collected for scaling and modeling regional terrestrial carbon processes with models such as Biome-BGC and the Community Land Model. The dataset contains measurements of specific leaf area, leaf longevity, leaf carbon and nitrogen for 35 tree and shrub species derived from more than 1,200 branch samples collected from over 200 forest plots, including several AmeriFlux sites. The dataset also contains plot-level measurements of forest composition, structure (e.g., tree biomass), and productivity, as well as measurements of soil structure (e.g., bulk density) and chemistry (e.g., carbon). Publically-archiving regional datasets of standardized, co-located, and geo-referenced plant trait measurements will advance the ability of earth system models to capture species-level climate sensitivity at regional to global scales. PMID:26784559

  15. Plant traits, productivity, biomass and soil properties from forest sites in the Pacific Northwest, 1999-2014

    Science.gov (United States)

    Berner, Logan T.; Law, Beverly E.

    2016-01-01

    Plant trait measurements are needed for evaluating ecological responses to environmental conditions and for ecosystem process model development, parameterization, and testing. We present a standardized dataset integrating measurements from projects conducted by the Terrestrial Ecosystem Research and Regional Analysis- Pacific Northwest (TERRA-PNW) research group between 1999 and 2014 across Oregon and Northern California, where measurements were collected for scaling and modeling regional terrestrial carbon processes with models such as Biome-BGC and the Community Land Model. The dataset contains measurements of specific leaf area, leaf longevity, leaf carbon and nitrogen for 35 tree and shrub species derived from more than 1,200 branch samples collected from over 200 forest plots, including several AmeriFlux sites. The dataset also contains plot-level measurements of forest composition, structure (e.g., tree biomass), and productivity, as well as measurements of soil structure (e.g., bulk density) and chemistry (e.g., carbon). Publically-archiving regional datasets of standardized, co-located, and geo-referenced plant trait measurements will advance the ability of earth system models to capture species-level climate sensitivity at regional to global scales.

  16. Non-timber Forest Products, Their Vulnerability and Conservation in a Designated UNESCO Heritage Site of Arunanchal Pradesh, India

    Directory of Open Access Journals (Sweden)

    Kaushalendra Kumar JHA

    2015-12-01

    Full Text Available The Apatani, non-nomadic tribe, have evolved an ecologically sustainable system of rural forestry in Ziro Valley, a proposed heritage site of UNESCO. They have been using non-timber forest products (NTFPs grown in homestead and nearby forests for a very long period. The present study was aimed at identification of priority NTFPs and uses, their availability status and availability trend, conservation need, and sustainability interventions. Qualitative methods of research like, exploratory survey, questionnaire survey, focus group discussion, semi-structured interview of key informants, etc. were employed for data collection. The Apatani used 112 priority NTFPs for food supplement, herbal medicine, house building material and other purposes. However, on the basis of ecological importance such NTFPs were categorized as very low, low, moderate, high, and very high vulnerable species. Twenty vulnerable species like Antiitari ayi (Actinidia callosa, Biiling (Choerospondias axillaris, Henchi (Rubus niveus, Jojuru ayi (Coccinia grandis, Ngiilyang Khiiko (Centella asiatica etc. should be conserved and seventeen not vulnerable species at this stage like, Padii hamang (Cardamine hirsute, Sankhe (Quercus griffithii, Bije (Phyllostachys manii, Hiigu hamang (Oenanthe javanica, Kiira (Quercus dealbata , etc. could be commercialized. However, a balance needed to be struck between commercialization and conservation by adopting a comprehensive policy based on scientific and traditional Apatani knowledge for harvesting and regeneration of NTFPs. Homegardening or community farming is recommended for sustainable supply of commercially important species to be domasticated.

  17. Study of the transfer of radionuclides in trees at a forest site

    International Nuclear Information System (INIS)

    Barci-Funel, G.; Dalmasso, J.; Barci, V.L.; Ardisson, G.

    1995-01-01

    The transfer of radionuclides such as 137 Cs and 90 Sr from soil to trees (conifers) was studied in a forest area, the Boreon massif, 30 km north of Nice in South Eastern France. This area has been highly contaminated after the Chernobyl accident. Besides the γ-emitting fission products, the α-emitters 238 Pu and 239+240 Pu and the pure β-emitter 90 Sr were measured in different parts of the studied trees (roots, branches, twigs, etc.). As has already been reported by other authors, the radionuclide activities in the tree rings are not correlated with the fallout deposition. They were found varying according to the sap flux in the tree and higher in sapwood than in heartwood. For cesium the root absorption was found to be lower than the atmospheric deposition. Soil-to-plant concentration factors were calculated for 137 Cs, 90 Sr and 239+240 Pu

  18. A cross-site comparison of factors influencing soil nitrification rates in northeastern USA forested watersheds

    Science.gov (United States)

    Ross, D.S.; Wemple, B.C.; Jamison, A.E.; Fredriksen, G.; Shanley, J.B.; Lawrence, G.B.; Bailey, S.W.; Campbell, J.L.

    2009-01-01

    Elevated N deposition is continuing on many forested landscapes around the world and our understanding of ecosystem response is incomplete. Soil processes, especially nitrification, are critical. Many studies of soil N transformations have focused on identifying relationships within a single watershed but these results are often not transferable. We studied 10 small forested research watersheds in the northeastern USA to determine if there were common factors related to soil ammonification and nitrification. Vegetation varied between mixed northern hardwoods and mixed conifers. Watershed surface soils (Oa or A horizons) were sampled at grid or transect points and analyzed for a suite of chemical characteristics. At each sampling point, vegetation and topographic metrics (field and GIS-based) were also obtained. Results were examined by watershed averages (n = 10), seasonal/watershed averages (n = 28), and individual sampling points (n = 608). Using both linear and tree regression techniques, the proportion of conifer species was the single best predictor of nitrification rates, with lower rates at higher conifer dominance. Similar to other studies, the soil C/N ratio was also a good predictor and was well correlated with conifer dominance. Unlike other studies, the presence of Acer saccharum was not by itself a strong predictor, but was when combined with the presence of Betula alleghaniensis. Topographic metrics (slope, aspect, relative elevation, and the topographic index) were not related to N transformation rates across the watersheds. Although found to be significant in other studies, neither soil pH, Ca nor Al was related to nitrification. Results showed a strong relationship between dominant vegetation, soil C, and soil C/N. ?? 2008 Springer Science+Business Media, LLC.

  19. Seasonal variations of dissolved organic carbon in precipitation over urban and forest sites in central Poland.

    Science.gov (United States)

    Siudek, Patrycja; Frankowski, Marcin; Siepak, Jerzy

    2015-07-01

    Spatial and temporal variability of carbon species in rainwater (bulk deposition) was studied for the first time at two sites located in urban area of Poznań City and protected woodland area (Jeziory), in central Poland, between April and December 2013. The mean concentration of total carbon (TC) for the first site was 5.86 mg L(-1), whereas for the second, 5.21 mg L(-1). Dissolved organic carbon (DOC) concentration accounted for, on average, 87 and 91 % of total carbon in precipitation at urban and non-urban sites, respectively. Significant changes in TC concentrations in rainwater were observed at both sites, indicating that atmospheric transformation, transport, and removal mechanisms of carbonaceous particles were affected by seasonal fluctuations in biogenic/anthropogenic emission and meteorological conditions (i.e., precipitation height and type, atmospheric transport). During the warm season, the DOC concentration in rainwater was mostly influenced by mixed natural and anthropogenic sources. In contrast, during the cold season, the DOC concentration significantly increased mainly as a result of anthropogenic activities, i.e., intensive coal combustion, domestic wood burning, high-temperature processes, etc. In addition, during the winter measurements, significant differences in mean DOC concentration (Kruskal-Wallis test, p urban and non-urban sites. These data imply that carbonaceous compounds are of crucial importance in atmospheric chemistry and should be considered as an important parameter while considering wet deposition, reactions with different substances, especially over polluted environments.

  20. Multi-criteria Analysis of Air Pollution with SO(2) and PM(10) in Urban Area Around the Copper Smelter in Bor, Serbia.

    Science.gov (United States)

    Nikolić, Djordje; Milošević, Novica; Mihajlović, Ivan; Zivković, Zivan; Tasić, Viša; Kovačević, Renata; Petrović, Nevenka

    2010-02-01

    This work presents the results of 4 years long monitoring of concentrations of SO(2) gas and PM(10) in the urban area around the copper smelter in Bor. The contents of heavy metals Pb, Cd, Cu, Ni, and As in PM(10) were determined and obtained values were compared to the limit values provided in EU Directives. Manifold excess concentrations of all the components in the atmosphere of the urban area of the townsite Bor were registered. Through application of a multi-criteria analysis by using PROMETHEE/GAIA method, the zones were ranked according to the level of pollution.

  1. Administrative goals and safety standards for hazard control on forested recreation sites

    Science.gov (United States)

    Lee A. Paine

    1973-01-01

    For efficient control of tree hazard on recreation sites, a specific administrative goal must be selected. A safety standard designed to achieve the selected goal and a uniform hazard-rating procedure will then promote a consistent level of safety at an acceptable cost. Safety standards can be established with the aid of data for past years, and dollar evaluations are...

  2. Response of Competing Vegetation to Site Preparation on West Gulf Coastal Plain Commercial Forest Land

    Science.gov (United States)

    Gale L. Wolters; Henry A. Pearson; Ronald E. Thill; V. Clark Baldwin; Alton Martin

    1995-01-01

    The response of woody and herbaceous vegetation to site preparation, subsoil texture, and fertilization was measured on the West Gulf Coastal Plain. The influences of these treatments on competing vegetation were short-term. Drastic soil disturbance and fertilization briefly increased herbage production. Shear-windrow and shear-disk were generally the most effective...

  3. Growth of 11 introduced tree species on selected forest sites in Hawaii

    Science.gov (United States)

    Michael G Buck; Roger H. Imoto

    1982-01-01

    Growth and volume data for trees on 25 plots reprsenting 11 introduced species in Hawaii were recorded during a 21-year period. Tree were measured at about 5-year intervals to determine overall growth and stand development. The sites selected were considered better-than-average in terms of elevation, amount of precipitation, and soil quality. Except for redwood, stands...

  4. Sugar maple seedling anatomy and element localization at forest sites with differing nutrient levels

    Science.gov (United States)

    Carolyn J. McQuattie; Robert P. Long; Thomas J. Hall

    1999-01-01

    Sugar maple (Acer saccharum Marsh.) seedlings often have poor survival on acidic unglaciated portions of the Allegheny Plateau. Greater survival is found after lime treatment of unglaciated sites or on glaciated areas of the Plateau. The difference in survival rate may depend in part on the acidity or chemical composition of the soil.

  5. Effective tree hazard control on forested recreation sites...losses and protection costs evaluated

    Science.gov (United States)

    Lee A. Paine

    1967-01-01

    Effectiveness of hazard control was evaluated by analyzing data on tree failures, accidents, and control costs on California recreation sites. Results indicate that reduction of limb hazard in oaks and bole hazard in conifers is the most effective form of control. Least effective is limb hazard reduction in conifers. After hazard control goals or control budgets have...

  6. Illustrating harvest effects on site microclimate in a high-elevation forest stand.

    Science.gov (United States)

    W.B. Fowler; T.D. Anderson

    1987-01-01

    Three-dimensional contour surfaces were drawn for physiologically active radiation (PAR) and air and soil temperatures from measurements taken at a high-elevation site (1450 m) near the crest of the Cascade Range in central Washington. Measurements in a clearcut were compared with measurements from an adjacent uncut stand. Data for 31 days in July and August 1985...

  7. Combined use of stable isotopes and fallout radionuclides as soil erosion indicators in a forested mountain site, South Korea

    Energy Technology Data Exchange (ETDEWEB)

    Meusburger, K.; Mabit, L.; Alewell, C. [Basel Univ. (Switzerland). Environmental Geosciences; Park, J.H. [Ewha Womans Univ., Seoul (Korea, Republic of). Dept. of Environmental Science and Engineering; Sandor, T. [Central Agricultural Office Food and Feed Safety Directorate (Hungary). Radioanalytical Reference Lab.

    2013-07-01

    The aim of this study is to assess and to validate the suitability of the stable nitrogen and carbon isotope signature as soil erosion indicators in a mountain forest site in South Korea. Our approach is based on the comparison of the isotope signature of ''stable'' landscape positions (reference sites), which are neither affected by erosion nor deposition, with eroding sites. For undisturbed soils we expect that the enrichment of δ{sup 15}N and δ{sup 13}C with soil depth, due to fractionation during decomposition, goes in parallel with a decrease in nitrogen and carbon content. Soil erosion processes potentially weaken this correlation. The {sup 137}Cs method and the Revised Universal Soil Loss Equation (RUSLE) were applied for the soil erosion quantification. Erosion rates obtained with the {sup 137}Cs method range from 0.9 t ha{sup -1} yr{sup -1} to 7 t ha{sup -1} yr{sup -1}. Considering the steep slopes of up to 40 and the erosive monsoon events (R factor of 6600 MJ mm ha{sup -1} h{sup -1} yr {sup -1}), the rates are plausible and within the magnitude of the RUSLE-modeled soil erosion rates, varying from 0.02 t ha{sup -1} yr{sup -1} to 5.1 t ha{sup -1} yr{sup -1}. The soil profiles of the reference sites showed significant (p < 0.0001) correlations between nitrogen and carbon content and its corresponding δ{sup 15}N and δ{sup 13}C signatures. In contrast, for the eroding sites this relationship was weaker and for the carbon not significant. These results confirm the usefulness of the stable carbon isotope signature as a qualitative indicator for soil disturbance. We could show further that the δ{sup 15}N isotope signature can be used similarly for uncultivated sites. We thus propose that the stable δ{sup 15}N and δ{sup 13}C signature of soil profiles could serve as additional indicators confirming the accurate choice of the reference site in soil erosion studies using the {sup 137}Cs method.

  8. Element fluxes through European forest ecosystems and their relationships with stand and site characteristics

    International Nuclear Information System (INIS)

    Vries, W. de; Salm, C. van der; Reinds, G.J.; Erisman, J.W.

    2007-01-01

    This paper describes a European wide assessment of element budgets, using available data on deposition, meteorology and soil solution chemistry at 121 Intensive Monitoring plots. Input fluxes from the atmosphere were derived from fortnightly or monthly measurements of bulk deposition and throughfall, corrected for canopy uptake. Element outputs from the forest ecosystem were derived by multiplying fortnightly or monthly measurements of the soil solution composition at the bottom of the root zone with simulated unsaturated soil water fluxes. Despite the uncertainties in the calculated budgets, the results indicate that: (i) SO 4 is still the dominant source of actual soil acidification despite the generally lower input of S than N, due to the different behaviour of S (near tracer) and N (strong retention); (ii) base cation removal due to man-induced soil acidification is limited; and (iii) Al release is high in areas with high S inputs and low base status. - An assessment of element budgets, using available data on deposition, meteorology and soil solution chemistry at 121 Intensive Monitoring plots in Europe

  9. The Niwot Ridge Subalpine Forest US-NR1 AmeriFlux site - Part 1: Data acquisition and site record-keeping

    Science.gov (United States)

    Burns, Sean P.; Maclean, Gordon D.; Blanken, Peter D.; Oncley, Steven P.; Semmer, Steven R.; Monson, Russell K.

    2016-09-01

    The Niwot Ridge Subalpine Forest AmeriFlux site (US-NR1) has been measuring eddy-covariance ecosystem fluxes of carbon dioxide, heat, and water vapor since 1 November 1998. Throughout this 17-year period there have been changes to the instrumentation and improvements to the data acquisition system. Here, in Part 1 of this three-part series of papers, we describe the hardware and software used for data-collection and metadata documentation. We made changes to the data acquisition system that aimed to reduce the system complexity, increase redundancy, and be as independent as possible from any network outages. Changes to facilitate these improvements were (1) switching to a PC/104-based computer running the National Center for Atmospheric Research (NCAR) In-Situ Data Acquisition Software (NIDAS) that saves the high-frequency data locally and over the network, and (2) time-tagging individual 10 Hz serial data samples using network time protocol (NTP) coupled to a GPS-based clock, providing a network-independent, accurate time base. Since making these improvements almost 2 years ago, the successful capture of high-rate data has been better than 99.98 %. We also provide philosophical concepts that shaped our design of the data system and are applicable to many different types of environmental data collection.

  10. United States Department of Agriculture Forest Service 1996 annual report wetlands research related to the Pen Branch restoration effort on the Savannah River site

    Energy Technology Data Exchange (ETDEWEB)

    Nelson, E.A. [Westinghouse Savannah River Company, Aiken, SC (United States); Kolka, R.K. [USDA Forest Service, Charleston, SC (United States); Trettin, C.C. [USDA Forest Service, Charleston, SC (United States)

    1997-01-01

    This report documents the role of the USDA Forest Service and their collaborators (SRTC, SREL, and several universities) in wetlands monitoring and research on the Savannah River Site. This report describes the rationales, methods, and results (when available) of these studies and summarizes and integrates the available information through 1996.

  11. Seed longevity and dormancy state suggest management strategies for garlic mustard (Alliaria petiolata) and Japanese stiltgrass (Microstegium vimineum) in deciduous forest sites

    Science.gov (United States)

    Mame E. Redwood; Glenn R. Matlack; Cynthia D. Huebner

    2018-01-01

    An effective management plan for invasive herb populations must consider the potential for regeneration from the soil seedbank. To test chis potential, we examined two species, Japanese scilcgrass and garlic mustard, at deciduous forest sites in southeastern Ohio. Seeds were buried in nylon mesh bags and recovered at regular intervals over 24 mo. Recovered seeds were...

  12. Environmental stress in German forests; assessment of critical deposition levels and their exceedances and meteorological stress for crown condition monitoring sites in Germany

    NARCIS (Netherlands)

    Klap, J.M.; Reinds, G.J.; Bleeker, A.; Vries, de W.

    2000-01-01

    Site-specific estimations of meteorological stress and atmospheric deposition were made for the systematic 8 x 8 km2 forest condition monitoring network in Germany for the years 1987-1995. Winter cold and late frost were important temperature stress variables and relative transpiration was a good

  13. Temporal change in soil carbon stability at a paired old-growth douglas-fir forest/clear-cut site

    Science.gov (United States)

    Forest ecosystems are estimated to contain one-half of the total terrestrial carbon (C) pool (1146 Pg), with two-thirds of this C (787 Pg) residing in forest soils. Given the magnitude of this C pool, it is critical to understand the effects of forest management practices on soil...

  14. LBA-ECO TG-07 Ground-based Biometry Data at km 83 Site, TapajosNational Forest: 1997

    Science.gov (United States)

    M.M. Keller; M.W. Palace

    2009-01-01

    A field inventory of trees was conducted in March of 1997 in a logging concession at the Tapajos National Forest, south of Santarem, Para, Brazil. The inventory was conducted by the foresters and technicians of the Tropical Forest Foundation (FFT) and included all trees with diameter at breast height greater than or equal to 35 cm. Four blocks of approximately 100 ha...

  15. Connecting non-timber forest products stakeholders to information and knowledge: A case study of an Internet web site

    Science.gov (United States)

    James Chamberlain; Matt Winn; A.L. Hammett

    2009-01-01

    Many products are harvested from forests that are not timber-based but are based on plant materials. These non-timber forest products (NTFPs) have not been fully incorporated into economic development programs, yet they provide significant monetary benefits for rural entrepreneurs. Interest in NTFPs as alternative forest enterprises and sources of additional income has...

  16. Exemplifying whole-plant ozone uptake in adult forest trees of contrasting species and site conditions

    International Nuclear Information System (INIS)

    Nunn, Angela J.; Wieser, Gerhard; Metzger, Ursula; Loew, Markus; Wipfler, Philip; Haeberle, Karl-Heinz; Matyssek, Rainer

    2007-01-01

    Whole-tree O 3 uptake was exemplified for Picea abies, Fagus sylvatica and Larix decidua in stands at high and low altitude and contrasting water availability through sap flow measurement in tree trunks, intrinsically accounting for drought and boundary layer effects on O 3 flux. O 3 uptake of evergreen spruce per unit foliage area was enhanced by 100% at high relative to low elevation, whereas deciduous beech and larch showed similar uptake regardless of altitude. The responsiveness of the canopy conductance to water vapor and, as a consequence, O 3 uptake to soil moisture and air humidity did not differ between species. Unifying findings at the whole-tree level will promote cause-effect based O 3 risk assessment and modeling. - Sap flow-based assessment of whole-tree O 3 uptake reflects similar responsiveness of canopy conductance and O 3 uptake across contrasting tree species and site conditions

  17. Ozone, OH and NO3 sink terms at a coniferous forest site in Central Germany: Role of biogenic VOCs

    Science.gov (United States)

    Bonn, B.; Bourtsoukidis, S.; Haunold, W.; Sitals, R.; Jacobi, S.

    2012-04-01

    Oxidation capacities of ecosystems are important to facilitate an ecosystem feedback on oxidation stress and in order to survive. We have conducted seasonal ambient measurements of a series of biogenic VOCs using a plant enclosure technique and determined the ambient levels of ozone, NOx as well as basic meteorological parameters at a managed spruce forest site in Central Germany (Mt. Kleiner Feldberg). The site is 810 m a.s.l. and faces distinct anthropogenic contributions from the Rhine-Main-area including the airport and major traffic routes in from the southeast. The opposite direction is moderately polluted and can be classified as Central German background condition. Since atmospheric chemistry and pollutants become very important especially for this site, which is the most polluted one in Germany with respect to ozone we approximated the sink terms for the atmospheric oxidation agents of interest at this site, i.e ozone, OH and NO3 using the measurements and box model steady state calculations for intermediate species not measured directly between the first of April and the start of November 2011. BVOC measurements were obtained with PTR-MS every 36 s and averaged for 30 min intervals afterwards to facilitate the inclusion of the monitoring data of the Hessian Agency for the Environment and Geology (HLUG) in Wiesbaden, Germany: temperature, humidity, global radiation, ozone and NOx. Analysis was performed with Matlab (Mathworks Inc.) and included the gas-phase chemistry set-up described by the Master Chemical Mechanism (MCM, v3, [1]). This resulted in the following outcome for sinks of oxidants: Ozone: Significant contributions were found for mono- and sesquiterpenes as well as for NOx. The individual contributions vary notably with the time of the day and the year and the emission strength of biogenic VOCs. Especially for the early season in April sesquiterpene reactions dominated the sink by up to 80% during nighttime, while NOx reactions dominated the

  18. Polarized localization and borate-dependent degradation of the Arabidopsis borate transporter BOR1 in tobacco BY-2 cells [v1; ref status: indexed, http://f1000r.es/kv

    Directory of Open Access Journals (Sweden)

    Noboru Yamauchi

    2013-09-01

    Full Text Available In Arabidopsis the borate transporter BOR1, which is located in the plasma membrane, is degraded in the presence of excess boron by an endocytosis-mediated mechanism. A similar mechanism was suggested in rice as excess boron decreased rice borate transporter levels, although in this case whether the decrease was dependent on an increase in degradation or a decrease in protein synthesis was not elucidated. To address whether the borate-dependent degradation mechanism is conserved among plant cells, we analyzed the fate of GFP-tagged BOR1 (BOR1-GFP in transformed tobacco BY-2 cells. Cells expressing BOR1-GFP displayed GFP fluorescence at the plasma membrane, especially at the membrane between two attached cells. The plasma membrane signal was abolished when cells were incubated in medium with a high concentration of borate (3 to 5 mM. This decrease in BOR1-GFP signal was mediated by a specific degradation of the protein after internalization by endocytosis from the plasma membrane. Pharmacological analysis indicated that the decrease in BOR1-GFP largely depends on the increase in degradation rate and that the degradation was mediated by a tyrosine-motif and the actin cytoskeleton. Tyr mutants of BOR1-GFP, which has been shown to inhibit borate-dependent degradation in Arabidopsis root cells, did not show borate-dependent endocytosis in tobacco BY-2 cells. These findings indicate that the borate-dependent degradation machinery of the borate transporter is conserved among plant species.

  19. Dispersal of radioactivity by wildlife from contaminated sites in a forested landscape

    Energy Technology Data Exchange (ETDEWEB)

    Garten, C.T. [Oak Ridge National Lab., TN (United States). Environmental Sciences Div.

    1995-12-31

    Oak Ridge National Laboratory (ORNL) is located within the Valley and Ridge Physiographic Province of eastern Tennessee (USA). Wildlife populations have access to some radioactively contaminated sites at ORNL. Contaminated animals or animal nests within the Laboratory`s boundaries have been found to contain {sup 90}Sr or {sup 137}Cs on the order of 10{sup -2}-10{sup 4} Bq g{sup -1} and trace amounts of other radionuclides (including transuranic elements). Animals that are capable of flight and animals with behaviour patterns or developmental life stages involving contact with sediments in radioactive ponds, like benthic invertebrates, present the greatest potential for dispersal of radioactivity. The emigration of frogs and turtles from waste ponds also presents a potential for dispersal of radioactivity but over distances < 5 km. Mud-dauber wasps (Hymenoptera) and swallows (Hirundinidae) may transport radioactive mud for nest building, but also over relatively short distances (0.2-1 km). Movement by small mammals is limited by several factors, including physical barriers and smaller home ranges. Larger animals, like white-tailed deer (Odocoileus virginianus) are potential vectors of radioactivity due to their greater body size, longer life expectancy, and larger home range. Larger animals contain greater amounts of total radioactivity than smaller animals, but tissue concentrations of {sup 137}Cs generally decline with body size. (author).

  20. Irradiation Microstructure of Austenitic Steels and Cast Steels Irradiated in the BOR-60 Reactor at 320°C

    Science.gov (United States)

    Yang, Yong; Chen, Yiren; Huang, Yina; Allen, Todd; Rao, Appajosula

    Reactor internal components are subjected to neutron irradiation in light water reactors, and with the aging of nuclear power plants around the world, irradiation-induced material degradations are of concern for reactor internals. Irradiation-induced defects resulting from displacement damage are critical for understanding degradation in structural materials. In the present work, microstructural changes due to irradiation in austenitic stainless steels and cast steels were characterized using transmission electron microscopy. The specimens were irradiated in the BOR-60 reactor, a fast breeder reactor, up to 40 dpa at 320°C. The dose rate was approximately 9.4x10-7 dpa/s. Void swelling and irradiation defects were analyzed for these specimens. A high density of faulted loops dominated the irradiated-altered microstructures. Along with previous TEM results, a dose dependence of the defect structure was established at 320°C.

  1. A Study of the Optimal Model of the Flotation Kinetics of Copper Slag from Copper Mine BOR

    Science.gov (United States)

    Stanojlović, Rodoljub D.; Sokolović, Jovica M.

    2014-10-01

    In this study the effect of mixtures of copper slag and flotation tailings from copper mine Bor, Serbia on the flotation results of copper recovery and flotation kinetics parameters in a batch flotation cell has been investigated. By simultaneous adding old flotation tailings in the ball mill at the rate of 9%, it is possible to increase copper recovery for about 20%. These results are compared with obtained copper recovery of pure copper slag. The results of batch flotation test were fitted by MatLab software for modeling the first-order flotation kinetics in order to determine kinetics parameters and define an optimal model of the flotation kinetics. Six kinetic models are tested on the batch flotation copper recovery against flotation time. All models showed good correlation, however the modified Kelsall model provided the best fit.

  2. Parameter optimization, sensitivity, and uncertainty analysis of an ecosystem model at a forest flux tower site in the United States

    Science.gov (United States)

    Wu, Yiping; Liu, Shuguang; Huang, Zhihong; Yan, Wende

    2014-01-01

    Ecosystem models are useful tools for understanding ecological processes and for sustainable management of resources. In biogeochemical field, numerical models have been widely used for investigating carbon dynamics under global changes from site to regional and global scales. However, it is still challenging to optimize parameters and estimate parameterization uncertainty for complex process-based models such as the Erosion Deposition Carbon Model (EDCM), a modified version of CENTURY, that consider carbon, water, and nutrient cycles of ecosystems. This study was designed to conduct the parameter identifiability, optimization, sensitivity, and uncertainty analysis of EDCM using our developed EDCM-Auto, which incorporated a comprehensive R package—Flexible Modeling Framework (FME) and the Shuffled Complex Evolution (SCE) algorithm. Using a forest flux tower site as a case study, we implemented a comprehensive modeling analysis involving nine parameters and four target variables (carbon and water fluxes) with their corresponding measurements based on the eddy covariance technique. The local sensitivity analysis shows that the plant production-related parameters (e.g., PPDF1 and PRDX) are most sensitive to the model cost function. Both SCE and FME are comparable and performed well in deriving the optimal parameter set with satisfactory simulations of target variables. Global sensitivity and uncertainty analysis indicate that the parameter uncertainty and the resulting output uncertainty can be quantified, and that the magnitude of parameter-uncertainty effects depends on variables and seasons. This study also demonstrates that using the cutting-edge R functions such as FME can be feasible and attractive for conducting comprehensive parameter analysis for ecosystem modeling.

  3. Snowpack-atmosphere gas exchanges of carbon dioxide, ozone, and nitrogen oxides at a hardwood forest site in northern Michigan

    Directory of Open Access Journals (Sweden)

    Brian Seok

    2015-03-01

    Full Text Available Abstract Snowpack-atmosphere gas exchanges of CO2, O3, and NOx (NO + NO2 were investigated at the University of Michigan Biological Station (UMBS, a mid-latitude, low elevation hardwood forest site, during the 2007–2008 winter season. An automated trace gas sampling system was used to determine trace gas concentrations in the snowpack at multiple depths continuously throughout the snow-covered period from two adjacent plots. One natural plot and one with the soil covered by a Tedlar sheet were setup for investigating whether the primary source of measured trace gases was biogenic (i.e., from the soil or non-biogenic (i.e., from the snowpack. The results were compared with the “White on Green” study conducted at the Niwot Ridge (NWT Long Term Ecological Research site in Colorado. The average winter CO2 flux ± s.e. from the soil at UMBS was 0.54 ± 0.037 µmol m-2 s-1 using the gradient diffusion method and 0.71 ± 0.012 µmol m-2 s-1 using the eddy covariance method, and in a similar range as found for NWT. Observed snowpack-O3 exchange was also similar to NWT. However, nitrogen oxides (NOx fluxes from snow at UMBS were 10 times smaller than those at NWT, and fluxes were bi-directional with the direction of the flux dependent on NOx concentrations in ambient air. The compensation point for the change in the direction of NOx flux was estimated to be 0.92 nmol mol-1. NOx in snow also showed diurnal dependency on incident radiation. These NOx dynamics in the snow at UMBS were notably different compared to NWT, and primarily determined by snow-atmosphere interactions rather than by soil NOx emissions.

  4. Vertical fogwater flux measurements above an elevated forest canopy at the Lägeren research site, Switzerland

    Science.gov (United States)

    Burkard, Reto; Bützberger, Patrick; Eugster, Werner

    During the winter of 2001/2002 wet and occult deposition measurements were performed at the Lägeren research site ( 690 m a.s.l.) in Switzerland. Two types of fog were observed: radiation fog (RF) and fog associated with atmospheric instabilities (FAI). The deposition measurements were performed above the forest canopy on a 45 m high tower. Occult deposition was measured by means of the eddy covariance method. Due to the large differences of microphysical properties of the two fog types, the liquid water fluxes were much higher (6.9 mg m -2 s-1) during RF than during FAI (0.57 mg m -2 s-1) . Fogwater concentrations were considerably enhanced during RF compared with FAI. The comparison of fog and rain revealed that fogwater nutrient concentrations were 3-66 times larger than concentrations in precipitation. The considerably larger water fluxes and nutrient concentrations of RF resulted in much higher nutrient deposition compared with FAI. In winter when RF was quite frequent, occult deposition was the dominant pathway for nitrate and ammonium deposition. Daily fluxes of total inorganic nitrogen were 1.89 mg m -2 d-1 by occult and 1.01 mg m -2 d-1 by wet deposition. The estimated contribution of occult deposition to total annual nitrogen input was 16.4% or 4.3 kg N ha -1 yr-1, and wet deposition contributed 26.5% ( 6.9 kg N ha -1 yr-1) . As a consequence, critical loads of annual N-input were exceeded, resulting in a significant over-fertilization at the Lägeren site.

  5. An interaction site of the envelope proteins of Semliki Forest virus that is preserved after proteolytic activation

    International Nuclear Information System (INIS)

    Zhang Xinyong; Kielian, Margaret

    2005-01-01

    Semliki Forest virus (SFV) membrane fusion is mediated by the viral E1 protein at acidic pH and regulated by the dimeric interaction of E1 with the E2 membrane protein. During low pH-triggered fusion, the E2/E1 heterodimer dissociates, freeing E1 to drive membrane fusion. E2 is synthesized as a precursor, p62, which is processed to mature E2 by the cellular protease furin. Both the dissociation of the p62/E1 dimer and the fusion reaction of p62 virus have a more acidic pH threshold than that of the mature E2 virus. We have previously isolated SFV mutations that allow virus growth in furin-deficient cells. Here we have used such pci mutations to compare the interactions of the p62/E1 and E2/E1 dimers. Our data suggest that there is an important p62/E1 dimer interaction site identified by an E2 R250G mutation and that this interaction is maintained after processing to the mature E2 protein

  6. Size of Specially Protected Forest Sites for Raptors: What Size of These Sites Should be for Protect the Raptor’s Breeding Territories?

    Directory of Open Access Journals (Sweden)

    Igor V. Karyakin

    2018-03-01

    Full Text Available The article analyzes the influence of various types of felling on the occupation of breeding territories by different species of raptors mainly in the Altai Territory forests. Responses of birds of prey to the disturbance factor are also analyzed. Flight initiation distance is determined for each species. A review of international and Russian experience of buffer zones and specially protected forest areas (SPFA around nests of raptors was made. On this basis, the article presents the sizes of specially protected forest areas, thus it is possible to preserve breeding territories of different birds of prey species.

  7. Modelling the carbon budget of intensive forest monitoring sites in Germany using the simulation model BIOME-BGC

    OpenAIRE

    Jochheim, H.; Puhlmann, M.; Beese, F.; Berthold, D.; Einert, P.; Kallweit, R.; Konopatzky, A.; Meesenburg, H.; Meiwes, K.-J.; Raspe, S.; Schulte-Bisping, H.; Schulz, C.

    2008-01-01

    It is shown that by calibrating the simulation model BIOME-BGC with mandatory and optional Level II data, within the ICP Forest programme, a well-founded calculation of the carbon budget of forest stands is achievable and, based on succeeded calibration, the modified BIOME-BGC model is a useful tool to assess the effect of climate change on forest ecosystems. peerReviewed

  8. Soil microbial biomass under pine forests in the north-western Spain: influence of stand age, site index and parent material

    Energy Technology Data Exchange (ETDEWEB)

    Mahia, J.; Perez-Ventura, L.; Cabaneiro, A.; Diaz-Ravina, M.

    2006-07-01

    The effects of stand age, site index and parent material on soil biochemical properties related to biomass (extractable C, microbial C and metabolic quotient) were examined in the 0-15 cm mineral soil layers of Pinus pinaster and Pinus sylvestris stand from NW Spain. Two productivity levels (low and high site index), two ages (young and old) and two parent soil materials (granite and acid schists) were considered. The data indicated that there were differences in microbial parameters in soils under different species. In general in P. pinaster forest higher values of biochemical parameters expressed on organic C basis, were observed in the stands of high site index as compared with the low ones; in contrast, in P. sylvestris no differences among stand site index were detected. In both species different results were also observed depending on parent material and a significant effect of stand age was detected for extractable C and microbial C in P. pinaster forest developed over granite. The data seem to indicate that measured parameters may have the potential to be used as indicators of the effect of forest management on soil organic matter quality. (Author) 25 refs.

  9. Size of Specially Protected Forest Sites for Raptors: What Size of These Sites Should be for Protect the Raptor’s Breeding Territories?

    OpenAIRE

    Igor V. Karyakin; Elvira G. Nikolenko; Sergey V. Bakka

    2018-01-01

    The article analyzes the influence of various types of felling on the occupation of breeding territories by different species of raptors mainly in the Altai Territory forests. Responses of birds of prey to the disturbance factor are also analyzed. Flight initiation distance is determined for each species. A review of international and Russian experience of buffer zones and specially protected forest areas (SPFA) around nests of raptors was made. On this basis, the article presents the sizes o...

  10. Growth dynamics of fine roots in a coniferous fern forest site close to Forsmark in the central part of Sweden

    Energy Technology Data Exchange (ETDEWEB)

    Persson, Hans; Stadenberg, Ingela (SLU, Dept. of Ecology and Environmental Research, Uppsala (Sweden))

    2007-12-15

    The seasonal growth dynamics of live and dead roots for trees and the field layer species (g/m2, varying diameter fractions) and live/dead ratios were analysed at a fresh/moist coniferous fern forest site close to the nuclear power plant at Forsmark in the central eastern parts of Sweden. The changes in depth distribution of fine roots were observed at depth intervals of the top humus horizon down to 40 cm in the mineral soil profile. The bulk of living fine roots of trees (< 1 mm in diameter) were found in the mineral soil horizon the total profile down to 40 cm of the mineral soil, where 89, 82, 83 and 89% of the total amount in the whole profile were found. The upper 2.5 cm part of the humus layer contained 83, 81, 100 and 100% of all roots of the humus layer on the four different sampling occasions. High amounts of living fine roots were found in the upper 10 cm of the mineral soil horizon viz. 84, 76, 91 and 69% of the total mineral soil layer. Consequently, both the top soil horizons of the humus and the mineral soil layers were heavily penetrated by living fine roots. The highest proportion of living fine roots was found in the top 2.5 cm of the humus layer. Accordingly, the live/dead ratio of fine roots (< 1 mm in diameter) decreased from the top of the humus layer to the lower part of mineral soil horizon from 8.0-0.3, 0.8-0.2, 4.4-0.4 and 3.3-0.7 (g g-1) for the four sampling occasions, respectively. We concluded that the decrease in the live/ dead ratio was related to decreased vitality with depth of the fine roots in the soil profile. The highest live/dead ratio was found in the upper 2.5 cm of the humus layer for both the tree and field-layer species. This distribution pattern was most evident for tree fine roots < 1 mm in diameter. The mean fine-root biomass (live tissue < 1 mm in diameter) of tree species for the total profile varied on the four sampling occasions between 317, 113, 139 and 248 g m-2. The related fine root necromass (dead tissue

  11. Underestimation of soil carbon stocks by Yasso07, Q, and CENTURY models in boreal forest linked to overlooking site fertility

    Science.gov (United States)

    Ťupek, Boris; Ortiz, Carina; Hashimoto, Shoji; Stendahl, Johan; Dahlgren, Jonas; Karltun, Erik; Lehtonen, Aleksi

    2016-04-01

    The soil organic carbon stock (SOC) changes estimated by the most process based soil carbon models (e.g. Yasso07, Q and CENTURY), needed for reporting of changes in soil carbon amounts for the United Nations Framework Convention on Climate Change (UNFCCC) and for mitigation of anthropogenic CO2 emissions by soil carbon management, can be biased if in a large mosaic of environments the models are missing a key factor driving SOC sequestration. To our knowledge soil nutrient status as a missing driver of these models was not tested in previous studies. Although, it's known that models fail to reconstruct the spatial variation and that soil nutrient status drives the ecosystem carbon use efficiency and soil carbon sequestration. We evaluated SOC stock estimates of Yasso07, Q and CENTURY process based models against the field data from Swedish Forest Soil National Inventories (3230 samples) organized by recursive partitioning method (RPART) into distinct soil groups with underlying SOC stock development linked to physicochemical conditions. These models worked for most soils with approximately average SOC stocks, but could not reproduce higher measured SOC stocks in our application. The Yasso07 and Q models that used only climate and litterfall input data and ignored soil properties generally agreed with two third of measurements. However, in comparison with measurements grouped according to the gradient of soil nutrient status we found that the models underestimated for the Swedish boreal forest soils with higher site fertility. Accounting for soil texture (clay, silt, and sand content) and structure (bulk density) in CENTURY model showed no improvement on carbon stock estimates, as CENTURY deviated in similar manner. We highlighted the mechanisms why models deviate from the measurements and the ways of considering soil nutrient status in further model development. Our analysis suggested that the models indeed lack other predominat drivers of SOC stabilization

  12. Final Report, 2011-2014. Forecasting Carbon Storage as Eastern Forests Age. Joining Experimental and Modeling Approaches at the UMBS AmeriFlux Site

    Energy Technology Data Exchange (ETDEWEB)

    Curtis, Peter [The Ohio State Univ., Columbus, OH (United States); Bohrer, Gil [The Ohio State Univ., Columbus, OH (United States); Gough, Christopher [Virginia Commonwealth Univ., Richmond, VA (United States); Nadelhoffer, Knute [Univ. of Michigan, Ann Arbor, MI (United States)

    2015-03-12

    At the University of Michigan Biological Station (UMBS) AmeriFlux sites (US-UMB and US-UMd), long-term C cycling measurements and a novel ecosystem-scale experiment are revealing physical, biological, and ecological mechanisms driving long-term trajectories of C cycling, providing new data for improving modeling forecasts of C storage in eastern forests. Our findings provide support for previously untested hypotheses that stand-level structural and biological properties constrain long-term trajectories of C storage, and that remotely sensed canopy structural parameters can substantially improve model forecasts of forest C storage. Through the Forest Accelerated Succession ExperimenT (FASET), we are directly testing the hypothesis that forest C storage will increase due to increasing structural and biological complexity of the emerging tree communities. Support from this project, 2011-2014, enabled us to incorporate novel physical and ecological mechanisms into ecological, meteorological, and hydrological models to improve forecasts of future forest C storage in response to disturbance, succession, and current and long-term climate variation

  13. Radionuclides in a deciduous forest surrounding a shallow-land-burial site in the eastern United States

    International Nuclear Information System (INIS)

    Rickard, W.H.; Kirby, L.J.; McShane, M.C.

    1981-06-01

    The objective of this study was to determine if radioactive materials buried in trenches at the Maxey Flats burial ground in eastern Kentucky have migrated into the surrounding oak-hickory forest. Forest floor litter, minearl soil, and tree leaves were sampled and the radionuclide content measured

  14. Nonnative invasive plants in the Penobscot Experimental Forest in Maine, USA: influence of site, silviculture, and land use history

    Science.gov (United States)

    Elizabeth Olson; Laura S. Kenefic; Alison C. Dibble; John C. Brissette

    2011-01-01

    We investigated the occurrence of nonnative invasive plants on approximately 175 ha comprising a long-term, 60-year-old U.S. Forest Service silvicultural experiment and old-field stands in the Penobscot Experimental Forest (PEF) in central Maine. Stands in the silvicultural experiment were never cleared for agriculture, but have been repeatedly partially cut. Our...

  15. Introduction to the Special Section--Bat Habitat Use in Eastern North American Temperate Forests: Site, Stand, an Landscape Effects

    Science.gov (United States)

    Robert T. Brooks; W. Mark Ford

    2006-01-01

    Forest bats of eastern North America select habitats for roosting, foraging, and winter hibernation/migration over a myriad of scales. An understanding of forest-bat habitat use over scales of time and space is important for their conservation and management. The papers in this Special Section report studies of bat habitat use across multiple scales from locations...

  16. Forest canopy uptake of atmospheric nitrogen deposition at eastern U.S. conifer sites: Carbon storage implications?

    Science.gov (United States)

    Herman Sievering; Ivan Fernandez; John Lee; John Hom; Lindsey Rustad

    2000-01-01

    Dry deposition determinations, along with wet deposition and throughfall (TF) measurements, at a spruce fir forest in central Maine were used to estimate the effect of atmospherically deposited nitrogen (N) uptake on forest carbon storage. Using nitric acid and particulate N as well as TF ammonium and nitrate data, the growing season (May-October) net canopy uptake of...

  17. Changing forest water yields in response to climate warming: results from long-term experimental watershed sites across North America

    Science.gov (United States)

    Irena F. Creed; Adam T. Spargo; Julia A. Jones; Jim M. Buttle; Mary B. Adams; Fred D. Beall; Eric G. Booth; John L. Campbell; Dave Clow; Kelly Elder; Mark B. Green; Nancy B. Grimm; Chelcy Miniat; Patricia Ramlal; Amartya Saha; Stephen Sebestyen; Dave Spittlehouse; Shannon Sterling; Mark W. Williams; Rita Winkler; Huaxia. Yao

    2014-01-01

    Climate warming is projected to affect forest water yields but the effects are expected to vary.We investigated how forest type and age affect water yield resilience to climate warming. To answer this question, we examined the variability in historical water yields at long-term experimental catchments across Canada and the United States over 5-year cool and warm...

  18. Description of Some Ecological Factors in Three Forest Sites in Lorestan Province and Their Impact on Myrtle (Myrtus communis L. Essential Oil Yield and Chemical Components

    Directory of Open Access Journals (Sweden)

    Z. Mir-Azadi

    2013-03-01

    Full Text Available Due to the side effects of chemical drugs, special attention is given recently to pharmaceutical plants. Myrtle (Myrtus communis L. is one of the valuable pharmaceutical plants, which is distributed over the vast areas of Iran. Yield and components of essential oil of this plant is dependent on ecological and genetic factors. In order to describe some ecological factors that affect myrtle in Lorestan province, three forest sites (Sepiddasht, Chame-moord, and Hamzeh Camp were selected. Some effective ecological factors on type of essential oil were measured and compared among the sites. To compare the yield and components of essential oil, myrtle leaves were collected during flowering stage in each site. Leaves were dried in open air conditions and the oil was extracted by distillation. Yield of essential oil was calculated and its components were identified by GC and GC/MS. Results showed that maximum yield belongs to Sepiddasht site. The altitude and soil Na, P, and organic carbon content of this site is quite different from other two sites. The main components of essential oils of these three sites had considerable differences. The amount of 9,10 anthracenedione was 29.1% in Sepiddasht site, while it was not found in the oil of Chame-moord site. It seems that differences in ecological and soil properties of the tree sites could have major effect on essential oil yield and its composition.

  19. Quality control of CarboEurope flux data - Part 1: Coupling footprint analyses with flux data quality assessment to evaluate sites in forest ecosystems

    DEFF Research Database (Denmark)

    Göckede, M.; Foken, T.; Aubinet, M.

    2008-01-01

    We applied a site evaluation approach combining Lagrangian Stochastic footprint modeling with a quality assessment approach for eddy-covariance data to 25 forested sites of the CarboEurope-IP network. The analysis addresses the spatial representativeness of the flux measurements, instrumental...... of the surrounding terrain, while the latent heat flux is subject to instrumentation-related problems. The Planar-Fit coordinate rotation proved to be a reliable tool for the majority of the sites using only a single set of rotation angles. Overall, we found a high average data quality for the CarboEurope-IP network...... effects on data quality, spatial patterns in the data quality, and the performance of the coordinate rotation method. Our findings demonstrate that application of a footprint filter could strengthen the CarboEurope-IP flux database, since only one third of the sites is situated in truly homogeneous...

  20. LBA-ECO CD-10 H2O Profiles at km 67 Tower Site, Tapajos National Forest

    Data.gov (United States)

    National Aeronautics and Space Administration — This data set contains a single text file which reports vertical profiles of H2O vapor concentrations measured at the Para Western (Santarem) - km 67, Primary Forest...

  1. LBA-ECO TG-07 Ground-based Biometry Data at km 83 Site, Tapajos National Forest: 1997

    Data.gov (United States)

    National Aeronautics and Space Administration — A field inventory of trees was conducted in March of 1997 in a logging concession at the Tapajos National Forest, south of Santarem, Para, Brazil. The inventory was...

  2. Mobility and natural attenuation of metals and arsenic in acidic waters of the drainage system of Timok River from Bor copper mines (Serbia) to Danube River.

    Science.gov (United States)

    Đorđievski, Stefan; Ishiyama, Daizo; Ogawa, Yasumasa; Stevanović, Zoran

    2018-06-22

    Bor, Krivelj, and Bela Rivers belong to the watershed of Timok River, which is a tributary of transboundary Danube River. These rivers receive metal-rich acidic wastewater from metallurgical facilities and acid mine drainage (AMD) from mine wastes around Bor copper mines. The aim of this study was to determine the mobility and natural attenuation of metals and arsenic in rivers from Bor copper mines to Danube River during the year 2015. The results showed that metallurgical facilities had the largest impact on Bor River by discharging about 400 t of Cu per year through highly acidic wastewater (pH = 2.6). The highest measured concentrations of Cu in river water and sediments were 40 mg L -1 and 1.6%, respectively. Dissolution of calcite from limestone bedrock and a high concentration of bicarbonate ions in natural river water (about 250 mg L -1 ) enhanced the neutralization of acidic river water and subsequent chemical precipitation of metals and arsenic. Decreases in the concentrations of Al, Fe, Cu, As, and Pb in river water were mainly due to precipitation on the river bed. On the other hand, dilution played an important role in the decreases in concentrations of Mn, Ni, Zn, and Cd. Chemically precipitated materials and flotation tailings containing Fe-rich minerals (fayalite, magnetite, and pyrite) were transported toward Danube River during the periods of high discharge. This study showed that processes of natural attenuation in catchments with limestone bedrock play an important role in reducing concentrations of metals and arsenic in AMD-bearing river water.

  3. Characterisation of Beaver Habitat Parameters That Promote the Use of Culverts as Dam Construction Sites: Can We Limit the Damage to Forest Roads?

    Directory of Open Access Journals (Sweden)

    Geneviève Tremblay

    2017-12-01

    Full Text Available The use of forest roads as foundations for dam construction by beavers is a recurrent problem in the management of forest road networks. In order to limit the damage to forest roads, our goal was to calculate the probability of beaver dam installation on culverts, according to surrounding habitat parameters, which could allow for improvement in the spatial design of new roads that minimise conflicts with beavers. Comparisons of culverts with (n = 77 and without (n = 51 dams in northwestern Quebec showed that catchment surface, cumulate length of all local streams within a 2-km radius, and road embankment height had a negative effect on the probability of dam construction on culverts, while flow level and culvert diameter ratio had a positive effect. Nevertheless, predicted probabilities of dam construction on culverts generally exceeded 50%, even on sites that were less favourable to beavers. We suggest that it would be more reasonable to take their probable subsequent presence into account at the earliest steps of road conception. Installing mitigation measures such as pre-dams during road construction would probably reduce the occurrence of conflicts with beavers and thus reduce the maintenance costs of forest roads.

  4. Reforestation Sites Show Similar and Nested AMF Communities to an Adjacent Pristine Forest in a Tropical Mountain Area of South Ecuador

    Science.gov (United States)

    Haug, Ingeborg; Setaro, Sabrina; Suárez, Juan Pablo

    2013-01-01

    Arbuscular mycorrhizae are important for growth and survival of tropical trees. We studied the community of arbuscular mycorrhizal fungi in a tropical mountain rain forest and in neighbouring reforestation plots in the area of Reserva Biológica San Francisco (South Ecuador). The arbuscular mycorrhizal fungi were analysed with molecular methods sequencing part of the 18 S rDNA. The sequences were classified as Operational Taxonomic Units (OTUs). We found high fungal species richness with OTUs belonging to Glomerales, Diversisporales and Archaeosporales. Despite intensive sampling, the rarefaction curves are still unsaturated for the pristine forest and the reforestation plots. The communities consisted of few frequent and many rare species. No specific interactions are recognizable. The plant individuals are associated with one to ten arbuscular mycorrhizal fungi and mostly with one to four. The fungal compositions associated with single plant individuals show a great variability and variety within one plant species. Planted and naturally occurring plants show high similarities in their fungal communities. Pristine forest and reforestation plots showed similar richness, similar diversity and a significantly nested structure of plant-AMF community. The results indicate that small-scale fragmentation presently found in this area has not destroyed the natural AMF community, at least yet. Thus, the regeneration potential of natural forest vegetation at the tested sites is not inhibited by a lack of appropriate mycobionts. PMID:23671682

  5. SHB1/HY1 Alleviates Excess Boron Stress by Increasing BOR4 Expression Level and Maintaining Boron Homeostasis in Arabidopsis Roots

    Directory of Open Access Journals (Sweden)

    Qiang Lv

    2017-05-01

    Full Text Available Boron is an essential mineral nutrient for higher plant growth and development. However, excessive amounts of boron can be toxic. Here, we report on the characterization of an Arabidopsis mutant, shb1 (sensitive to high-level of boron 1, which exhibits hypersensitivity to excessive boron in roots. Positional cloning demonstrated that the shb1 mutant bears a point mutation in a gene encoding a heme oxygenase 1 (HO1 corresponding to the HY1 gene involved in photomorphogenesis. The transcription level of the SHB1/HY1 gene in roots is up-regulated under excessive boron stimulation. Either overexpressing SHB1/HY1 or applying the HO1 inducer hematin reduces boron accumulation in roots and confers high boron tolerance. Furthermore, carbon monoxide and bilirubin, catalytic products of HO1, partially rescue the boron toxicity-induced inhibition of primary root growth in shb1. Additionally, the mRNA level of BOR4, a boron efflux transporter, is reduced in shb1 roots with high levels of boron supplementation, and hematin cannot relieve the boron toxicity-induced root inhibition in bor4 mutants. Taken together, our study reveals that HO1 acts via its catalytic by-products to promote tolerance of excessive boron by up-regulating the transcription of the BOR4 gene and therefore promoting the exclusion of excessive boron in root cells.

  6. A decade of monitoring at Swiss Long-Term Forest Ecosystem Research (LWF) sites: can we observe trends in atmospheric acid deposition and in soil solution acidity?

    Science.gov (United States)

    Pannatier, Elisabeth Graf; Thimonier, Anne; Schmitt, Maria; Walthert, Lorenz; Waldner, Peter

    2011-03-01

    Trends in atmospheric acid deposition and in soil solution acidity from 1995 or later until 2007 were investigated at several forest sites throughout Switzerland to assess the effects of air pollution abatements on deposition and the response of the soil solution chemistry. Deposition of the major elements was estimated from throughfall and bulk deposition measurements at nine sites of the Swiss Long-Term Forest Ecosystem Research network (LWF) since 1995 or later. Soil solution was measured at seven plots at four soil depths since 1998 or later. Trends in the molar ratio of base cations to aluminum (BC/Al) in soil solutions and in concentrations and fluxes of inorganic N (NO(3)-N + NH(4)-N), sulfate (SO(4)-S), and base cations (BC) were used to detect changes in soil solution chemistry. Acid deposition significantly decreased at three out of the nine study sites due to a decrease in total N deposition. Total SO(4)-S deposition decreased at the nine sites, but due to the relatively low amount of SO(4)-S load compared to N deposition, it did not contribute to decrease acid deposition significantly. No trend in total BC deposition was detected. In the soil solution, no trend in concentrations and fluxes of BC, SO(4)-S, and inorganic N were found at most soil depths at five out of the seven sites. This suggests that the soil solution reacted very little to the changes in atmospheric deposition. A stronger reduction in base cations compared to aluminum was detected at two sites, which might indicate that acidification of the soil solution was proceeding faster at these sites.

  7. Concentrations and content of mercury in bark, wood, and leaves in hardwoods and conifers in four forested sites in the northeastern USA.

    Science.gov (United States)

    Yang, Yang; Yanai, Ruth D; Driscoll, Charles T; Montesdeoca, Mario; Smith, Kevin T

    2018-01-01

    Mercury (Hg) is deposited from the atmosphere to remote areas such as forests, but the amount of Hg in trees is not well known. To determine the importance of Hg in trees, we analyzed foliage, bark and bole wood of eight tree species at four sites in the northeastern USA (Huntington Forest, NY; Sleepers River, VT; Hubbard Brook, NH; Bear Brook, ME). Foliar concentrations of Hg averaged 16.3 ng g-1 among the hardwood species, which was significantly lower than values in conifers, which averaged 28.6 ng g-1 (p < 0.001). Similarly, bark concentrations of Hg were lower (p < 0.001) in hardwoods (7.7 ng g-1) than conifers (22.5 ng g-1). For wood, concentrations of Hg were higher in yellow birch (2.1-2.8 ng g-1) and white pine (2.3 ng g-1) than in the other species, which averaged 1.4 ng g-1 (p < 0.0001). Sites differed significantly in Hg concentrations of foliage and bark (p = 0.02), which are directly exposed to the atmosphere, but the concentration of Hg in wood depended more on species (p < 0.001) than site (p = 0.60). The Hg contents of tree tissues in hardwood stands, estimated from modeled biomass and measured concentrations at each site, were higher in bark (mean of 0.10 g ha-1) and wood (0.16 g ha-1) than in foliage (0.06 g ha-1). In conifer stands, because foliar concentrations were higher, the foliar pool tended to be more important. Quantifying Hg in tree tissues is essential to understanding the pools and fluxes of Hg in forest ecosystems.

  8. Concentrations and content of mercury in bark, wood, and leaves in hardwoods and conifers in four forested sites in the northeastern USA

    Science.gov (United States)

    Yanai, Ruth D.; Driscoll, Charles T.; Montesdeoca, Mario; Smith, Kevin T.

    2018-01-01

    Mercury (Hg) is deposited from the atmosphere to remote areas such as forests, but the amount of Hg in trees is not well known. To determine the importance of Hg in trees, we analyzed foliage, bark and bole wood of eight tree species at four sites in the northeastern USA (Huntington Forest, NY; Sleepers River, VT; Hubbard Brook, NH; Bear Brook, ME). Foliar concentrations of Hg averaged 16.3 ng g-1 among the hardwood species, which was significantly lower than values in conifers, which averaged 28.6 ng g-1 (p < 0.001). Similarly, bark concentrations of Hg were lower (p < 0.001) in hardwoods (7.7 ng g-1) than conifers (22.5 ng g-1). For wood, concentrations of Hg were higher in yellow birch (2.1–2.8 ng g-1) and white pine (2.3 ng g-1) than in the other species, which averaged 1.4 ng g-1 (p < 0.0001). Sites differed significantly in Hg concentrations of foliage and bark (p = 0.02), which are directly exposed to the atmosphere, but the concentration of Hg in wood depended more on species (p < 0.001) than site (p = 0.60). The Hg contents of tree tissues in hardwood stands, estimated from modeled biomass and measured concentrations at each site, were higher in bark (mean of 0.10 g ha-1) and wood (0.16 g ha-1) than in foliage (0.06 g ha-1). In conifer stands, because foliar concentrations were higher, the foliar pool tended to be more important. Quantifying Hg in tree tissues is essential to understanding the pools and fluxes of Hg in forest ecosystems. PMID:29684081

  9. Soil surface CO2 efflux measurements in Norway spruce forests. Comparison between four different sites across Europe — from boreal to alpine forest

    Czech Academy of Sciences Publication Activity Database

    Acosta, Manuel; Pavelka, Marian; Montagnani, L.; Kutsch, W.; Lindroth, A.; Juszczak, R.; Janouš, Dalibor

    2013-01-01

    Roč. 192, JAN (2013), s. 295-303 ISSN 0016-7061 R&D Projects: GA MŠk OC08021; GA MŽP(CZ) SP/2D1/93/07; GA MŽP(CZ) SP/2D1/70/08; GA MŠk(CZ) ED1.1.00/02.0073 Institutional research plan: CEZ:AV0Z60870520 Keywords : Soil CO2 efflux * Forest * Chamber method * Q10 * Soil temperature * Spatial variability Subject RIV: EH - Ecology, Behaviour Impact factor: 2.509, year: 2013

  10. On the re-emergence of motion and innovations in the Gábor Bódy's intermedia experiments

    Directory of Open Access Journals (Sweden)

    Kamil Lipiński

    2015-06-01

    Full Text Available The article explores the main cases of Hungarian neo-avant-garde cinema in terms of re-emergence of visual material and the introduction of electronic innovations resulting in the transformation of reality. Among the research conducted in Béla Balázs Studio based on reframing the perception limits in the 1960s and the 1970s, the most innovative were Gábor Bódy's intermedia experiments. Along with launching K/3 subgroup within BBS, Bódy directed its objectives to reduce the material derived from reality and to visually intervene into media image electronically transforming the landscape of his films. Innovatively adapting the Sándor Weöres's verse, the film Narcissus and Psyche (1983 aimed at using hyper-real aesthetics to reframe the film reality. Starting from 1980, Bódy founded an international magazine Infermental to disseminate the advent of the video and electronics by creating a community drew on sharing news about emerging media image.

  11. Local and Regional Economic Benefits from Forest Products Production Activities at the Savannah River Site: 1955-Present

    International Nuclear Information System (INIS)

    Teeter, L.; Blake, J.I.

    2002-01-01

    SRS was established in 1951 as a nuclear materials production facility; however, decline in the defense mission budget at SRS has created a major economic impact on the community in the Central Savannah River Area. SRS has been offsetting these effects by producing revenue (80 million dollars to date) from the sale of forest products since 1955 primarily trees, but also pine straw. Revenue has been re-invested into the infrastructure development, restoration and management of natural resources. Total asset value of the forest-land has increased from 21 million to over 500 million dollars in the same period

  12. Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp.

    Directory of Open Access Journals (Sweden)

    Julia Bock

    2016-10-01

    Full Text Available Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp. (e-book; a shorter version is accessible at: http://zsido.com/konyvek/a-cservenkai-tomeggyilkossag/.

  13. Spectral contribution of understory to forest reflectance in a boreal site: an analysis of EO-1 Hyperion data

    Czech Academy of Sciences Publication Activity Database

    Rautianien, M.; Lukeš, Petr

    2015-01-01

    Roč. 171, dec (2015), s. 98-104 ISSN 0034-4257 R&D Projects: GA MŠk(CZ) LO1415 Institutional support: RVO:67179843 Keywords : forest reflectance model * hyperspectral * boreal * leaf area index * understory Subject RIV: EH - Ecology, Behaviour Impact factor: 5.881, year: 2015

  14. Overview of the Manitou Experimental Forest Observatory: Site description and selected science results from 2008 to 2013

    Science.gov (United States)

    J. Ortega; A. Turnipseed; A. B. Guenther; T. G. Karl; D. A. Day; D. Gochis; J. A. Huffman; A. J. Prenni; E. J. T. Levin; S. M. Kreidenweis; P. J. DeMott; Y. Tobo; E. G. Patton; A. Hodzic; Y. Y. Cui; P. C. Harley; R. S. Hornbrook; E. C. Apel; R. K. Monson; A. S. D. Eller; J. P. Greenberg; M. C. Barth; P. Campuzano-Jost; B. B. Palm; J. L. Jimenez; A. C. Aiken; M. K. Dubey; C. Geron; J. Offenberg; M. G. Ryan; P. J. Fornwalt; S. C. Pryor; F. N. Keutsch; J. P. DiGangi; A. W. H. Chan; A. H. Goldstein; G. M. Wolfe; S. Kim; L. Kaser; R. Schnitzhofer; A. Hansel; C. A. Cantrell; R. L. Mauldin; J. N. Smith

    2014-01-01

    The Bio-hydro-atmosphere interactions of Energy, Aerosols, Carbon, H2O, Organics and Nitrogen (BEACHON) project seeks to understand the feedbacks and interrelationships between hydrology, biogenic emissions, carbon assimilation, aerosol properties, clouds and associated feedbacks within water-limited ecosystems. The Manitou Experimental Forest Observatory (MEFO) was...

  15. Herpetofauna of the Camili Biosphere Rezerve Area (Borçka, Artvin, Turkey

    Directory of Open Access Journals (Sweden)

    Murat AFSAR

    2011-03-01

    Full Text Available In this study, 15 amphibian and reptile species were recorded from 12 different localities in the Camili Biosphere Reserve, known as the first biosphere site of Turkey. Two of these species are Urodelan, four are Anuran, four are Lacertilia and five are Ophidia. Two black coloured specimens belongs to Natrix genus collected from biosphere rezerv area are compered with literature data belongs to N. megalocephala. Moreover, the population and habitat status of threatened species were investigated, required conservation measures were explained.

  16. Cosmic-ray neutron transport at a forest field site: the sensitivity to various environmental conditions with focus on biomass and canopy interception

    Science.gov (United States)

    Andreasen, Mie; Jensen, Karsten H.; Desilets, Darin; Zreda, Marek; Bogena, Heye R.; Looms, Majken C.

    2017-04-01

    Cosmic-ray neutron intensity is inversely correlated to all hydrogen present in the upper decimeters of the subsurface and the first few hectometers of the atmosphere above the ground surface. This correlation forms the base of the cosmic-ray neutron soil moisture estimation method. The method is, however, complicated by the fact that several hydrogen pools other than soil moisture affect the neutron intensity. In order to improve the cosmic-ray neutron soil moisture estimation method and explore the potential for additional applications, knowledge about the environmental effect on cosmic-ray neutron intensity is essential (e.g., the effect of vegetation, litter layer and soil type). In this study the environmental effect is examined by performing a sensitivity analysis using neutron transport modeling. We use a neutron transport model with various representations of the forest and different parameters describing the subsurface to match measured height profiles and time series of thermal and epithermal neutron intensities at a field site in Denmark. Overall, modeled thermal and epithermal neutron intensities are in satisfactory agreement with measurements; however, the choice of forest canopy conceptualization is found to be significant. Modeling results show that the effect of canopy interception, soil chemistry and dry bulk density of litter and mineral soil on neutron intensity is small. On the other hand, the neutron intensity decreases significantly with added litter-layer thickness, especially for epithermal neutron energies. Forest biomass also has a significant influence on the neutron intensity height profiles at the examined field site, altering both the shape of the profiles and the ground-level thermal-to-epithermal neutron ratio. This ratio increases with increasing amounts of biomass, and was confirmed by measurements from three sites representing agricultural, heathland and forest land cover. A much smaller effect of canopy interception on the ground

  17. Conifer seedling recruitment across a gradient from forest to alpine tundra: effects of species, provenance, and site

    Science.gov (United States)

    Castanha, C.; Torn, M.S.; Germino, M.J.; Weibel, Bettina; Kueppers, L.M.

    2013-01-01

    Background: Seedling germination and survival is a critical control on forest ecosystem boundaries, such as at the alpine–treeline ecotone. In addition, while it is known that species respond individualistically to the same suite of environmental drivers, the potential additional effect of local adaptation on seedling success has not been evaluated. Aims: To determine whether local adaptation may influence the position and movement of forest ecosystem boundaries, we quantified conifer seedling recruitment in common gardens across a subalpine forest to alpine tundra gradient at Niwot Ridge, Colorado, USA. Methods: We studied Pinus flexilis and Picea engelmannii grown from seed collected locally at High (3400 m a.s.l.) and Low (3060 m a.s.l.) elevations. We monitored emergence and survival of seeds sown directly into plots and survival of seedlings germinated indoors and transplanted after snowmelt. Results: Emergence and survival through the first growing season was greater for P. flexilis than P. engelmannii and for Low compared with High provenances. Yet survival through the second growing season was similar for both species and provenances. Seedling emergence and survival tended to be greatest in the subalpine forest and lowest in the alpine tundra. Survival was greater for transplants than for field-germinated seedlings. Conclusions: These results suggest that survival through the first few weeks is critical to the establishment of natural germinants. In addition, even small distances between seed sources can have a significant effect on early demographic performance – a factor that has rarely been considered in previous studies of tree recruitment and species range shifts.

  18. Pengaruh Perbedaan Kelas Umur terhadap Produktivitas Getah Pinus merkusii Jungh et de Vriese Ras Lahan Jawa melalui Penyadapan Getah Metode Bor

    Directory of Open Access Journals (Sweden)

    Agus Sukarno

    2013-09-01

    Full Text Available Pinus merkusii Jungh et de Vriese merupakan tanaman asli Indonesia, yang sebaran alaminya di Aceh, Tapanuli dan Kerinci. Penyadapan getah dengan metode bor pada kelas umur yang berbeda belum pernah dilakukan. Tujuan penelitian untuk mengetahui perbedaan produksi getah pinus di antara  kelas umur. Penelitian dilakukan di RPH Oro-oro Ombo, BKPH Pujon, KPH Malang pada tanaman pinus kelas umur III, IV,  V  dan VI  dengan ketinggian tempat antara 1.100 m –1.250 m dari permukaan air laut.  Waktu penelitian bulan September sampai dengan Nopember 2010.  Jumlah pohon yang disadap di setiap kelas umur sebanyak 150 - 160 pohon dengan dua lubang per pohon.  Penyadapan getah menggunakan bor mesin, kantong plastik tahan minyak diikatkan pada ujung pipa untuk menampung getah.  Pemungutan getah dilakukan sehari setelah penyadapan. Analisis  data  menggunakan  one way anova, apabila terdapat perbedaan yang nyata,  dilakukan uji lanjut dengan orthogonal polynomial. Produksi getah di antara kelas umur, menunjukkan perbedaan yang nyata. Produksi getah kelas umur III (36,5 g/ 2 lubang/1 hari meningkat pada kelas umur IV (62,9 g/2 lubang/1 hari dan menurun pada kelas umur V  (24,61 g/2 lubang/1 hari.  Produksi getah pada kelas umur VI (38,3 g/ 2 lubang/1 hari hampir sama dengan kelas umur III. Hasil uji lanjut orthogonal polynomial  menunjukkan respons  bersifat kuadratik (p=0,09 antara produksi getah dengan kelas umur. Kata Kunci: Pinus, kelas umur, getah, metode bor

  19. Modeling dynamics of "1"3"7Cs in forest surface environments: Application to a contaminated forest site near Fukushima and assessment of potential impacts of soil organic matter interactions

    International Nuclear Information System (INIS)

    Ota, Masakazu; Nagai, Haruyasu; Koarashi, Jun

    2016-01-01

    A process-based model for "1"3"7Cs transfer in forest surface environments was developed to assess the dynamic behavior of Fukushima-derived "1"3"7Cs in a Japanese forest. The model simulation successfully reproduced the observed data from 3 year migration of "1"3"7Cs in the organic and mineral soil layers at a contaminated forest near Fukushima. The migration of "1"3"7Cs from the organic layer to the mineral soil was explained by the direct deposition pattern on the forest floor and the turnover of litter materials in the organic layer under certain ecological conditions. Long-term predictions indicated that more than 90% of the deposited "1"3"7Cs would remain within the top 5 cm of the soil for up to 30 years after the accident, suggesting that the forest acts as an effective long-term reservoir of "1"3"7Cs with limited transfer via the groundwater pathway. The model was also used to explore the potential impacts of soil organic matter (SOM) interactions on the mobility and bioavailability of "1"3"7Cs in the soil–plant system. The simulation results for hypothetical organic soils with modified parameters of "1"3"7Cs turnover revealed that the SOM-induced reduction of "1"3"7Cs adsorption elevates the fraction of dissolved "1"3"7Cs in the soil solution, thereby increasing the soil-to-plant transfer of "1"3"7Cs without substantially altering the fractional distribution of "1"3"7Cs in the soil. Slower fixation of "1"3"7Cs on the flayed edge site of clay minerals and enhanced mobilization of the clay-fixed "1"3"7Cs in organic-rich soils also appeared to elevate the soil-to-plant transfer of "1"3"7Cs by increasing the fraction of the soil-adsorbed (exchangeable) "1"3"7Cs. A substantial proportion (approximate 30%–60%) of "1"3"7Cs in these organic-rich soils was transferred to layers deeper than 5 cm decades later. These results suggested that SOM influences the behavior of "1"3"7Cs in forests over a prolonged period through alterations of adsorption and fixation in

  20. Sustainability of High Intensity Forest Management with Respect to Water QuaIity and Site Nutrient Reserves

    Science.gov (United States)

    Virginia R. Tolbert; Carl C. Trettin; Dale W. Johnson; John W. Parsons; Allan E. Houston; David A. Mays

    2001-01-01

    Ensuring sustainability of intensively managed woody crops requires determining soil and water quality effects using a combination of field data and modeling projections. Plot- and catchrnent-scale research, models, and meta-analyses are addressing nutrient availability, site quality, and measures to increase short-rotation woody crop (SRWC) productivity and site...

  1. Estimation of land-surface evaporation at four forest sites across Japan with the new nonlinear complementary method

    DEFF Research Database (Denmark)

    Ai, Zhipin; Wang, Qinxue; Yang, Yonghui

    2017-01-01

    Evaporation from land surfaces is a critical component of the Earth water cycle and of water management strategies. The complementary method originally proposed by Bouchet, which describes a linear relation between actual evaporation (E), potential evaporation (Epo) and apparent potential...... evaporation (Epa) based on routinely measured weather data, is one of the various methods for evaporation calculation. This study evaluated the reformulated version of the original method, as proposed by Brutsaert, for forest land cover in Japan. The new complementary method is nonlinear and based on boundary...

  2. Evaluating the Community Land Model (CLM4.5) at a coniferous forest site in northwestern United States using flux and carbon-isotope measurements

    Science.gov (United States)

    Duarte, Henrique F.; Raczka, Brett M.; Ricciuto, Daniel M.; Lin, John C.; Koven, Charles D.; Thornton, Peter E.; Bowling, David R.; Lai, Chun-Ta; Bible, Kenneth J.; Ehleringer, James R.

    2017-09-01

    Droughts in the western United States are expected to intensify with climate change. Thus, an adequate representation of ecosystem response to water stress in land models is critical for predicting carbon dynamics. The goal of this study was to evaluate the performance of the Community Land Model (CLM) version 4.5 against observations at an old-growth coniferous forest site in the Pacific Northwest region of the United States (Wind River AmeriFlux site), characterized by a Mediterranean climate that subjects trees to water stress each summer. CLM was driven by site-observed meteorology and calibrated primarily using parameter values observed at the site or at similar stands in the region. Key model adjustments included parameters controlling specific leaf area and stomatal conductance. Default values of these parameters led to significant underestimation of gross primary production, overestimation of evapotranspiration, and consequently overestimation of photosynthetic 13C discrimination, reflected in reduced 13C : 12C ratios of carbon fluxes and pools. Adjustments in soil hydraulic parameters within CLM were also critical, preventing significant underestimation of soil water content and unrealistic soil moisture stress during summer. After calibration, CLM was able to simulate energy and carbon fluxes, leaf area index, biomass stocks, and carbon isotope ratios of carbon fluxes and pools in reasonable agreement with site observations. Overall, the calibrated CLM was able to simulate the observed response of canopy conductance to atmospheric vapor pressure deficit (VPD) and soil water content, reasonably capturing the impact of water stress on ecosystem functioning. Both simulations and observations indicate that stomatal response from water stress at Wind River was primarily driven by VPD and not soil moisture. The calibration of the Ball-Berry stomatal conductance slope (mbb) at Wind River aligned with findings from recent CLM experiments at sites characterized by

  3. Evaluating the Community Land Model (CLM4.5 at a coniferous forest site in northwestern United States using flux and carbon-isotope measurements

    Directory of Open Access Journals (Sweden)

    H. F. Duarte

    2017-09-01

    Full Text Available Droughts in the western United States are expected to intensify with climate change. Thus, an adequate representation of ecosystem response to water stress in land models is critical for predicting carbon dynamics. The goal of this study was to evaluate the performance of the Community Land Model (CLM version 4.5 against observations at an old-growth coniferous forest site in the Pacific Northwest region of the United States (Wind River AmeriFlux site, characterized by a Mediterranean climate that subjects trees to water stress each summer. CLM was driven by site-observed meteorology and calibrated primarily using parameter values observed at the site or at similar stands in the region. Key model adjustments included parameters controlling specific leaf area and stomatal conductance. Default values of these parameters led to significant underestimation of gross primary production, overestimation of evapotranspiration, and consequently overestimation of photosynthetic 13C discrimination, reflected in reduced 13C : 12C ratios of carbon fluxes and pools. Adjustments in soil hydraulic parameters within CLM were also critical, preventing significant underestimation of soil water content and unrealistic soil moisture stress during summer. After calibration, CLM was able to simulate energy and carbon fluxes, leaf area index, biomass stocks, and carbon isotope ratios of carbon fluxes and pools in reasonable agreement with site observations. Overall, the calibrated CLM was able to simulate the observed response of canopy conductance to atmospheric vapor pressure deficit (VPD and soil water content, reasonably capturing the impact of water stress on ecosystem functioning. Both simulations and observations indicate that stomatal response from water stress at Wind River was primarily driven by VPD and not soil moisture. The calibration of the Ball–Berry stomatal conductance slope (mbb at Wind River aligned with findings from recent CLM experiments at

  4. Environmental analysis of a formerly utilized MED/AEC site: Site A and plot M, Palos Forest Preserve, Palos Park, Illinois

    Energy Technology Data Exchange (ETDEWEB)

    1979-09-01

    This environmental analysis report describes the existing site environment and evaluates the environmental impacts of 8 options for remedial action, including allowing buried waste to remain undisturbed. Conformity or conflict with governmental statutes, regulations and standards was determined, especially with regard to compliance with contamination criteria and guidelines. The program of measurements, documentation, and control to demonstrate compliance with these criteria and guidelines was identified.

  5. Environmental analysis of a formerly utilized MED/AEC site: Site A and plot M, Palos Forest Preserve, Palos Park, Illinois

    International Nuclear Information System (INIS)

    1979-09-01

    This environmental analysis report describes the existing site environment and evaluates the environmental impacts of 8 options for remedial action, including allowing buried waste to remain undisturbed. Conformity or conflict with governmental statutes, regulations and standards was determined, especially with regard to compliance with contamination criteria and guidelines. The program of measurements, documentation, and control to demonstrate compliance with these criteria and guidelines was identified

  6. Estimation of land-surface evaporation at four forest sites across Japan with the new nonlinear complementary method.

    Science.gov (United States)

    Ai, Zhipin; Wang, Qinxue; Yang, Yonghui; Manevski, Kiril; Zhao, Xin; Eer, Deni

    2017-12-19

    Evaporation from land surfaces is a critical component of the Earth water cycle and of water management strategies. The complementary method originally proposed by Bouchet, which describes a linear relation between actual evaporation (E), potential evaporation (E po ) and apparent potential evaporation (E pa ) based on routinely measured weather data, is one of the various methods for evaporation calculation. This study evaluated the reformulated version of the original method, as proposed by Brutsaert, for forest land cover in Japan. The new complementary method is nonlinear and based on boundary conditions with strictly physical considerations. The only unknown parameter (α e ) was for the first time determined for various forest covers located from north to south across Japan. The values of α e ranged from 0.94 to 1.10, with a mean value of 1.01. Furthermore, the calculated evaporation with the new method showed a good fit with the eddy-covariance measured values, with a determination coefficient of 0.78 and a mean bias of 4%. Evaluation results revealed that the new nonlinear complementary relation performs better than the original linear relation in describing the relationship between E/E pa and E po /E pa , and also in depicting the asymmetry variation between E pa /E po and E/E po .

  7. CTFS-ForestGEO: a worldwide network monitoring forests in an era of global change

    Science.gov (United States)

    Kristina J. Anderson-Teixeira; Stuart J. Davies; Amy C. Bennett; Erika B. Gonzalez-Akre; Helene C. Muller-Landau; S. Joseph Wright; Kamariah Abu Salim; Angélica M. Almeyda Zambrano; Alfonso Alonso; Jennifer L. Baltzer; Yves Basset; Norman A. Bourg; Eben N. Broadbent; Warren Y. Brockelman; Sarayudh Bunyavejchewin; David F. R. P. Burslem; Nathalie Butt; Min Cao; Dairon Cardenas; George B. Chuyong; Keith Clay; Susan Cordell; Handanakere S. Dattaraja; Xiaobao Deng; Matteo Detto; Xiaojun Du; Alvaro Duque; David L. Erikson; Corneille E.N. Ewango; Gunter A. Fischer; Christine Fletcher; Robin B. Foster; Christian P. Giardina; Gregory S. Gilbert; Nimal Gunatilleke; Savitri Gunatilleke; Zhanqing Hao; William W. Hargrove; Terese B. Hart; Billy C.H. Hau; Fangliang He; Forrest M. Hoffman; Robert W. Howe; Stephen P. Hubbell; Faith M. Inman-Narahari; Patrick A. Jansen; Mingxi Jiang; Daniel J. Johnson; Mamoru Kanzaki; Abdul Rahman Kassim; David Kenfack; Staline Kibet; Margaret F. Kinnaird; Lisa Korte; Kamil Kral; Jitendra Kumar; Andrew J. Larson; Yide Li; Xiankun Li; Shirong Liu; Shawn K.Y. Lum; James A. Lutz; Keping Ma; Damian M. Maddalena; Jean-Remy Makana; Yadvinder Malhi; Toby Marthews; Rafizah Mat Serudin; Sean M. McMahon; William J. McShea; Hervé R. Memiaghe; Xiangcheng Mi; Takashi Mizuno; Michael Morecroft; Jonathan A. Myers; Vojtech Novotny; Alexandre A. de Oliveira; Perry S. Ong; David A. Orwig; Rebecca Ostertag; Jan den Ouden; Geoffrey G. Parker; Richard P. Phillips; Lawren Sack; Moses N. Sainge; Weiguo Sang; Kriangsak Sri-ngernyuang; Raman Sukumar; I-Fang Sun; Witchaphart Sungpalee; Hebbalalu Sathyanarayana Suresh; Sylvester Tan; Sean C. Thomas; Duncan W. Thomas; Jill Thompson; Benjamin L. Turner; Maria Uriarte; Renato Valencia; Marta I. Vallejo; Alberto Vicentini; Tomáš Vrška; Xihua Wang; Xugao Wang; George Weiblen; Amy Wolf; Han Xu; Sandra Yap; Jess Zimmerman

    2014-01-01

    Global change is impacting forests worldwide, threatening biodiversity and ecosystem services including climate regulation. Understanding how forests respond is critical to forest conservation and climate protection. This review describes an international network of 59 long-term forest dynamics research sites (CTFS-ForestGEO) useful for characterizing forest responses...

  8. Plug-welding of ODS cladding tube for BOR-60 irradiation. Welding condition setting. Device remodeling and welding

    International Nuclear Information System (INIS)

    Seki, Masayuki; Ishibashi, Fujio; Kono, Syusaku; Hirako, Kazuhito; Tsukada, Tatsuya

    2003-04-01

    Irradiation test in BOR-60 at RIAR to judge practical use prospect of ODS cladding tube at early stage is planned as Japan-Russia a joint research. RIAR does fuel design of fuel pin used for this joint research. JNC manufactures ODS cladding tube and bar materials (two steel kind of martensite and ferrite), upper endplug production. They are welded by pressurized resistance welding, and are inspected in JNC Tokai, transported to RIAR. And RIAR manufactures vibration packing fuel pin. On the upper endplug welding by pressurized resistance welding method, we worded on the problems such as decision of welding condition by changing the size and crystallization of cladding tube and the design of endplug, and the chucking device remodeling to correspond to the long scale cladding tube welding system (included handling) and of quality assurance method. Especially, use of long scale cladding tube caused problem that bending transformation occurred in cladding tube by welding pressure. However, we solved this problem by shortening the distance of cladding tube colette chuck and pressure receiving, and by putting the sleeve in an internal space of welding machine, losing the bending of cladding tube. Moreover, welding defects were occurred by the difference of an inside state, an inside defect and recrystallization of cladding tube. We solved the problem by inside grinding for the edge of tube, angle beam method by ultrasonic wave, and ultrasonic wave form confirmation. Manufacturing process with long scale cladding tube including heat-treatment to remove combustion return and remaining stress was established besides, Afterwards, welding of ODS cladding tube and upper endplug. As the quality assurance system, we constructed [Documented procedure (referred to JOYO)] based on [Document of the QA plan] by OEC. Welding and inspection were executed by the document procedure. It is thought that the quality assurance method become references for the irradiation test in JOYO in the

  9. Model-experiment synthesis at two FACE sites in the southeastern US. Forest ecosystem responses to elevated CO[2]. (Invited)

    Science.gov (United States)

    Walker, A. P.; Zaehle, S.; De Kauwe, M. G.; Medlyn, B. E.; Dietze, M.; Hickler, T.; Iversen, C. M.; Jain, A. K.; Luo, Y.; McCarthy, H. R.; Parton, W. J.; Prentice, C.; Thornton, P. E.; Wang, S.; Wang, Y.; Warlind, D.; Warren, J.; Weng, E.; Hanson, P. J.; Oren, R.; Norby, R. J.

    2013-12-01

    Ecosystem observations from two long-term Free-Air CO[2] Enrichment (FACE) experiments (Duke forest and Oak Ridge forest) were used to evaluate the assumptions of 11 terrestrial ecosystem models and the consequences of those assumptions for the responses of ecosystem water, carbon (C) and nitrogen (N) fluxes to elevated CO[2] (eCO[2]). Nitrogen dynamics were the main constraint on simulated productivity responses to eCO[2]. At Oak Ridge some models reproduced the declining response of C and N fluxes, while at Duke none of the models were able to maintain the observed sustained responses. C and N cycles are coupled through a number of complex interactions, which causes uncertainty in model simulations in multiple ways. Nonetheless, the major difference between models and experiments was a larger than observed increase in N-use efficiency and lower than observed response of N uptake. The results indicate that at Duke there were mechanisms by which trees accessed additional N in response to eCO[2] that were not represented in the ecosystem models, and which did not operate with the same efficiency at Oak Ridge. Sequestration of the additional productivity under eCO[2] into forest biomass depended largely on C allocation. Allocation assumptions were classified into three main categories--fixed partitioning coefficients, functional relationships and a partial (leaf allocation only) optimisation. The assumption which best constrained model results was a functional relationship between leaf area and sapwood area (pipe-model) and increased root allocation when nitrogen or water were limiting. Both, productivity and allocation responses to eCO[2] determined the ecosystem-level response of LAI, which together with the response of stomatal conductance (and hence water-use efficiency; WUE) determined the ecosystem response of transpiration. Differences in the WUE response across models were related to the representation of the relationship of stomatal conductance to CO[2] and

  10. Tree species diversity in a seasonally-dry forest: the case of the Pinkaití site, in the Kayapó Indigenous Area, Southeastern limits of the Amazon

    OpenAIRE

    Salm,Rodolfo

    2004-01-01

    This study investigates patterns of forest structure and tree species diversity in an anthropogenic palm grove and undisturbed areas at the seasonally-dry Pinkaití research station, in the Kayapó Indigenous Area. This site, managed by the Conservation International do Brasil, is the most southeastern site floristically surveyed in the Amazon until now. The secondary and a nearby undisturbed forest were sampled in a group of 52 floristic plots of 0.0625-ha (25x25-m) where all trees with DBH > ...

  11. Soil type affects migration pattern of airborne Pb and Cd under a spruce-beech forest of the UN-ECE integrated monitoring site Zoebelboden, Austria

    Energy Technology Data Exchange (ETDEWEB)

    Kobler, Johannes, E-mail: johannes.kobler@umweltbundesamt.a [Umweltbundesamt, Spittelauer Laende 5, 1090 Vienna (Austria); Fitz, Walter J.; Dirnboeck, Thomas; Mirtl, Michael [Umweltbundesamt, Spittelauer Laende 5, 1090 Vienna (Austria)

    2010-03-15

    Anthropogenic trace element emissions have declined. However, top soils all over the world remain enriched in trace elements. We investigated Pb and Cd migration in forest soils of a remote monitoring site in the Austrian limestone Alps between 1992 and 2004. Large spatial variability masked temporal changes in the mineral soil of Lithic Leptosols (Skeltic), whereas a significant reduction of Pb concentrations in their forest floors occurred. Reductions of concentrations in the less heterogeneous Cambisols (Chromic) were significant. In contrast, virtually no migration of Pb and Cd were found in Stagnosols due to their impeded drainage. Very low element concentrations (<1 mug l{sup -1}) in field-collected soil solutions using tension lysimeters (0.2 mum nylon filters) imply that migration largely occurred by preferential flow as particulate-bound species during intensive rainfall events. Our results indicate that the extent of Pb and Cd migration in soils is largely influenced by soil type. - Comparison between soil solid phase and soil solution concentrations imply that trace element migration largely occurred by preferential flow as particulate-bound species.

  12. Analysis of copper losses throughout weak acid effluent flows generated during off-gas treatment in the New Copper Smelter RTB Bor

    Directory of Open Access Journals (Sweden)

    Dragana Ivšić-Bajčeta

    2013-09-01

    Full Text Available The previous inadequate treatment of off-gas in RTB Bor in Serbia has resulted in serious pollution of the environment and the possibly high losses of copper through the effluent flows. The project of New Copper Smelter RTB Bor, besides the new flash smelting furnace (FSF and the reconstruction of Pierce-Smith converter (PSC, includes more effective effluent treatment. Paper presents an analysis of the new FSF and PSC off-gas treatment, determination of copper losses throughout generated wastewaters and discussion of its possible valorization. Assumptions about the solubility of metals phases present in the FSF and PSC off-gas, obtained by the treatment process simulation, were compared with the leaching results of flue dusts. Determined wastewaters characteristics indicate that the PSC flow is significantly richer in copper, mostly present in insoluble metallic/sulfide form, while the FSF flow has low concentration of copper in the form of completely soluble oxide/sulfate. The possible scenario for the copper valorization, considering arsenic and lead as limiting factors, is the separation of the FSF and PSC flows, return of the metallic/sulfide solid phase to the smelting process and recovery from the sulfate/oxide liquid phase.

  13. Occurrence of Phytophthora plurivora and other Phytophthora species in oak forests of southern Poland and their association with site conditions and the health status of trees.

    Science.gov (United States)

    Jankowiak, R; Stępniewska, H; Bilański, P; Kolařík, M

    2014-11-01

    Phytophthora plurivora and other Phytophthora species are known to be serious pathogens of forest trees. Little is known, however, about the presence of P. plurivora in Polish oak forests and their role in oak decline. The aims of this study were to identify P. plurivora in healthy and declining Quercus robur stands in southern Poland and to demonstrate the relationship between different site factors and the occurrence of P. plurivora. In addition, the virulence of P. plurivora and other Phytophthora species was evaluated through inoculations using 2-year-old oak seedlings. Rhizosphere soil was investigated from 39 oak stands representing different healthy tree statuses. The morphology and DNA sequences of the internal transcribed spacer regions (ITS) of the ribosomal DNA and the mitochondrial cox1 gene were used for identifications. P. plurivora, an oak fine root pathogen, was isolated from rhizosphere soil samples in 6 out of 39 stands. Additionally, Phytophthora cambivora, Phytophthora polonica and Phytophthora rosacearum-like were also obtained from several stands. The results showed a significant association between the presence of P. plurivora and the health status of oak trees. Similar relationships were also observed for all identified Phytophthora species. In addition, there was evidence for a connection between the presence of all identified Phytophthora species and some site conditions. Phytophthora spp. occurred more frequently in declining stands and in silt loam and sandy loam soils with pH ≥ 3.66. P. plurivora and P. cambivora were the only species capable of killing whole plants, producing extensive necrosis on seedling stems.

  14. Estimation of soil respiration using automated chamber systems in an oak (Quercus mongolica) forest at the Nam-San site in Seoul, Korea.

    Science.gov (United States)

    Joo, Seung Jin; Park, Soon-Ung; Park, Moon-Soo; Lee, Chang Seok

    2012-02-01

    Soil respiration (R(soil)) is the largest component of ecosystem respiration produced by the autotrophic and heterotrophic respirations. Its variability on multiple time scales strongly depends on environmental variables such as temperature and moisture. To investigate the temporal variations of R(soil) in a cool-temperate oak (Quercus mongolica) forest at the Nam-San site in Seoul, Korea, continuous measurements of R(soil) using the automated chamber systems, air and soil temperatures and soil moisture are made for the period from April 2010 to March 2011. The observed data indicate that the R(soil) shows a remarkable seasonal variation in accordance with temperatures with high in summer and low in winter. The R(soil) is found to be strongly correlated with soil temperature (T(s)) at the 5cm depth throughout the year. However, the high fluctuation of R(soil) is found to be related with soil moisture content (M(s)) during the forest growing season. The estimated annual Q(10) value using the 1.5m-high air temperature is found to be 2.4 that is comparable with other studies in temperate forest ecosystems. The optimal regression equation of R(soil) with the T(s) at 5cm depth and the M(s) at 15cm depth is found to be R(soil)=124.3 exp (0.097T(s))-55.3 (M(s))(2)+2931.9 (M(s))-38516 for T(s)≥0°C and R(soil)=0 for T(s)soil). The annual total soil respiration estimated by the optimal regression equation is found to be 1264gCm(-2) with a maximum of 685gCm(-2) in the summer season and a minimum of 33gCm(-2) in the winter season. The present study can be implemented for the determination of the carbon balance of a cool-temperate Q. mongolica forest with the provision of photosynthesis. Copyright © 2011 Elsevier B.V. All rights reserved.

  15. Contrasting winter and summer VOC mixing ratios at a forest site in the Western Mediterranean Basin: the effect of local biogenic emissions

    Directory of Open Access Journals (Sweden)

    R. Seco

    2011-12-01

    Full Text Available Atmospheric volatile organic compounds (VOCs are involved in ozone and aerosol generation, thus having implications for air quality and climate. VOCs and their emissions by vegetation also have important ecological roles as they can protect plants from stresses and act as communication cues between plants and between plants and animals. In spite of these key environmental and biological roles, the reports on seasonal and daily VOC mixing ratios in the literature for Mediterranean natural environments are scarce.

    We conducted seasonal (winter and summer measurements of VOC mixing ratios in an elevated (720 m a.s.l. holm oak Mediterranean forest site near the metropolitan area of Barcelona (NE Iberian Peninsula. Methanol was the most abundant compound among all the VOCs measured in both seasons. While aromatic VOCs showed almost no seasonal variability, short-chain oxygenated VOCs presented higher mixing ratios in summer, presumably due to greater emission by vegetation and increased photochemistry, both enhanced by the high temperatures and solar radiation in summer. Isoprenoid VOCs showed the biggest seasonal change in mixing ratios: they increased by one order of magnitude in summer, as a result of the vegetation's greater physiological activity and emission rates. The maximum diurnal concentrations of ozone increased in summer too, most likely due to more intense photochemical activity and the higher levels of VOCs in the air.

    The daily variation of VOC mixing ratios was mainly governed by the wind regime of the mountain, as the majority of the VOC species analyzed followed a very similar diel cycle. Mountain and sea breezes that develop after sunrise advect polluted air masses to the mountain. These polluted air masses had previously passed over the urban and industrial areas surrounding the Barcelona metropolitan area, where they were enriched in NOx and in VOCs of biotic and abiotic origin. Moreover, these

  16. Contrasting winter and summer VOC mixing ratios at a forest site in the Western Mediterranean Basin: the effect of local biogenic emissions

    Science.gov (United States)

    Seco, R.; Peñuelas, J.; Filella, I.; Llusià, J.; Molowny-Horas, R.; Schallhart, S.; Metzger, A.; Müller, M.; Hansel, A.

    2011-12-01

    Atmospheric volatile organic compounds (VOCs) are involved in ozone and aerosol generation, thus having implications for air quality and climate. VOCs and their emissions by vegetation also have important ecological roles as they can protect plants from stresses and act as communication cues between plants and between plants and animals. In spite of these key environmental and biological roles, the reports on seasonal and daily VOC mixing ratios in the literature for Mediterranean natural environments are scarce. We conducted seasonal (winter and summer) measurements of VOC mixing ratios in an elevated (720 m a.s.l.) holm oak Mediterranean forest site near the metropolitan area of Barcelona (NE Iberian Peninsula). Methanol was the most abundant compound among all the VOCs measured in both seasons. While aromatic VOCs showed almost no seasonal variability, short-chain oxygenated VOCs presented higher mixing ratios in summer, presumably due to greater emission by vegetation and increased photochemistry, both enhanced by the high temperatures and solar radiation in summer. Isoprenoid VOCs showed the biggest seasonal change in mixing ratios: they increased by one order of magnitude in summer, as a result of the vegetation's greater physiological activity and emission rates. The maximum diurnal concentrations of ozone increased in summer too, most likely due to more intense photochemical activity and the higher levels of VOCs in the air. The daily variation of VOC mixing ratios was mainly governed by the wind regime of the mountain, as the majority of the VOC species analyzed followed a very similar diel cycle. Mountain and sea breezes that develop after sunrise advect polluted air masses to the mountain. These polluted air masses had previously passed over the urban and industrial areas surrounding the Barcelona metropolitan area, where they were enriched in NOx and in VOCs of biotic and abiotic origin. Moreover, these polluted air masses receive additional biogenic

  17. Tritium in a deciduous forest adjacent to a commercial shallow land burial site: implications for monitoring to detect radionuclide migration

    International Nuclear Information System (INIS)

    Rickard, W.H.; Kirby, L.J.

    1983-09-01

    Tritium as tritiated water was measured in the sap taken from the trunks of 26 maple trees growing in the vicinity of the shallow-land, low-level radioactive waste disposal site at Maxey Flats, Kentucky. Tritium values ranged between 10,000 and 290,000 pCi/l with the highest levels measured in sap from trees growing downslope from the burial site's western boundary. Levels of tritium of less than 1000 pCi/l were measured at a distance of 20 kilometers from the site: The source of elevated tritium levels in the vicinity of the disposal site is the evaporator facility which has released tritiated water vapor into the air more or less continuously for 10 years. Another possible source of at least some of the tritium is subterranean leakage from the trenches located near the western boundary. The evaporator facility has been shut down since December 1982. With the shutdown of the evaporator the levels of tritium in tree sap in future years is expected to show a marked decline as the tritiated soil water in the root zone becomes increasingly diluted with fresh rainwater and the residual tritium is dissipated to the air by evaporation and plant transpiration processes. 11 references

  18. The Social and Environmental Impacts of Biofuel Feedstock Cultivation: Evidence from Multi-Site Research in the Forest Frontier

    Directory of Open Access Journals (Sweden)

    Laura German

    2011-09-01

    Full Text Available Preoccupation with global energy supplies and climate change in the global North, and a desire to improve the balance of trade and capture value in the emerging carbon market by developing countries, together place biofuels firmly on the map of global land use change. Much of this recent land use change is occurring in developing countries where large agro-ecologically suitable tracts of land may be accessed at lower economic and opportunity cost. This is leading to the gradual penetration of commercial crops that provide suitable biofuel feedstocks (e.g., sugarcane, soybean, oil palm, jatropha into rural communities and forested landscapes throughout many areas of the global South. Expansion of biofuel feedstock cultivation in developing countries is widely embraced by producer country governments as a means to achieve energy security and stimulate rural economic development through employment and smallholder market integration. It is also expected that foreign and domestic investments in biofuel feedstock cultivation will lead to positive economic spillovers from knowledge transfer and investor contributions to social and physical infrastructure. While biofuel feedstocks are expanding through large industrial-scale plantations and smallholder production alike, the expansion of industrial-scale production systems has been countered by a critical response by civil society actors concerned about the implications for rural livelihoods, customary land rights, and the environmental effects of biofuel feedstock cultivation. To date, however, limited data exist to demonstrate the conditions under which widely anticipated economic and climate change mitigation benefits accrue in practice, and the implications of these developments for forests, local livelihoods, and the climate change mitigation potential of biofuels. In such a situation, debates are easily polarized into those for and against biofuels. This special issue seeks to nuance this debate by

  19. pSuc-Lys: Predict lysine succinylation sites in proteins with PseAAC and ensemble random forest approach.

    Science.gov (United States)

    Jia, Jianhua; Liu, Zi; Xiao, Xuan; Liu, Bingxiang; Chou, Kuo-Chen

    2016-04-07

    Being one type of post-translational modifications (PTMs), protein lysine succinylation is important in regulating varieties of biological processes. It is also involved with some diseases, however. Consequently, from the angles of both basic research and drug development, we are facing a challenging problem: for an uncharacterized protein sequence having many Lys residues therein, which ones can be succinylated, and which ones cannot? To address this problem, we have developed a predictor called pSuc-Lys through (1) incorporating the sequence-coupled information into the general pseudo amino acid composition, (2) balancing out skewed training dataset by random sampling, and (3) constructing an ensemble predictor by fusing a series of individual random forest classifiers. Rigorous cross-validations indicated that it remarkably outperformed the existing methods. A user-friendly web-server for pSuc-Lys has been established at http://www.jci-bioinfo.cn/pSuc-Lys, by which users can easily obtain their desired results without the need to go through the complicated mathematical equations involved. It has not escaped our notice that the formulation and approach presented here can also be used to analyze many other problems in computational proteomics. Copyright © 2016 Elsevier Ltd. All rights reserved.

  20. Proceedings, 15th central hardwood forest conference

    Science.gov (United States)

    David S. Buckley; Wayne K. Clatterbuck; [Editors

    2007-01-01

    Proceedings of the 15th central hardwood forest conference held February 27–March 1, 2006, in Knoxville, TN. Includes 86 papers and 30 posters pertaining to forest health and protection, ecology and forest dynamics, natural and artificial regeneration, forest products, wildlife, site classification, management and forest resources, mensuration and models, soil and...

  1. The importance of odor in nest site selection by a lodger bee, Centris Bicornuta Mocsáry (Hymenoptera: Apidae) in the dry forest of Costa Rica.

    Science.gov (United States)

    Vinson, S B; Frankie, G W; Rao, A

    2011-01-01

    The more common lodger bee occurring in the dry forest of Costa Rica, Centris bicornuta Muscáry), has been observed nesting in new nest cavities drilled into wooden blocks placed next to cavities used by another female within 2-3 days. In contrast, new nest cavities placed in similar areas with no nesting Centris nearby were not used for weeks. These observations suggest that the presence of nesting bees may play a role in nest site selection. To confirm our observations, new nest cavities were placed in areas with or without nesting. We found nest initiation in newly placed nest cavities only in areas where bees were actively nesting. To examine the possibility that nesting locations are not unique, we placed new nest cavities in new locations either with (a) a number of completed nest cavities or (b) placed alone. Within three days we only found bees nesting in the newly placed nest cavities in situation "a". The results suggested that odor might be involved. We next compared nesting in new cavities placed alone with cavities contaminated with either (a) nest entrance plug material, (b) nest nectar, (c) nest pollen or (d) a combination of pollen and nectar. Nesting was significantly low in cavities placed next to cavities with nest entrance plug material (a), and high in cavities placed next to cavities "b, c, or d". The results suggest that pollen and /or nectar odor play a role in the location of potential nest sites.

  2. An integrative computational framework based on a two-step random forest algorithm improves prediction of zinc-binding sites in proteins.

    Directory of Open Access Journals (Sweden)

    Cheng Zheng

    Full Text Available Zinc-binding proteins are the most abundant metalloproteins in the Protein Data Bank where the zinc ions usually have catalytic, regulatory or structural roles critical for the function of the protein. Accurate prediction of zinc-binding sites is not only useful for the inference of protein function but also important for the prediction of 3D structure. Here, we present a new integrative framework that combines multiple sequence and structural properties and graph-theoretic network features, followed by an efficient feature selection to improve prediction of zinc-binding sites. We investigate what information can be retrieved from the sequence, structure and network levels that is relevant to zinc-binding site prediction. We perform a two-step feature selection using random forest to remove redundant features and quantify the relative importance of the retrieved features. Benchmarking on a high-quality structural dataset containing 1,103 protein chains and 484 zinc-binding residues, our method achieved >80% recall at a precision of 75% for the zinc-binding residues Cys, His, Glu and Asp on 5-fold cross-validation tests, which is a 10%-28% higher recall at the 75% equal precision compared to SitePredict and zincfinder at residue level using the same dataset. The independent test also indicates that our method has achieved recall of 0.790 and 0.759 at residue and protein levels, respectively, which is a performance better than the other two methods. Moreover, AUC (the Area Under the Curve and AURPC (the Area Under the Recall-Precision Curve by our method are also respectively better than those of the other two methods. Our method can not only be applied to large-scale identification of zinc-binding sites when structural information of the target is available, but also give valuable insights into important features arising from different levels that collectively characterize the zinc-binding sites. The scripts and datasets are available at http://protein.cau.edu.cn/zincidentifier/.

  3. Disparate effects of global-change drivers on mountain conifer forests: warming-induced growth enhancement in young trees vs. CO2 fertilization in old trees from wet sites.

    Science.gov (United States)

    Camarero, J Julio; Gazol, Antonio; Galván, Juan Diego; Sangüesa-Barreda, Gabriel; Gutiérrez, Emilia

    2015-02-01

    Theory predicts that the postindustrial rise in the concentration of CO2 in the atmosphere (c(a)) should enhance tree growth either through a direct fertilization effect or indirectly by improving water use efficiency in dry areas. However, this hypothesis has received little support in cold-limited and subalpine forests where positive growth responses to either rising ca or warmer temperatures are still under debate. In this study, we address this issue by analyzing an extensive dendrochronological network of high-elevation Pinus uncinata forests in Spain (28 sites, 544 trees) encompassing the whole biogeographical extent of the species. We determine if the basal area increment (BAI) trends are linked to climate warming and increased c(a) by focusing on region- and age-dependent responses. The largest improvement in BAI over the past six centuries occurred during the last 150 years affecting young trees and being driven by recent warming. Indeed, most studied regions and age classes presented BAI patterns mainly controlled by temperature trends, while growing-season precipitation was only relevant in the driest sites. Growth enhancement was linked to rising ca in mature (151-300 year-old trees) and old-mature trees (301-450 year-old trees) from the wettest sites only. This finding implies that any potential fertilization effect of elevated c(a) on forest growth is contingent on tree features that vary with ontogeny and it depends on site conditions (for instance water availability). Furthermore, we found widespread growth decline in drought-prone sites probably indicating that the rise in ca did not compensate for the reduction in water availability. Thus, warming-triggered drought stress may become a more important direct driver of growth than rising ca in similar subalpine forests. We argue that broad approaches in biogeographical and temporal terms are required to adequately evaluate any effect of rising c(a) on forest growth. © 2014 John Wiley & Sons Ltd.

  4. Assessing Ecosystem Drought Response in CLM 4.5 Using Site-Level Flux and Carbon-Isotope Measurements: Results From a Pacific Northwest Coniferous Forest

    Science.gov (United States)

    Duarte, H.; Raczka, B. M.; Koven, C. D.; Ricciuto, D. M.; Lin, J. C.; Bowling, D. R.; Ehleringer, J. R.

    2015-12-01

    The frequency, extent, and severity of droughts are expected to increase in the western United States as climate changes occur. The combination of warmer temperature, larger vapor pressure deficit, reduced snowfall and snow pack, earlier snow melt, and extended growing seasons is expected to lead to an intensification of summer droughts, with a direct impact on ecosystem productivity and therefore on the carbon budget of the region. In this scenario, an accurate representation of ecosystem drought response in land models becomes fundamental, but the task is challenging, especially in regards to stomatal response to drought. In this study we used the most recent release of the Community Land Model (CLM 4.5), which now includes photosynthetic carbon isotope discrimination and revised photosynthesis and hydrology schemes, among an extensive list of updates. We evaluated the model's performance at a coniferous forest site in the Pacific northwest (Wind River AmeriFlux Site), characterized by a climate that has a strong winter precipitation component followed by a summer drought. We ran the model in offline mode (i.e., decoupled from an atmospheric model), forced by observed meteorological data, and used site observations (e.g., surface fluxes, biomass values, and carbon isotope data) to assess the model. Previous field observations indicated a significant negative correlation between soil water content and the carbon isotope ratio of ecosystem respiration (δ13CR), suggesting that δ13CR was closely related to the photosynthetic discrimination against 13CO2 as controlled by stomatal conductance. We used these observations and latent-heat flux measurements to assess the modeled stomatal conductance values and their responses to extended summer drought. We first present the model results, followed by a discussion of potential CLM model improvements in stomatal conductance responses and in the representation of soil water stress (parameter βt) that would more precisely

  5. Geochemical investigations and interim recommendations for priority abandoned mine sites on U.S.D.A. Forest Service lands, Mineral Creek watershed, San Juan County, Colorado

    Science.gov (United States)

    Nash, J.T.

    1999-01-01

    Field observations, sampling of mine dumps and mine drainage waters, and laboratory studies of dump materials have been made at mining areas deemed to be on public lands administered by the USDA Forest Service in the Mineral Creek watershed. Results of chemical analyses of dump materials, leachates of those materials, and of surface waters draining mines or dumps provide indications of where acid is generated or consumed, and what metals are mobilized below mines or dumps. Information on 25 sites is reviewed and reclamation priorities are ranked into four classes (high, medium, low priority, or no work required). The western side of the upper Animas watershed (the Mineral Creek watershed) has a history of mining and prospecting for about 130 years. The intensity of miningrelated disturbance is higher than in most parts of the San Juan Mountains region, but actually is much less than the eastern half of the watershed (US BLM lands) and none of the mines moved millions of tons of rock and ore as in some of the eastern mines. The majority of the roughly one thousand mining sites on the USFS lands are very small (less than 100 tons or 70 cubic yards of dump material), are more than 2 miles from a major stream, or are so inaccessible as to prohibit reclamation. Twenty five sites have been considered by others to have significant size and potential for significant environmental degradation. These most significant mining areas were evaluated by multiple criteria, including tendency to generate acid or liberate toxic metals, observed acidic pH or dead vegetation (?kill zones?) below dumps or adits, potential mobility of metals, and likelihood of transport into streams of the watershed. In the author?s opinion, no single measurable parameter, such as metal concentration, is reliable for ranking significance or feasibility of reclamation. Rather, subjective estimates are required to evaluate combinations of, or interactions among, several parameters. The most subjective

  6. STUDI KONEKTIVITAS AKUIFER ANTARA SUMUR BOR DENGAN SUMBER DAYA AIR DI BAWAHNYA (Study on Aquifer Connectivity, between Boreholes with water resources underneath

    Directory of Open Access Journals (Sweden)

    Agus Budhie Wijatna

    2013-11-01

    Full Text Available ABSTRAK Untuk memenuhi kebutuhan air bersih bagi penduduk di daerah bekas bencana letusan Gunung Merapi, Kabupaten Sleman, DIY, telah dibuat 5 sumur bor di Dusun Srunen (BH1, Pagerjurang (BH2, Ngepring (BH3, Kuweron (BH4, dan di Dusun Bubur (BH5. Pembuatan sumur bor pada elevasi antara 544 sampai 846 m.dpl, dengan kedalaman antara 98-146 m dan debit pengambilan airtanah rerata 9-10 liter per detik tersebut dikawatirkan akan mempengaruhi kondisi muka airtanah sumur gali di Dusun Pendowoharjo (W7, Ngaglik (W8, Gebang (W9, Condong Catur (W10, sumur UGM (W11 dan mempengaruhi debit umbul (mataair Ngepas (S8, Umbul Jogopaten (S9, Umbul Pajangan (S10, Umbul Londo (S11, Umbul Permai (S12, dan Umbul Seturan (S13, yang berada pada elevasi 148-329 m.dpl. Secara teoritis, pengambilan airtanah di sumur bor akan berpengaruh jika terdapat interkoneksi hidraulik antara sumur bor dengan sumur gali dan mataair. Pada penelitian ini, interkoneksi hidraulik antara sumur bor dengan sumur gali dan mataair dilakukan menggunakan isotop lingkungan (D, 3H dan 18O. Penelitian diawali dengan menentukan lokasi pengambilan sampel airtanah berdasarkan peta topografi dan kondisi hidrologi; sampel airtanah diambil dari sumur bor, sumur gali dan mataair sebanyak 30 ml dan 1.000 ml; rasio isotop δD dan δ18O pada sampel airtanah diukur dengan liquid-water stable isotope analyzer LGR DLT-100, sedangkan kadar tritium diukur dengan Liquid Scientillation Counter (LSC Tri Carb 1900 TR. Genesis sampel airtanah ditentukan berdasarkan komposisi isotop (δ18O, δD dengan mengacu pada persamaan Merapi Meteoric Water Line (MMWL; sedangkan untuk memastikan adanya interkoneksi hidraulik, maka hasil pengukuran kadar tritium dianalisis dengan tritium dating method. Hasil penelitian menunjukkan bahwa genesis airtanah di BH1, BH2, BH3, dan BH4 berbeda dengan genesis airtanah sumur gali dan mataair di bawahnya. Sehingga dapat disimpulkan airtanah sumur bor di BH1, BH2, BH3, dan BH4 tidak memiliki

  7. Validating MODIS and Sentinel-2 NDVI Products at a Temperate Deciduous Forest Site Using Two Independent Ground-Based Sensors.

    Science.gov (United States)

    Lange, Maximilian; Dechant, Benjamin; Rebmann, Corinna; Vohland, Michael; Cuntz, Matthias; Doktor, Daniel

    2017-08-11

    Quantifying the accuracy of remote sensing products is a timely endeavor given the rapid increase in Earth observation missions. A validation site for Sentinel-2 products was hence established in central Germany. Automatic multispectral and hyperspectral sensor systems were installed in parallel with an existing eddy covariance flux tower, providing spectral information of the vegetation present at high temporal resolution. Normalized Difference Vegetation Index (NDVI) values from ground-based hyperspectral and multispectral sensors were compared with NDVI products derived from Sentinel-2A and Moderate-resolution Imaging Spectroradiometer (MODIS). The influence of different spatial and temporal resolutions was assessed. High correlations and similar phenological patterns between in situ and satellite-based NDVI time series demonstrated the reliability of satellite-based phenological metrics. Sentinel-2-derived metrics showed better agreement with in situ measurements than MODIS-derived metrics. Dynamic filtering with the best index slope extraction algorithm was nevertheless beneficial for Sentinel-2 NDVI time series despite the availability of quality information from the atmospheric correction procedure.

  8. Evaluating the potential for site-specific modification of LiDAR DEM derivatives to improve environmental planning-scale wetland identification using Random Forest classification

    Science.gov (United States)

    O'Neil, Gina L.; Goodall, Jonathan L.; Watson, Layne T.

    2018-04-01

    Wetlands are important ecosystems that provide many ecological benefits, and their quality and presence are protected by federal regulations. These regulations require wetland delineations, which can be costly and time-consuming to perform. Computer models can assist in this process, but lack the accuracy necessary for environmental planning-scale wetland identification. In this study, the potential for improvement of wetland identification models through modification of digital elevation model (DEM) derivatives, derived from high-resolution and increasingly available light detection and ranging (LiDAR) data, at a scale necessary for small-scale wetland delineations is evaluated. A novel approach of flow convergence modelling is presented where Topographic Wetness Index (TWI), curvature, and Cartographic Depth-to-Water index (DTW), are modified to better distinguish wetland from upland areas, combined with ancillary soil data, and used in a Random Forest classification. This approach is applied to four study sites in Virginia, implemented as an ArcGIS model. The model resulted in significant improvement in average wetland accuracy compared to the commonly used National Wetland Inventory (84.9% vs. 32.1%), at the expense of a moderately lower average non-wetland accuracy (85.6% vs. 98.0%) and average overall accuracy (85.6% vs. 92.0%). From this, we concluded that modifying TWI, curvature, and DTW provides more robust wetland and non-wetland signatures to the models by improving accuracy rates compared to classifications using the original indices. The resulting ArcGIS model is a general tool able to modify these local LiDAR DEM derivatives based on site characteristics to identify wetlands at a high resolution.

  9. Site-specific forest-assembly of single-wall carbon nanotubes on electron-beam patterned SiOx/Si substrates

    International Nuclear Information System (INIS)

    Wei Haoyan; Kim, Sang Nyon; Kim, Sejong; Huey, Bryan D.; Papadimitrakopoulos, Fotios; Marcus, Harris L.

    2008-01-01

    Based on electron-beam direct writing on the SiO x /Si substrates, favorable absorption sites for ferric cations (Fe 3+ ions) were created on the surface oxide layer. This allowed Fe 3+ -assisted self-assembled arrays of single-wall carbon nanotube (SWNT) probes to be produced. Auger investigation indicated that the incident energetic electrons depleted oxygen, creating more dangling bonds around Si atoms at the surface of the SiO x layer. This resulted in a distinct difference in the friction forces from unexposed regions as measured by lateral force microscopy (LFM). Atomic force microscopy (AFM) affirmed that the irradiated domains absorbed considerably more Fe 3+ ions upon immersion into pH 2.2 aqueous FeCl 3 solution. This rendered a greater yield of FeO(OH)/FeOCl precipitates, primarily FeO(OH), upon subsequent washing with lightly basic dimethylformamide (DMF) solution. Such selective metal-functionalization established the basis for the subsequent patterned forest-assembly of SWNTs as demonstrated by resonance Raman spectroscopy

  10. Ecological modeling for forest management in the Shawnee National Forest

    Science.gov (United States)

    Richard G. Thurau; J.F. Fralish; S. Hupe; B. Fitch; A.D. Carver

    2008-01-01

    Land managers of the Shawnee National Forest in southern Illinois are challenged to meet the needs of a diverse populace of stakeholders. By classifying National Forest holdings into management units, U.S. Forest Service personnel can spatially allocate resources and services to meet local management objectives. Ecological Classification Systems predict ecological site...

  11. Forest report 2017; Waldzustandsbericht 2017

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2017-11-01

    This forest condition report of Hesse (Germany) includes the following topics: forest condition survey for all tree species, forest in the in the Rhine-Main area, weather and climate, insects and fungi, forestry environment monitoring, site information for the Federal Forest Inventory in Hesse, infiltrated substances, development of soil acidification on intensive monitoring areas in northwestern Germany, and the substrate group basalt/diabase.

  12. Phylobetadiversity among forest types in the Brazilian Atlantic Forest complex.

    Science.gov (United States)

    Duarte, Leandro Da Silva; Bergamin, Rodrigo Scarton; Marcilio-Silva, Vinícius; Seger, Guilherme Dubal Dos Santos; Marques, Márcia Cristina Mendes

    2014-01-01

    Phylobetadiversity is defined as the phylogenetic resemblance between communities or biomes. Analyzing phylobetadiversity patterns among different vegetation physiognomies within a single biome is crucial to understand the historical affinities between them. Based on the widely accepted idea that different forest physiognomies within the Southern Brazilian Atlantic Forest constitute different facies of a single biome, we hypothesize that more recent phylogenetic nodes should drive phylobetadiversity gradients between the different forest types within the Atlantic Forest, as the phylogenetic divergence among those forest types is biogeographically recent. We compiled information from 206 checklists describing the occurrence of shrub/tree species across three different forest physiognomies within the Southern Brazilian Atlantic Forest (Dense, Mixed and Seasonal forests). We analyzed intra-site phylogenetic structure (phylogenetic diversity, net relatedness index and nearest taxon index) and phylobetadiversity between plots located at different forest types, using five different methods differing in sensitivity to either basal or terminal nodes (phylogenetic fuzzy weighting, COMDIST, COMDISTNT, UniFrac and Rao's H). Mixed forests showed higher phylogenetic diversity and overdispersion than the other forest types. Furthermore, all forest types differed from each other in relation phylobetadiversity patterns, particularly when phylobetadiversity methods more sensitive to terminal nodes were employed. Mixed forests tended to show higher phylogenetic differentiation to Dense and Seasonal forests than these latter from each other. The higher phylogenetic diversity and phylobetadiversity levels found in Mixed forests when compared to the others likely result from the biogeographical origin of several taxa occurring in these forests. On one hand, Mixed forests shelter several temperate taxa, like the conifers Araucaria and Podocarpus. On the other hand, tropical groups, like

  13. Calidad de abonos orgánicos empleados en la depresión de Quíbor-Venezuela bajo ambientes protegidos

    Directory of Open Access Journals (Sweden)

    Duilio Torres Rodríguez

    2017-01-01

    Full Text Available La depresión de Quíbor es una de las zonas agrícolas más importante de Venezuela, donde en los últimos años se han introducido sistemas de producción bajo ambientes protegidos, los cuales están acompañados por el uso de abonos orgánicos, no certi cados. El objetivo de esta investigación fue evaluar la calidad de los abonos orgánicos empleados en sistemas de producción bajo ambientes protegidos en la depresión de Quíbor, Venezuela. Se realizó un diseño experimental completamente al azar y se evaluaron once (11 abonos orgánicos (cuatro sólidos y siete líquidos por triplicados. Los abonos sólidos fueron colectados en la parte superior, inferior y media de las pilas, mientras que los líquidos fueron tomados directamente de los tanques de almacenamiento. Para la caracterización de los abonos se empleó el protocolo TMECC, la materia orgánica se determinó por calcinación a 450°C, el nitrógeno por Kjeldahl y los macronutrientes (potasio y calcio y micronutrientes (cobre, manganeso, hierro y zinc en extracto acuoso 1/20 (v/v del material y cuantificación por absorción atómica. Los resultados obtenidos muestran que el vermicompost y compost de gallinaza presentaron los valores más altos de macronutrientes, mientras, para los abonos líquidos Macro®, fue quien presentó la mayor concentración de nitrógeno, humus1 los valores más altos de Ca y Mg y Micro® y humus2 los mayores contenidos de manganeso, hierro, cobre y zinc fueron encontrados, todos los abonos sólidos presentaron valores bajos de micronutrientes.

  14. Urban Forests

    Science.gov (United States)

    David Nowak

    2016-01-01

    Urban forests (and trees) constitute the second forest resource considered in this report. We specifically emphasize the fact that agricultural and urban forests exist on a continuum defined by their relationship (and interrelationship) with a given landscape. These two forest types generally serve different purposes, however. Whereas agricultural forests are...

  15. Environmental Modeling, The Buffer Priority layers for Nitrogen Removal identify priority forest/grass buffer sites by subwatershed. Land use, hydrology, soil, and landscape characteristics were analyzed to rank opportunities with high nitrogen removal potential., Published in 2014, Smaller than 1:100000 scale, Maryland Department of Natural Resources (DNR).

    Data.gov (United States)

    NSGIC Education | GIS Inventory — Environmental Modeling dataset current as of 2014. The Buffer Priority layers for Nitrogen Removal identify priority forest/grass buffer sites by subwatershed. Land...

  16. Radioactivity of long-lived nuclides in the primary circuit of the reactor BOR-60 during operation with defective fuel elements

    International Nuclear Information System (INIS)

    Gryazev, V.M.; Kizin, V.D.; Lisitsyn, E.S.; Polyakov, V.I.; Chechetkin, Y.V.

    1978-06-01

    The summarized results of measurements of the enrichment and distribution of radioactive nuclides from corrosion and of fission products during the four years of operation of BOR-60, including a longer period of operation with detective fuel elements in the core, are presented. It is shown that for operation with approximately 1% leaking fuel rods radiation exposure becomes worse manily because of release and enrichment of cesium isotopes in the coolant. Of the other fission products, the largest contribution to the dose rate in pipework and components is given by 140 Ba / 140 La and 95 Nb. On operation with 0.1 to 0.2% of leaking fuel rods, this contribution is comparable to that of the corrosion products 60 Co and 54 Mn. The radioactivity of corrosion products in the circuit has not increased within the last three years and was about one order of magnitude lower than the theoretical values. The corrosion and fission products are nonuniformly distributed over the circuit. Concentration of 95 Nb and 60 Co in the pipe for 'cold' sodium is larger by a factor of 2 - 5 and of 140 Ba and 54 Mn by a factor of 10-20 than in the pipes for 'hot' sodium. Most of the cobalt was found to deposit in the heat exchanges. The effectiveness of emptying the pipes from coolant in order to reduce the dose sate is assessed. (orig.) [de

  17. (15)N in tree rings as a bio-indicator of changing nitrogen cycling in tropical forests: an evaluation at three sites using two sampling methods.

    Science.gov (United States)

    van der Sleen, Peter; Vlam, Mart; Groenendijk, Peter; Anten, Niels P R; Bongers, Frans; Bunyavejchewin, Sarayudh; Hietz, Peter; Pons, Thijs L; Zuidema, Pieter A

    2015-01-01

    Anthropogenic nitrogen deposition is currently causing a more than twofold increase of reactive nitrogen input over large areas in the tropics. Elevated (15)N abundance (δ(15)N) in the growth rings of some tropical trees has been hypothesized to reflect an increased leaching of (15)N-depleted nitrate from the soil, following anthropogenic nitrogen deposition over the last decades. To find further evidence for altered nitrogen cycling in tropical forests, we measured long-term δ(15)N values in trees from Bolivia, Cameroon, and Thailand. We used two different sampling methods. In the first, wood samples were taken in a conventional way: from the pith to the bark across the stem of 28 large trees (the "radial" method). In the second, δ(15)N values were compared across a fixed diameter (the "fixed-diameter" method). We sampled 400 trees that differed widely in size, but measured δ(15)N in the stem around the same diameter (20 cm dbh) in all trees. As a result, the growth rings formed around this diameter differed in age and allowed a comparison of δ(15)N values over time with an explicit control for potential size-effects on δ(15)N values. We found a significant increase of tree-ring δ(15)N across the stem radius of large trees from Bolivia and Cameroon, but no change in tree-ring δ(15)N values over time was found in any of the study sites when controlling for tree size. This suggests that radial trends of δ(15)N values within trees reflect tree ontogeny (size development). However, for the trees from Cameroon and Thailand, a low statistical power in the fixed-diameter method prevents to conclude this with high certainty. For the trees from Bolivia, statistical power in the fixed-diameter method was high, showing that the temporal trend in tree-ring δ(15)N values in the radial method is primarily caused by tree ontogeny and unlikely by a change in nitrogen cycling. We therefore stress to account for tree size before tree-ring δ(15)N values can be properly

  18. 15N in tree rings as a bio-indicator of changing nitrogen cycling in tropical forests: an evaluation at three sites using two sampling methods

    Directory of Open Access Journals (Sweden)

    Peter evan der Sleen

    2015-04-01

    Full Text Available Anthropogenic nitrogen deposition is currently causing a more than twofold increase of reactive nitrogen input over large areas in the tropics. Elevated 15N abundance (δ15N in the growth rings of some tropical trees has been hypothesized to reflect an increased leaching of 15N-depleted nitrate from the soil following anthropogenic nitrogen deposition over the last decades. To find further evidence for altered nitrogen cycling in tropical forests we measured long-term δ15N values in trees from Bolivia, Cameroon and Thailand. We used two different sampling methods. In the first, wood samples were taken in a conventional way: from the pit to the bark across the stem of 28 large trees (the ‘radial’ method. In the second, δ15N values were compared across a fixed diameter (the ‘fixed-diameter’ method. We sampled 400 trees that differed widely in size, but measured δ15N in the stem around the same diameter (20 cm dbh in all trees. As a result, the growth rings formed around this diameter differed in age and allowed a comparison of δ15N values over time with an explicit control for the potential size-effects on δ15N values. We found a significant increase of tree-ring δ15N across the stem radius of large trees from Bolivia and Cameroon, but no change in tree-ring δ15N values over time was found in any of the study sites when controlling for tree size. This suggests that radial trends of δ15N values within trees reflect tree ontogeny (size development. However, for the trees from Cameroon and Thailand, a low statistical power in the fixed-diameter method prevents to conclude this with high certainty. For the trees from Bolivia, statistical power in the fixed-diameter method was high, showing that the temporal trend in tree-ring δ15N values in the radial method is primarily caused by tree ontogeny and unlikely by a change in nitrogen cycling. We therefore stress to account for tree size before tree-ring δ15N values can be properly

  19. Forest rights

    DEFF Research Database (Denmark)

    Balooni, Kulbhushan; Lund, Jens Friis

    2014-01-01

    One of the proposed strategies for implementation of reducing emissions from deforestation and forest degradation plus (REDD+) is to incentivize conservation of forests managed by communities under decentralized forest management. Yet, we argue that this is a challenging road to REDD+ because...... conservation of forests under existing decentralized management arrangements toward a push for extending the coverage of forests under decentralized management, making forest rights the hard currency of REDD+....

  20. Culture phenomenon analysis on the forest tour activity of China

    Institute of Scientific and Technical Information of China (English)

    Jiang Minjin

    2006-01-01

    This paper analyzes culture and forest culture, the intension of culture and forest culture, combines the understanding of the main cultural factor with the forest tour activity of China, analyzes the compatible phenomenon of Chinese forest culture and traditional culture, and explores culture of forest tourist site containing the meaning in forest tour. The author thinks the tour of forest culture which will be the important component of forest tour in forest culture,This paper puts forward simple questions existing in exploitation and advantage of forest tour culture, and proposes some countermeasures.

  1. Analiza structurii arboretelor naturale din siturile natura 2000 glodeasa și Cheile Doftanei – jud. Prahova în raport cu criteriile de încadrare în categoria pădurilor cvasivirgine/ The analysis of the structure of natural stands from natura 2000 sites, glodeasa and Doftana Canyon – Prahova county, reported to the cvasi-virgin forests categorizing criteria

    Directory of Open Access Journals (Sweden)

    Petre Dorin GÎRBACEA

    2016-12-01

    Full Text Available Habitats protection and conservation of flora and fauna species of communitarian interest, represents an important topic at national and European level in the context of climate change. The data analysis from documents records, has led to the conclusion that the sites formed in Natura 2000 ecological network in Doftana Valley basin, are poorly studied in terms of biodiversity. The multi-criterial analysis we used, showed that the forests natural habitats from Glodeasa fits better in the category of cvasi-virgin forest relative to the natural forest habitat from Doftana Canyon site.

  2. Amphibians of the Reserva Ecológica Michelin: a high diversity site in the lowland Atlantic Forest of southern Bahia, Brazil.

    Science.gov (United States)

    de Mira-Mendes, Caio Vinícius; Ruas, Danilo Silva; de Oliveira, Renan Manoel; Castro, Indira Maria; Dias, Iuri Ribeiro; Baumgarten, Julio Ernesto; Juncá, Flora Acuña; Solé, Mirco

    2018-01-01

    An inventory of the amphibians of the Reserva Ecológica Michelin - REM in southern Bahia, Brazil is presented. Sixty-nine species were recorded during a ten-year sampling period. Amphibians were distributed in two orders (Gymnophiona and Anura), belonging to twelve families [Aromobatidae (1), Bufonidae (3), Centrolenidae (1), Craugastoridae (5), Eleutherodactylidae (3), Hemiphractidae (2), Hylidae (34), Phyllomedusidae (5) Leptodactylidae (7), Microhylidae (4), Odontophrynidae (3) and Caeciliidae (1)]. Fifty per cent of the reproductive modes known for Atlantic forest anurans were recorded. While no threatened species were found at REM, six species are classified as data deficient (DD) by the Brazilian Red List of threatened species and deserve additional attention. Phasmahyla timbo and Vitreorana eurygnatha are listed as endangered in Bahia according to the list of threatened species of the state. Despite a higher diversity of amphibians in the Atlantic forest having been reported for mountainous regions, our results revealed that amphibian richness for lowland forests is also high.

  3. Managing carbon sequestration and storage in northern hardwood forests

    Science.gov (United States)

    Eunice A. Padley; Deahn M. Donner; Karin S. Fassnacht; Ronald S. Zalesny; Bruce Birr; Karl J. Martin

    2011-01-01

    Carbon has an important role in sustainable forest management, contributing to functions that maintain site productivity, nutrient cycling, and soil physical properties. Forest management practices can alter ecosystem carbon allocation as well as the amount of total site carbon.

  4. Forest soils

    Science.gov (United States)

    Charles H. (Hobie) Perry; Michael C. Amacher

    2009-01-01

    Productive soils are the foundation of sustainable forests throughout the United States. Forest soils are generally subjected to fewer disturbances than agricultural soils, particularly those that are tilled, so forest soils tend to have better preserved A-horizons than agricultural soils. Another major contrast between forest and agricultural soils is the addition of...

  5. Forest hydrology

    Science.gov (United States)

    Ge Sun; Devendra Amatya; Steve McNulty

    2016-01-01

    Forest hydrology studies the distribution, storage, movement, and quality of water and the hydrological processes in forest-dominated ecosystems. Forest hydrological science is regarded as the foundation of modern integrated water¬shed management. This chapter provides an overview of the history of forest hydrology and basic principles of this unique branch of...

  6. Forest Management

    Science.gov (United States)

    S. Hummel; K. L. O' Hara

    2008-01-01

    Global variation in forests and in human cultures means that a single method for managing forests is not possible. However, forest management everywhere shares some common principles because it is rooted in physical and biological sciences like chemistry and genetics. Ecological forest management is an approach that combines an understanding of universal processes with...

  7. Changing role of non-timber forest products (NTFP) in rural household economy: the case of Sinharaja World Heritage site in Sri Lanka.

    Science.gov (United States)

    Senaratne, Athula; Abeygunawardena, Piyasena; Jayatilake, Wijaya

    2003-11-01

    This paper examines the modified patterns of utilizing non-timber forest products (NTFP) and associated behavioral changes around tropical forest areas in the context of conservation-related objectives and other commercially driven objectives. Our study introduces a conceptual framework based on the household production theory and tests empirically the hypotheses drawn at Sinharaja World Heritage in Sri Lanka. The results show that conditions introduced by forest conservation programs and the spread of small-scale commercial tea cultivation are transforming the economy around Sinharaja. The process is an economically rational one where resident communities decide upon their actions based on the opportunity cost of time involved with NTFP in the absence of observable prices. Although the process, overall, has led to a decline in the role of NTFP in the household economy, its impact over different NTFP are not uniform, leaving sustained demand for certain NTFP. This situation calls for a multifaceted approach in forest management programs to address the various household needs fulfilled by NTFP-based activities.

  8. Carbon-13 and nitrogen-15 enrichment in coastal forest foliage from nutrient-poor and seabird-enriched sites in southern New Zealand

    International Nuclear Information System (INIS)

    Hawke, D.J.; Newman, J.

    2007-01-01

    To assess the effect of nutrient inputs from breeding seabirds on forest foliage δ 13 C and δ 15 N, we collected foliage samples from two contrasting locations. Olearia lyallii forest on North East Island at The Snares hosts large numbers of (in particular) breeding sooty shearwaters (Puffinus griseus). At Mason Bay (Rakiura/Stewart Island), samples of Brachyglottis rotundifolia, Griselinia littoralis, and Dracophyllum longifolium were collected from two strata within diverse dune forest and one stratum from the open dunes. The δ 13 C results were typical of C 3 plants and did not differ significantly between Mason Bay and North East Island. In contrast, the δ 15 N results from Mason Bay (mean ± standard deviation, -6.1 ± 1.7 permille) were significantly lower than expected for temperate forest (95% confidence interval of difference, 2.7-3.9 permille), and dramatically lower (19.1-21.5 permille) than North East Island where enrichments (+14.2 ± 3.1 permille) were among the highest ever reported for vegetation. (author). 33 refs., 1 fig., 2 tabs

  9. Late glacial and Holocene history of the dry forest area in south Colombian Cauca Valley from sites Quilichao and la Teta

    International Nuclear Information System (INIS)

    Berrio, Juan Carlos; Hooghiemstra, Henry; Marchant, Rob; Rangel Orlando

    2002-01-01

    Two sedimentary cores with records of pollen and charcoal content within a chronology provided by radiocarbon are presented from the southern Cauca Valley in Colombia (1020 m). These records document the late glacial and Holocene dry forest vegetation, fire and environment history. Specifically, core Quilichao -1 (640 cm; 3 degrade 6' N, 76 degrade 31' W) represents the periods of 13/150-7720 14 C yr BP and following a hiatus from 2880 14 C yr BP to recent. Core la Teta - 2 (250 cm; 3 degrade 5' N, 76 degrade 32' W) provides a record from 8700 14 C yr BP around 13/150 21 4 C yr BP Quilichao shown an active late glacial drainage system and presence of dry forest. From 11/465-10/520 14 C yr BP dry forest consists mainly of Crotalaria Moraceae Urticaceae, Melastomataceae, Piper and low stature trees, such as Acalypha, Alchornea, Cecropia and Celtis. At higher elevation on the slopes Andean forest with Quercus, Hedyosmum, Myrica and Alnus are common

  10. Effects of site preparation subsoiling and prescribed burning on survival and growth of shortleaf pine in the Mark Twain National Forest: results after 20 growing seasons

    Science.gov (United States)

    David Gwaze; Ross Melick; Lynn McClure; Charly Studyvin; David Massengele

    2007-01-01

    The objective of this study was to evaluate the effect of subsoiling (ripping) and prescribed burning on height, survival, diameter, volume, and competition of planted shortleaf pine (Pinus echinata Mill.). The study was established at the Salem Ranger District, Mark Twain National Forest. The treatments were subsoil/burn, burn, and control with no...

  11. Vacant Nests and Other Factors Influencing Nest Site Selection of Birds of Prey Based on Case Studies in Forest Habitats in the Forest-Steppe and Steppe Zones of Eastern Ukraine

    Directory of Open Access Journals (Sweden)

    Stanislav G. Viter

    2015-12-01

    Full Text Available Our study was conducted in 2003–2012 in Eastern Ukraine, in the basin of the Seversky Donets river. The total surveyed area was ca. 900 km2 of nesting habitats suitable for raptors. A total of 69 vacant nests were found, i.e. 33.2 % of the total number of nests (208. Nests occupied by recipient species, i.e. the so-called ‘effective nest pool’, were 23–24, i.e. 33.3–34.7 % of the pool of available nests. Up to 25 % of all pairs of raptors depend on the availability of vacant nests of heterospecifics. Ravens (Corvus corax are the most significant donors of nests: 42.5 % of the pool of available nests is built by this species, and more than 60 % of them are occupied by recipient species. Common Buzzard (Buteo buteo comes second with 26.09 and 58.3 %, respectively. The most common recipients of nests are Hobbies (Falco subbuteo, Common Kestrel (Falco tinnunculus and Booted Eagles (Hieraaetus pennatus. The most significant factors that govern occupation of vacant nests by recipient species are: availability of nests in the marginal zone of forest plots, i.e. within 500 m from the forest edge, large distance from human settlements (>1500 m, presence of nests located on trees in the canopy storey, and mature and submature age of forest stands. For seven species considered in our research (n=227, the most important factors were position of nests, in the forest canopy layer, no logging activity within300 m of the nest, no regular human disturbance, and presence of “windows” in the canopy made by fallen trees.

  12. Efectos de la costra microbiótica en algunas propiedades del suelo en el sur de la quebrada Los Barrancos, Valle de Quíbor, Venezuela

    Directory of Open Access Journals (Sweden)

    Franklin Antonio Nuñez Ravelo

    2013-10-01

    Full Text Available En el suelo de Quíbor crecen de manera discontinua unas costras constituidas por líquenes, briofitas y cianobacterias. El propósito de esta investigación es identificar variaciones en el comportamiento de algunas propiedades edáficas al comparar muestras del suelo con y sin costra. Se trata de una investigación de campo desarrollada en tres fases: la primera, denominada de Campo, con el fin de recolectar muestras de suelo con apoyo en la tabla de dígitos aleatorios y a partir de dos transectas longitudinales, sobre éstas se empleó cada diez metros una cuadrata cuadrada de 25 x 25 cm; la segunda fase, laboratorio, en la cual se determinaron las propiedades del suelo: a física como el %humedad; b químicas como la salinidad, pH, Conductividad Eléctrica (C.E y Carbono Orgánico (CO, y c bioquímicas, entre ellas la Materia Orgánica (MO y Dióxido de carbono (CO2 desprendido; la tercera fase, de análisis estadístico, se empleó la prueba t, a fin de identificar variaciones significativas entre ambos grupos muestrales. Se concluye que la presencia de la costra en la superficie del suelo aumenta la actividad metabólica, el CO y la MO. En cuanto al pH, C.E, salinidad y %H no se registraron variaciones significativas.

  13. Multi-criteria analysis of soil pollution by heavy metals in the vicinity of the Copper Smelting Plant in Bor (Serbia

    Directory of Open Access Journals (Sweden)

    NEVENKA PETROVIĆ

    2011-04-01

    Full Text Available This study highlights the consequences on soil pollution of one hund­red years of manufacturing in the Copper Mining and Smelting Complex RTB-Bor (Serbia. Soil sediments were taken via a probe from the surface layer of the soil at twelve different measuring points. The measuring points were all within 20 km of the smelting plant, which included both urban and rural zones. Soil sampling was performed using a soil core sampler in such way that a core of a soil of radius 5 cm and depth of 30 cm was removed. Subsequently, the samples were analyzed for pH and heavy metal concentrations (Cu, Pb, As, Cd, Mn, Ni and Hg using different spectrometric methods. The obtained results for the heavy metal contents in the samples show high values: 2,540 mg kg-1 Cu; 230 mg kg-1 Pb; 6 mg kg-1 Cd; 530 mg kg-1 Ni; 1,300 mg kg-1 Mn; 260 mg kg-1 As and 0.3 mg kg-1 Hg. In this study, critical zones of polluted soil were iden­tified and ranked according to their metal contents by the multi-criteria deci­sion method Preference Organization Method for Enrichment Evaluation/Geo­metrical Analysis for Interactive Assistance – PROMETHEE/GAIA, which is the preferred multivariate method commonly used in chemometric studies. The ranking results clearly showed that the most polluted zones are at locations holding the vital functions of the town. Therefore, due to the high bioavail­abi­lity of heavy metals through com­plex reactions with organic species in the sediments, consequences for human health could drastically emerge if these metals enter the food chain.

  14. Measured and modeled evidence for a two-fold increase in water use efficiency at an old-growth forest site in the Pacific Northwest

    Science.gov (United States)

    Jiang, Y.; Rastogi, B.; Kim, J. B.; Voelker, S.; Meinzer, F. C.; Still, C. J.

    2017-12-01

    Water use efficiency (WUE), the ratio of carbon uptake to transpiration, has been widely recognized as an important measure of carbon and water cycling in plants, and is used to track forest ecosystem responses to climate change and rising atmospheric CO2concentrations. In this study we used eddy covariance measurement data and Ecosystem Demography model (ED2) simulations to explore the patterns and physiological and biophysical controls of WUE at Wind River Experimental Forest, an old-growth coniferous forest in the Pacific Northwest. We characterized how observed and simulated WUE vary between wet and dry years, and explored the drivers of the differences in WUE between the wet and dry years. Through this explorative process, we evaluated the utility of various ways that WUE have been computed in literature. Measurement-based and simulated WUE at the old-growth forest increased over twofold from 1998 to 2015. The primary driver of this trend is a decreasing trend in evapotranspiration (ET). There were significant inter-annual variations. For example, during drought years, higher air temperature drove increases in early season ET, thereby depleting soil water and decreasing GPP. Lower GPP in turn resulted in lower WUE. This mechanism might drive changes in future carbon and water budgets under warming climate. Our evaluation of multiple WUE metrics demonstrates that each metric has a distinct sensitivity to climate anomalies, but also indicates a robust increasing trend of WUE. Statistical (multiple linear regression) and machine learning (Random Forest) analyses of flux measurements indicated that atmospheric CO2 concentration, air temperature and radiation were the most important predictors of WUE at monthly, daily and half-hourly time scale, respectively. In contrast, WUE mechanism was stable across all time scales in ED2 simulations: vapor pressure deficit was consistently the most important predictor of WUE at the monthly, daily and half-hourly time scales.

  15. Restoring forests

    DEFF Research Database (Denmark)

    Jacobs, Douglass F.; Oliet, Juan A.; Aronson, James

    2015-01-01

    of land requiring restoration implies the need for spatial prioritization of restoration efforts according to cost-benefit analyses that include ecological risks. To design resistant and resilient ecosystems that can adapt to emerging circumstances, an adaptive management approach is needed. Global change......, in particular, imparts a high degree of uncertainty about the future ecological and societal conditions of forest ecosystems to be restored, as well as their desired goods and services. We must also reconsider the suite of species incorporated into restoration with the aim of moving toward more stress resistant...... and competitive combinations in the longer term. Non-native species may serve an important role under some circumstances, e.g., to facilitate reintroduction of native species. Propagation and field establishment techniques must promote survival through seedling stress resistance and site preparation. An improved...

  16. Validation of PROBA-V GEOV1 and MODIS C5 & C6 fAPAR Products in a Deciduous Beech Forest Site in Italy

    Czech Academy of Sciences Publication Activity Database

    Nestola, E.; Sanchez-Zapero, J.; Latorre, C.; Mazzenga, F.; Matteucci, G.; Calfapietra, Carlo; Camacho, F.

    2017-01-01

    Roč. 9, č. 2 (2017), č. článku 126. ISSN 2072-4292 Institutional support: RVO:86652079 Keywords : fAPAR * validation * PROBA-V GEOV1 * MODIS C5 * MODIS C6 * beech forest * up-scaling * GCOS requirements * in-situ comparison and evaluation Subject RIV: EH - Ecology, Behaviour OBOR OECD: Environmental sciences (social aspects to be 5.7) Impact factor: 3.244, year: 2016

  17. Electrical Resistivity Tomography and Ground Penetrating Radar for locating buried petrified wood sites: a case study in the natural monument of the Petrified Forest of Evros, Greece

    Science.gov (United States)

    Vargemezis, George; Diamanti, Nectaria; Tsourlos, Panagiotis; Fikos, Ilias

    2014-05-01

    A geophysical survey was carried out in the Petrified Forest of Evros, the northernmost regional unit of Greece. This collection of petrified wood has an age of approximately 35 million years and it is the oldest in Greece (i.e., older than the well-known Petrified Forest of Lesvos island located in the North Aegean Sea and which is possibly the largest of the petrified forests worldwide). Protection, development and maintenance projects still need to be carried out at the area despite all fears regarding the forest's fate since many petrified logs remain exposed both in weather conditions - leading to erosion - and to the public. This survey was conducted as part of a more extensive framework regarding the development and protection of this natural monument. Geophysical surveying has been chosen as a non-destructive investigation method since the area of application is both a natural ecosystem and part of cultural heritage. Along with electrical resistivity tomography (ERT), ground penetrating radar (GPR) surveys have been carried out for investigating possible locations of buried fossilized tree trunks. The geoelectrical sections derived from ERT data in combination with the GPR profiles provided a broad view of the subsurface. Two and three dimensional subsurface geophysical images of the surveyed area have been constructed, pointing out probable locations of petrified logs. Regarding ERT, petrified trunks have been detected as high resistive bodies, while lower resistivity values were more related to the surrounding geological materials. GPR surveying has also indicated buried petrified log locations. As these two geophysical methods are affected in different ways by the subsurface conditions, the combined use of both techniques enhanced our ability to produce more reliable interpretations of the subsurface. After the completion of the geophysical investigations of this first stage, petrified trunks were revealed after a subsequent excavation at indicated

  18. Amphibians of the Reserva Ecológica Michelin: a high diversity site in the lowland Atlantic Forest of southern Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Caio Vinícius de Mira-Mendes

    2018-04-01

    Full Text Available An inventory of the amphibians of the Reserva Ecológica Michelin – REM in southern Bahia, Brazil is presented. Sixty-nine species were recorded during a ten-year sampling period. Amphibians were distributed in two orders (Gymnophiona and Anura, belonging to twelve families [Aromobatidae (1, Bufonidae (3, Centrolenidae (1, Craugastoridae (5, Eleutherodactylidae (3, Hemiphractidae (2, Hylidae (34, Phyllomedusidae (5 Leptodactylidae (7, Microhylidae (4, Odontophrynidae (3 and Caeciliidae (1]. Fifty per cent of the reproductive modes known for Atlantic forest anurans were recorded. While no threatened species were found at REM, six species are classified as data deficient (DD by the Brazilian Red List of threatened species and deserve additional attention. Phasmahyla timbo and Vitreorana eurygnatha are listed as endangered in Bahia according to the list of threatened species of the state. Despite a higher diversity of amphibians in the Atlantic forest having been reported for mountainous regions, our results revealed that amphibian richness for lowland forests is also high.

  19. Abelhas Euglossini (Apidae de áreas de Mata Atlântica: abundância, riqueza e aspectos biológicos Euglossine bees (Apidae from Atlantic Forest sites: abundance, richness, and biological aspects

    Directory of Open Access Journals (Sweden)

    Rui Carlos Peruquetti

    1999-01-01

    Full Text Available Collection data of Euglossinae males from Parque Estadual do Rio Doce (PERD and Viçosa, both areas with remnants of Atlantic Rain Forest (Mata Atlântica in Minas Gerais state, Brazil are presented. Comparisons made among three fragments with different sizes and states of disturbance from Viçosa showed differences in abundance of most common species and apparently, Eulaema nigrita Lepeletir, 1841 can be an useful indicator of disturbed sites. Some populations of euglossine bees seems to be restrict to a forest fragment, there being few or no flow of individuals or species of one fragment to another, even when they are only 1 km apart. 15 species of euglossines were sampled in PERD, and the most abundant was Eulaema cingulata (Fabricius, 1804. At Viçosa, 10 species were sampled, E. nigrita was the predominant one. Methyl salicylate attracted no males at both sites, in spite of large numbers of species and individuals sampled using this bait in other regions. The majority of species and individuals were collected in the rainy season. Only 0,58% of sampled males carried orchid pollinia (Catasetum Richard, Cycnoches Lindley and Coryanthes Hook on their bodies. Emergence data of four species of Euglossa Latreille, 1802 reared from trap nests suggest that sex ratio in Euglossini is not a constant within the tribe. A list of 57 euglossine species now known to occur in Mata Atlântica are offered.

  20. Monitoring coniferous forest biomass change using a Landsat trajectory-based approach

    Science.gov (United States)

    Magdalena Main-Knorn; Warren B. Cohen; Robert E. Kennedy; Wojciech Grodzki; Dirk Pflugmacher; Patrick Griffiths; Patrick Hostert

    2013-01-01

    Forest biomass is a major store of carbon and thus plays an important role in the regional and global carbon cycle. Accurate forest carbon sequestration assessment requires estimation of both forest biomass and forest biomass dynamics over time. Forest dynamics are characterized by disturbances and recovery, key processes affecting site productivity and the forest...

  1. Forest report 2017; Waldzustandsbericht 2017

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2017-07-01

    This forest report of Lower Saxony (Germany) contains the following topics: Forestry Environment Monitoring (defoliation results of all tree species), weather and climate, insects and fungi, site information for the Federal Forest Inventory in Lower Saxony, infiltrated substances, development of soil acidification on intensive monitoring areas in northwestern Germany, and substrate group mottled sandstone.

  2. Species composition and similarities among anuran assemblages of forest sites in southeastern Brazil Composição de espécies e similaridades entre taxocenoses de anuros de áreas florestais do sudeste do Brasil

    Directory of Open Access Journals (Sweden)

    Jaime Bertoluci

    2007-08-01

    Full Text Available Neotropical forests show high anuran species richness, but some Brazilian forest formations, like cerradão, semideciduous forests and restingas, remain poorly known. The composition of anuran species were determined for four forest sites belonging to different biomes in southeastern Brazil, based on two complementary techniques (visual encounter survey and survey on breeding sites, both applied simultaneously. A total of 60 anuran species belonging to eight families was recorded. Species richness and levels of endemism were higher in the Atlantic rainforest site. Sites located in the Cerrado domain were more alike than those located in the Atlantic Forest Domain. Similarity in anuran species composition was negatively correlated to the geographical distance among sites, which explains part of similarities in species composition. Factors affecting these occurrence patterns are discussed. One species (if its identity is confirmed is considered Data Deficient by IUCN (The World Conservation Union, though it is not included in the Brazilian list of threatened amphibians. The presence of certain species with special habitats and microclimate requirements (bioindicators suggests well-preserved ecosystems.As florestas neotropicais apresentam altas riquezas de espécies de anuros, mas algumas formações florestais brasileiras, como o cerradão, as florestas semidecíduas e as restingas, permanecem pouco conhecidas. A composição de espécies de anuros de quatro áreas florestais pertencentes a diferentes biomas do sudeste do Brasil foi determinada com base em duas técnicas complementares (procura visual e investigação nos sítios reprodutivos, aplicadas de forma simultânea. Registramos um total de 60 espécies de anuros, incluídas em oito famílias. A riqueza de espécies e o nível de endemismo foram maiores na área coberta por floresta pluvial atlântica. As áreas localizadas no domínio do Cerrado foram mais similares entre si do que as

  3. Degraded tropical rain forests possess valuable carbon storage opportunities in a complex, forested landscape.

    Science.gov (United States)

    Alamgir, Mohammed; Campbell, Mason J; Turton, Stephen M; Pert, Petina L; Edwards, Will; Laurance, William F

    2016-07-20

    Tropical forests are major contributors to the terrestrial global carbon pool, but this pool is being reduced via deforestation and forest degradation. Relatively few studies have assessed carbon storage in degraded tropical forests. We sampled 37,000 m(2) of intact rainforest, degraded rainforest and sclerophyll forest across the greater Wet Tropics bioregion of northeast Australia. We compared aboveground biomass and carbon storage of the three forest types, and the effects of forest structural attributes and environmental factors that influence carbon storage. Some degraded forests were found to store much less aboveground carbon than intact rainforests, whereas others sites had similar carbon storage to primary forest. Sclerophyll forests had lower carbon storage, comparable to the most heavily degraded rainforests. Our findings indicate that under certain situations, degraded forest may store as much carbon as intact rainforests. Strategic rehabilitation of degraded forests could enhance regional carbon storage and have positive benefits for tropical biodiversity.

  4. Securing tropical forest carbon

    DEFF Research Database (Denmark)

    Scharlemann, Jörn P. W.; Kapos, Valerie; Campbell, Alison

    2010-01-01

    Forest loss and degradation in the tropics contribute 6-17% of all greenhouse gas emissions. Protected areas cover 217.2 million ha (19.6%) of the world's humid tropical forests and contain c. 70.3 petagrams of carbon (Pg C) in biomass and soil to 1 m depth. Between 2000 and 2005, we estimate...... that 1.75 million ha of forest were lost from protected areas in humid tropical forests, causing the emission of 0.25-0.33 Pg C. Protected areas lost about half as much carbon as the same area of unprotected forest. We estimate that the reduction of these carbon emissions from ongoing deforestation...... in protected sites in humid tropical forests could be valued at USD 6,200-7,400 million depending on the land use after clearance. This is >1.5 times the estimated spending on protected area management in these regions. Improving management of protected areas to retain forest cover better may be an important...

  5. Environmental consequences of intensive forest harvesting for bioenergy

    International Nuclear Information System (INIS)

    Dyck, W.J.; Maclaren, J.P.

    1994-01-01

    This paper examines environmental concerns regarding intensive forest harvesting, and outlines current knowledge. Site productivity and nutrient removal, site productivity and soil disturbance, and site preparation impacts are discussed. Biodiversity, off-site impacts, positive environmental impacts of intensive biomass harvesting, acid rain, climate change, estimating the carbon stored by a forest, site productivity research needs and application of models are discussed. (UK)

  6. Alabama, 2012 - forest inventory and analysis factsheet

    Science.gov (United States)

    Andrew J. Hartsell

    2013-01-01

    These early surveys were not concerned with the forests, species, and tree sizes that were not considered commercially viable. Early surveys reported only on growing-stock trees on timberlands, i.e. commercially important tree species and tree sizes on forests that could sustain harvest operations. Currently, FIA reports on all of the forest lands regardless of site...

  7. Site index determination techniques for southern bottomland hardwoods

    Science.gov (United States)

    Brian Roy Lockhart

    2013-01-01

    Site index is a species-specific indirect measure of forest productivity expressed as the average height of dominant and codominant trees in a stand of a specified base age. It is widely used by forest managers to make informed decisions regarding forest management practices. Unfortunately, forest managers have difficulty in determining site index for southern US...

  8. 78 FR 53726 - Notice of New Fee Site

    Science.gov (United States)

    2013-08-30

    ... DEPARTMENT OF AGRICULTURE Forest Service Notice of New Fee Site AGENCY: Monongahela National Forest, USDA Forest Service. ACTION: Notice of New Fee Site. SUMMARY: The Monongahela National Forest is... amenities. Fees for overnight use will be used for the continued operation and maintenance of Island...

  9. 78 FR 14960 - Notice of New Fee Site

    Science.gov (United States)

    2013-03-08

    ... DEPARTMENT OF AGRICULTURE Forest Service Notice of New Fee Site AGENCY: Kaibab National Forest, USDA Forest Service, Arizona. ACTION: Notice of New Fee Sites. SUMMARY: The Kaibab National Forest is proposing to charge fees for the overnight rental of three historic facilities on the North Kaibab Ranger...

  10. Determination of Dioxins in Soil Samples from industrial and burned forest sites in Syria Using an Enzyme Linked Immunosorbent Assay (ELIZA)

    International Nuclear Information System (INIS)

    Ghanem, I.; Orfi, M.; Abu-Alnaser, A.

    2013-01-01

    Sixty soil samples were collected from three industrial locations and burnt forest locution of Syria, namely, Banyas refinery and the Thermal Electricity Generation Station area (7 samples), Central factory area, Tartous (11 samples), AlFrunlok Forest, Lattakia (22 samples), Alwaer and Oil refinery area in Homs (20 samples) Dioxin presence in these samples was determined using a specific ELIZA Kit, Results indicate the absence of any detectable levels of Dioxins from any of the samples collected in Banyas refinery, Electricity Generation Station of Banyas, Central factory and the area of Hsain AlBaher, Mazrahat AlArous in Tartous. Likewise, all samples (22 samples) taken from AlFrunlok forest area were free of Dioxin contamination except the samples taken from the road to Nubu Issa, and Shahrura, where 8 samples (36.36%) and 6 samples (27.27%) contained concentration of Dioxin ranging between 5-15 and 15-25 PPT respectively. Results showed the presence of Dioxins in samples collected at AlWa-er area, Homs (17 sample) at high concentration in comparison with samples collected in other areas. Three of those samples (17.6%) and four samples (23.5%) contained Dioxins at levels ranging between 15-25 and 15-25 PPT respectively. (58.8%) of all samples (10 samples) collected in this area, contained Dioxins at levels exceeding the maximum level detectable by the ELIZA kit (i.e. 50 PPT). The results reported in the present study justify a follow up and detailed study in AlWa-er area. (author)

  11. Forest Resources

    Energy Technology Data Exchange (ETDEWEB)

    None

    2016-06-01

    Forest biomass is an abundant biomass feedstock that complements the conventional forest use of wood for paper and wood materials. It may be utilized for bioenergy production, such as heat and electricity, as well as for biofuels and a variety of bioproducts, such as industrial chemicals, textiles, and other renewable materials. The resources within the 2016 Billion-Ton Report include primary forest resources, which are taken directly from timberland-only forests, removed from the land, and taken to the roadside.

  12. Remote sensing based evapotranspiration and runoff modeling of agricultural, forest and urban flux sites in Denmark: From field to macro-scale

    DEFF Research Database (Denmark)

    Bøgh, E.; Poulsen, R.N.; Butts, M.

    2009-01-01

    representing agricultural, forest and urban land surfaces in physically based hydrological modeling makes it possible to reproduce much of the observed variability (48–73%) in stream flow (Q − Qb) when data and modeling is applied at an effective spatial resolution capable of representing land surface...... variability in eddy covariance latent heat fluxes. The “effective” spatial resolution needed to adopt local-scale model parameters for spatial-deterministic hydrological modeling was assessed using a high-spatial resolution (30 m) variogram analysis of the NDVI. The use of the NDVI variogram to evaluate land...

  13. CTFS-ForestGEO: a worldwide network monitoring forests in an era of global change

    Energy Technology Data Exchange (ETDEWEB)

    Anderson-Teixeira, Kristina J. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Smithsonian Conservation Biology Inst. (SCBI), Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Davies, Stuart J. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; National Museum of Natural History, Washington, DC (United States). Dept. of Botany; Bennett, Amy C. [Smithsonian Conservation Biology Inst. (SCBI), Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Gonzalez-Akre, Erika B. [Smithsonian Conservation Biology Inst. (SCBI), Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Muller-Landau, Helene C. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Joseph Wright, S. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Abu Salim, Kamariah [Univ. of Brunei Darussalam, Bandar Seri Begawan (Brunei). Faculty of Science. Environmental and Life Sciences; Almeyda Zambrano, Angélica M. [Smithsonian Conservation Biology Inst. (SCBI), Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Stanford Univ., CA (United States). Stanford Woods Inst. for the Environment; Univ. of Alabama, Tuscaloosa, AL (United States). Dept. of Geography; Alonso, Alfonso [Smithsonian Conservation Biology Inst., Washington, DC (United States). National Zoological Park. Center for Conservation Education and Sustainability; Baltzer, Jennifer L. [Wilfrid Laurier Univ., Waterloo, ON (Canada). Dept. of Biology; Basset, Yves [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Bourg, Norman A. [Smithsonian Conservation Biology Inst. (SCBI), Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Broadbent, Eben N. [Smithsonian Conservation Biology Inst. (SCBI), Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Stanford Univ., CA (United States). Stanford Woods Inst. for the Environment; Univ. of Alabama, Tuscaloosa, AL (United States). Dept. of Geography; Brockelman, Warren Y. [Mahidol Univ., Bangkok (Thailand). Dept. of Biology; Bunyavejchewin, Sarayudh [Dept. of National Parks, Wildlife and Plant Conservation, Bangkok (Thailand). Research Office; Burslem, David F. R. P. [Univ. of Aberdeen (United Kingdom). School of Biological Sciences; Butt, Nathalie [Univ. of Queensland, St. Lucia (Australia). School of Biological Sciences; Univ. of Oxford (United Kingdom). School of Geography and the Environment. Environmental Change Inst.; Cao, Min [Chinese Academy of Sciences (CAS), Kunming (China). Xishuangbanna Tropical Botanical Garden. Key Lab. of Tropical Forest Ecology; Cardenas, Dairon [Sinchi Amazonic Inst. of Scientific Research, Bogota (Colombia); Chuyong, George B. [Univ. of Buea (Cameroon). Dept. of Botany and Plant Physiology; Clay, Keith [Indiana Univ., Bloomington, IN (United States). Dept. of Biology; Cordell, Susan [USDA Forest Service, Hilo, HI (United States). Inst. of Pacific Islands Forestry; Dattaraja, Handanakere S. [Indian Inst. of Science, Bangalore (India). Centre for Ecological Sciences; Deng, Xiaobao [Chinese Academy of Sciences (CAS), Kunming (China). Xishuangbanna Tropical Botanical Garden. Key Lab. of Tropical Forest Ecology; Detto, Matteo [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Du, Xiaojun [Chinese Academy of Sciences (CAS), Beijing (China). Inst. of Botany; Duque, Alvaro [Univ. Nacional de Colombia, Medellin (Colombia). Dept. de Ciencias Forestales; Erikson, David L. [National Museum of Natural History, Washington, DC (United States). Dept. of Botany; Ewango, Corneille E. N. [Okapi Wildlife Reserve, Epulu (Democratic Republic of the Congo). Centre de Formation et de Recherche en Conservation Forestiere (CEFRECOF); Fischer, Gunter A. [Kadoorie Farm and Botanic Garden, Tai Po, Hong Kong (China); Fletcher, Christine [Forest Research Inst. Malaysia (FRIM), Selangor (Malaysia); Foster, Robin B. [The Field Museum, Chicago, IL (United States). Botany Dept.; Giardina, Christian P. [USDA Forest Service, Hilo, HI (United States). Inst. of Pacific Islands Forestry; Gilbert, Gregory S. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Univ. of California, Santa Cruz, CA (United States). Environmental Studies Dept.; Gunatilleke, Nimal [Univ. of Peradeniya (Sri Lanka). Faculty of Science. Dept. of Botany; Gunatilleke, Savitri [Univ. of Peradeniya (Sri Lanka). Faculty of Science. Dept. of Botany; Hao, Zhanqing [Chinese Academy of Sciences (CAS), Shenyang (China). State Key Lab. of Forest and Soil Ecology. Inst. of Applied Ecology; Hargrove, William W. [USDA-Forest Service Station Headquarters, Asheville, NC (United States). Eastern Forest Environmental Threat Assessment Center; Hart, Terese B. [Lukuru Wildlife Research Foundation, Kinshasa (Democratic Republic of the Congo). Tshuapa-Lomami-Lualaba Project; Hau, Billy C. H. [Univ. of Hong Kong (China). School of Biological Sciences. Kadoorie Inst.; He, Fangliang [Univ. of Alberta, Edmonton, AB (Canada). Dept. of Renewable Resources; Hoffman, Forrest M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Computational Earth Sciences Group; Howe, Robert W. [Univ. of Wisconsin, Green Bay, WI (United States). Dept. of Natural and Applied Sciences; Hubbell, Stephen P. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Univ. of California, Los Angeles, CA (United States). Dept. of Ecology and Evolutionary Biology; Inman-Narahari, Faith M. [Univ. of Hawaii, Honolulu, HI (United States). College of Tropical Agriculture and Human Resources; Jansen, Patrick A. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Wageningen Univ. (Netherlands). Resource Ecology Group; Jiang, Mingxi [Chinese Academy of Sciences (CAS), Wuhan (China). Wuhan Botanical Garden; Johnson, Daniel J. [Indiana Univ., Bloomington, IN (United States). Dept. of Biology; Kanzaki, Mamoru [Kyoto Univ. (Japan). Graduate School of Agriculture; Kassim, Abdul Rahman [Forest Research Inst. Malaysia (FRIM), Selangor (Malaysia); Kenfack, David [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; National Museum of Natural History, Washington, DC (United States). Dept. of Botany; Kibet, Staline [National Museums of Kenya, Nairobi (Kenya); Univ. of Nairobi (Kenya). Land Resource Management and Agricultural Technology Dept.; Kinnaird, Margaret F. [Mpala Research Centre, Nanyuki (Kenya); Wildlife Conservation Society, New York, NY (United States). Global Conservation Programs; Korte, Lisa [Smithsonian Conservation Biology Inst., Washington, DC (United States). National Zoological Park. Center for Conservation Education and Sustainability; Kral, Kamil [Silva Tarouca Research Inst., Brno (Czech Republic). Dept. of Forest Ecology; Kumar, Jitendra [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Computational Earth Sciences Group; Larson, Andrew J. [Univ. of Montana, Missoula, MT (United States). College of Forestry and Conservation. Dept. of Forest Management; Li, Yide [Chinese Academy of Forestry, Guangzhou (China). Research Inst. of Tropical Forestry; Li, Xiankun [Chinese Academy of Sciences (CAS), Guilin (China). Guangxi Inst. of Botany; Liu, Shirong [Chinese Academy of Forestry, Beijing (China). Research Inst. of Forest Ecology, Environment and Protection; Lum, Shawn K. Y. [Nanyang Technological Univ. (Singapore). National Inst. of Education. Natural Sciences and Science Education Academic Group; Lutz, James A. [Utah State Univ., Logan, UT (United States). Wildland Resources Dept.; Ma, Keping [Chinese Academy of Sciences (CAS), Beijing (China). Inst. of Botany; Maddalena, Damian M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Computational Earth Sciences Group; Makana, Jean-Remy [Wildlife Conservation Society, Brazzaville (Democratic Republic of the Congo); Malhi, Yadvinder [Univ. of Oxford (United Kingdom). School of Geography and the Environment. Environmental Change Inst.; Marthews, Toby [Univ. of Oxford (United Kingdom). School of Geography and the Environment. Environmental Change Inst.; Mat Serudin, Rafizah [Univ. of Brunei Darussalam, Bandar Seri Begawan (Brunei). Faculty of Science. Environmental and Life Sciences; McMahon, Sean M. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Smithsonian Environmental Research Center, Edgewater, MD (United States). Forest Ecology Group; McShea, William J. [Smithsonian Conservation Biology Inst., Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Memiaghe, Hervé R. [Inst. de Recherche en Ecologie Tropicale, Libreville (Gabon). Centre National de la Recherche Scientifique et Technologique; Mi, Xiangcheng [Chinese Academy of Sciences (CAS), Beijing (China). Inst. of Botany; Mizuno, Takashi [Kyoto Univ. (Japan). Graduate School of Agriculture; Morecroft, Michael [Natural England, Sheffield (United Kingdom); Myers, Jonathan A. [Washington Univ., St. Louis, MO (United States). Dept. of Biology; Novotny, Vojtech [New Guinea Binatang Research Centre, Madang (Papua New Guinea); Univ. of South Bohemia, Ceske Budejovice (Czech Republic). Academy of Sciences of the Czech Republic. Faculty of Science. Biology Centre; de Oliveira, Alexandre A. [Univ. of Sao Paulo (Brazil). Inst. of Biosciences. Ecology Dept.; Ong, Perry S. [Univ. of the Philippines Diliman, Quezon City (Philippines). Inst. of Biology; Orwig, David A. [Harvard Univ., Petersham, MA (United States). Harvard Forest; Ostertag, Rebecca [Univ. of Hawaii, Hilo, HI (United States). Dept. of Biology; den Ouden, Jan [Wageningen Univ. (Netherlands). Forest Ecology and Forest Management Group; Parker, Geoffrey G. [Smithsonian Environmental Research Center, Edgewater, MD (United States). Forest Ecology Group; Phillips, Richard P. [Indiana Univ., Bloomington, IN (United States). Dept. of Biology; Sack, Lawren [Univ. of California, Los Angeles, CA (United States). Dept. of Ecology and Evolutionary Biology; Sainge, Moses N. [Tropical Plant Exploration Group (TroPEG), Mundemba (Cameroon); Sang, Weiguo [Chinese Academy of Sciences (CAS), Beijing (China). Inst. of Botany; Sri-ngernyuang, Kriangsak [Maejo Univ., Chiang Mai (Thailand). Faculty of Architecture and Environmental Design; Sukumar, Raman [Indian Inst. of Science, Bangalore (India). Centre for Ecological Sciences; Sun, I-Fang [National Dong Hwa Univ., Hualian (Taiwan). Dept. of Natural Resources and Environmental Studies; Sungpalee, Witchaphart [Maejo Univ., Chiang Mai (Thailand). Faculty of Architecture and Environmental Design; Suresh, Hebbalalu Sathyanarayana [Indian Inst. of Science, Bangalore (India). Centre for Ecological Sciences; Tan, Sylvester [Sarawak Forest Dept., Kuching (Malaysia); Thomas, Sean C. [Univ. of Toronto, ON (Canada). Faculty of Forestry; Thomas, Duncan W. [Washington State Univ., Vancouver, WA (United States). School of Biological Sciences; Thompson, Jill [Centre for Ecology and Hydrology, Penicuik, Scotland (United Kingdom); Univ. of Puerto Rico Rio Pedras, San Juan (Puerto Rico). Dept. of Environmental Science. Inst. for Tropical Ecosystem Studies; Turner, Benjamin L. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Uriarte, Maria [Columbia Univ., New York, NY (United States). Dept. of Ecology, Evolution and Environmental Biology; Valencia, Renato [Pontifical Catholic Univ. of Ecuador, Quito (Ecuador). Dept. of Biological Sciences; Vallejo, Marta I. [Inst. Alexander von Humboldt, Bogota (Colombia); Vicentini, Alberto [National Inst. of Amazonian Research (INPA), Manaus (Brazil); Vrška, Tomáš [Silva Tarouca Research Inst., Brno (Czech Republic). Dept. of Forest Ecology; Wang, Xihua [East China Normal Univ. (ECNU), Shanghai (China). School of Ecological and Environmental Sciences; Wang, Xugao [Lukuru Wildlife Research Foundation, Kinshasa (Democratic Republic of the Congo). Tshuapa-Lomami-Lualaba Project; Weiblen, George [Univ. of Minnesota, St. Paul, MN (United States). Dept. of Plant Biology; Wolf, Amy [Univ. of Wisconsin, Green Bay, WI (United States). Dept. of Biology. Dept. of Natural and Applied Sciences; Xu, Han [Chinese Academy of Forestry, Guangzhou (China). Research Inst. of Tropical Forestry; Yap, Sandra [Univ. of the Philippines Diliman, Quezon City (Philippines). Inst. of Biology; Zimmerman, Jess [Univ. of Puerto Rico Rio Piedras, San Juan (Puerto Rico). Dept. of Environmental Science. Inst. for Tropical Ecosystem Studies

    2014-09-25

    Global change is impacting forests worldwide, threatening biodiversity and ecosystem services, including climate regulation. Understanding how forests respond is critical to forest conservation and climate protection. This review describes an international network of 59 long-term forest dynamic research sites useful for characterizing forest responses to global change. The broad suite of measurements made at the CTFS-ForestGEO sites make it possible to investigate the complex ways in which global change is impacting forest dynamics. ongoing research across the network is yielding insights into how and why the forests are changing, and continued monitoring will provide vital contributions to understanding worldwide forest diversity and dynamics in a era of global change

  14. Site properties have a stronger influence than fire severity on ectomycorrhizal fungi and associated N-cycling bacteria in regenerating post-beetle-killed lodgepole pine forests.

    Science.gov (United States)

    Kennedy, Nabla M; Robertson, Susan J; Green, D Scott; Scholefield, Scott R; Arocena, Joselito M; Tackaberry, Linda E; Massicotte, Hugues B; Egger, Keith N

    2015-09-01

    Following a pine beetle epidemic in British Columbia, Canada, we investigated the effect of fire severity on rhizosphere soil chemistry and ectomycorrhizal fungi (ECM) and associated denitrifying and nitrogen (N)-fixing bacteria in the root systems of regenerating lodgepole pine seedlings at two site types (wet and dry) and three fire severities (low, moderate, and high). The site type was found to have a much larger impact on all measurements than fire severity. Wet and dry sites differed significantly for almost all soil properties measured, with higher values identified from wet types, except for pH and percent sand that were greater on dry sites. Fire severity caused few changes in soil chemical status. Generally, bacterial communities differed little, whereas ECM morphotype analysis revealed ectomycorrhizal diversity was lower on dry sites, with a corresponding division in community structure between wet and dry sites. Molecular profiling of the fungal ITS region confirmed these results, with a clear difference in community structure seen between wet and dry sites. The ability of ECM fungi to colonize seedlings growing in both wet and dry soils may positively contribute to subsequent regeneration. We conclude that despite consecutive landscape disturbances (mountain pine beetle infestation followed by wildfire), the "signature" of moisture on chemistry and ECM community structure remained pronounced.

  15. İmar Meclisi Raporlarında Borçlanma ve Selem Uygulaması (1845-1846 / Borrowing and Selem Practices in Ottoman Era According to "Macalis Imariyya (Development Counsils" Reports

    Directory of Open Access Journals (Sweden)

    Tahir Bilirli

    2016-06-01

    Full Text Available İmar Meclisi Raporlarında Borçlanma ve Selem Uygulaması (1845-1846 Öz Bu makale, Osmanlı Devleti'nde 1845 yılında ilan edilen Tensikât-ı mülkiye kararı çerçevesinde geçici olarak olarak kurulan İmar Meclisleri'nin görevlerini incelemektedir. Makalede, bu meclislerin özellikle halkın borç para alma durumları ile selem usulü denilen mahsulün hasattan önce satılması konusundaki faaliyetleri incelenmektedir. Hasat zamanından önce alınan vergi, ahaliyi borçlanmaya yöneltmekte, bu da halkın fahiş faiz oranlarıyla tefecilerden borç almalarına ve ürünün hasat edilmeden önce daha düşük fiyatlara satılmasına sebep olmaktaydı. Bu durum gelir kaybı nedeniyle hem tebaya hem de devlete zarar vermekteydi. İmar Meclisi memurları yaşanan bu sıkıntının giderilmesi noktasında yerinde durum tespiti yapmışlardır. Makalenin birinci bölümünde İmar Meclisleri'nin kuruluşu ve görevleri hakkında bilgi verilmektedir. İkinci bölümde makalenin ana konusu olan borçlanma ve selem usulünün uygulanmasının meclis raporlarına nasıl yansıdığı arşiv belgelerine göre ele alınmıştır. Makalenin sonuç bölümünde arşiv belgelerinde elde edilen veriler doğrultusunda değerlendirme yapılmıştır. Borrowing and Selem Practices in Ottoman Era According to "Macalis Imariyya (Development Counsils" Reports Abstract This article examines the mission of Macalis Imariyya (Develepment Counsils which were founded by the decree of Tankisat al-Mulkiyye declared in 1845. In the article, the activity of these Counsils about the indebtedness status of the people and the selling of products before the harvest -called “selem”- particularly examined. The tax collection before harvest period was impelling the people borrowing from usurers with excessive interest rates and to sell the product at nearly half price. This case was damaging both the state and the citizens because of income loss. Development Council

  16. WAsP in the forest

    DEFF Research Database (Denmark)

    Dellwik, Ebba; Landberg, Lars; Jensen, Niels Otto

    2005-01-01

    This article compares mean wind estimates from a WAsP analysis for three forest sites and one site near a forest with measurements taken at the sites. By standard WAsP settings for forest, the mean wind speed at the sites was overestimated. Agreement between the estimates and the measurements...... improved significantly if displacement height and roughness length as calculated from the forest mast data were used or if a simple model estimate of roughness length and displacement height based on stand density (frontal area index) was used. The two estimates of displacement height and roughness length...... (mast data and simple model) did not agree well with each other. One reason for this may be that all evaluated sites are windy and that both d and z0 depend on the wind speed. All analysed forest sites are dense, in which case the influence from the roughness sublayer is limited and the effect on mean...

  17. Combining forest inventory, satellite remote sensing, and geospatial data for mapping forest attributes of the conterminous United States

    Science.gov (United States)

    Mark Nelson; Greg Liknes; Charles H. Perry

    2009-01-01

    Analysis and display of forest composition, structure, and pattern provides information for a variety of assessments and management decision support. The objective of this study was to produce geospatial datasets and maps of conterminous United States forest land ownership, forest site productivity, timberland, and reserved forest land. Satellite image-based maps of...

  18. Forest production dynamics along a wood density spectrum in eastern US forests

    Science.gov (United States)

    C.W. Woodall; M.B. Russell; B.F. Walters; A.W. D' Amato; K. Zhu; S.S. Saatchi

    2015-01-01

    Emerging plant economics spectrum theories were confirmed across temperate forest systems of the eastern US where the use of a forest stand's mean wood density elucidated forest volume and biomass production dynamics integrating aspects of climate, tree mortality/growth, and rates of site occupancy.

  19. Management impacts on forest floor and soil organic carbon in northern temperate forests of the US

    Science.gov (United States)

    Coeli M. Hoover

    2011-01-01

    The role of forests in the global carbon cycle has been the subject of a great deal of research recently, but the impact of management practices on forest soil dynamics at the stand level has received less attention. This study used six forest management experimental sites in five northern states of the US to investigate the effects of silvicultural treatments (light...

  20. The experimental design of the Missouri Ozark Forest Ecosystem Project

    Science.gov (United States)

    Steven L. Sheriff; Shuoqiong. He

    1997-01-01

    The Missouri Ozark Forest Ecosystem Project (MOFEP) is an experiment that examines the effects of three forest management practices on the forest community. MOFEP is designed as a randomized complete block design using nine sites divided into three blocks. Treatments of uneven-aged, even-aged, and no-harvest management were randomly assigned to sites within each block...

  1. What really separates us? Survey of attitudes of young people in the cities of Kikinda (Vojvodina, Nis, Bor (South and East Serbia, and Pristina, Pec, Prizren (Kosovo

    Directory of Open Access Journals (Sweden)

    Bašić Goran

    2014-01-01

    Full Text Available The results of the survey point to a high level of agreement among youth aged between 15 and 25 years of age, high school and college students, employed and unemployed youth, men and women in the cities of Pec, Pristina, Prizren in Kosovo, and Bor, Kikinda, and Nis in Serbia, on whether the question of mutual cooperation is burdened by prejudice and events from the past, and that the possibility and the quality of cooperation is influenced by the attitudes the receive in their primary social groups such as families and peers, and also by the attitudes they receive through education and media. At the same time, the possibilities to influence the social and political change aren’t big, and the youth have no desire to take the concrete civic or political initiatives. A certain perspective in cooperation the youth see in the European constellation and the good quality education. However, youth on both sides are not open to more intensive mutual meetings - the majority would not either host peers from the other communities gladly, nor they would respond to their invitation of hosting. They are not interested in cultural values of one another, but they do think respect of human rights should be guaranteed and they are ready for toleration of differences. The necessity of youth cooperation is important for overcoming the problems that citizens of Kosovo and Serbia are facing when it comes to exercising numerous rights, which from the perspective of individual freedoms collide with the concept of state reasons and "higher" interests. The regional stability depends on overcoming the issues that governments in Serbia and Kosovo have concerning Kosovo’s status, and also from setting a network of individual and group relations among the citizens. Youth should be the carriers of social and cultural changes. In the stated attitudes there is no direct objection to such processes, but fear of changes is clearly expressed because indirectly it can be

  2. Utilización de una nueva materia prima borácica para la formulación de esmaltes

    Directory of Open Access Journals (Sweden)

    Gómez-Tena, M. P.

    2010-10-01

    contenido en B2O3 entre un 10-11 % en peso. Es en gran parte amorfo, siendo el cuarzo la fase cristalina presente de forma mayoritaria. Características tales, como presentar una baja solubilidad y formar fácilmente fase vítrea, hace que sea posible utilizar el nuevo borato, como materia prima en composiciones de esmalte. Su aptitud para la formulación de esmaltes, ha sido el resultado de varios años de investigación en colaboración con el Instituto de Tecnología Cerámica. En este trabajo se ha estudiado la viabilidad de fabricar esmaltes cerámicos haciendo uso de una nueva materia prima borácica sintética, la cual permite aportar boro a la composición de los esmaltes sin necesidad de hacerlo en forma fritada. Se ha podido obtener vidriados con similares características técnicas y estéticas que los obtenidos a partir de esmaltes de uso industrial que contienen fritas típicas en su composición, por lo que resulta posible formular esmaltes mediante el empleo de la nueva materia prima de boro sintética. De los resultados se deriva, que la utilización de esta nueva materia prima (E-4972 es especialmente adecuada para la obtención de vidriados de bajo brillo a elevada temperatura.

  3. Meteorological effects on Hg wet deposition in a forested site in the Adirondack region of New York during 2000-2015

    Science.gov (United States)

    Mao, Huiting; Ye, Zhuyun; Driscoll, Charles

    2017-11-01

    An analysis of weekly measurement data of mercury (Hg) wet deposition was conducted for Huntington Wildlife Forest (HWF), a forest ecosystem in Upstate New York and a biological Hg hotspot, during 2000-2015. Annual accumulated Hg wet deposition flux was found to decrease at a rate of -0.13 μg m-2 yr-1 (2% yr-1) (p = 0.09), and volume weighted mean (VWM) Hg precipitation concentrations at -0.14 ng L-1 yr-1 (2.5% yr-1) (p = 0.00). In examining data by season, no trends were identified for the two variables. It was found that the North Atlantic Oscillation (NAO) affected Hg wet deposition predominantly in spring, as did the position of the U.S. East Coast trough in summer, which suggests different dominant mechanisms driving Hg wet deposition in different seasons. The impacts of such large scale circulation processes were facilitated via variations in precipitation amounts. This was manifested in spring 2011 with the strongest positive phase of NAO, resulting in the wettest spring with the largest Hg wet deposition flux, and in summer 2007 with the U.S. East Coast trough positioned the farthest out over the Atlantic Ocean, causing the driest summer with the lowest Hg wet deposition flux of the study period. Extreme precipitation amounts in spring could singularly drive the overall long-term trend in Hg wet deposition whereas in summer other factors could just be as important. Similar mechanisms were thought to control the long term variations of Hg wet deposition and precipitation concentrations in all seasons but summer as indicated in their significant correlation in all but summer. Atmospheric concentrations of gaseous oxidized mercury (GOM) and particulate borne mercury (PBM) at HWF over 2009-2015 hardly exhibited correlations with Hg wet deposition or precipitation concentrations. Chemical transport model simulations strongly supported efficient scavenging of oxidized Hg by precipitation resulting in the lowest concentration of GOM in the warm season despite the

  4. Identification of a novel EYA1 splice-site mutation in a Danish branchio-oto-renal syndrome family

    DEFF Research Database (Denmark)

    Henriksen, Ann Marie; Tümer, Zeynep; Tommerup, Niels

    2004-01-01

    Branchio-oto-renal (BOR) syndrome is an autosomal dominant disorder characterized by variable clinical manifestations including branchial fistulae, preauricular pits, ear malformations, hearing impairment, and renal anomalies. BOR is caused by mutations in the genes EYA1 and SIX1. A Danish BOR...

  5. Disturbing forest disturbances

    Energy Technology Data Exchange (ETDEWEB)

    Volney, W.J.A.; Hirsch, K.G. [Natural Resources Canada, Canadian Forest Service, Northern Forestry Centre, Edmonton, AB (Canada)

    2005-10-01

    This paper described the role that disturbances play in maintaining the ecological integrity of Canadian boreal forests. Potential adaptation options to address the challenges that these disturbances present were also examined. Many forest ecosystems need fire for regeneration, while other forests rely on a cool, wet disintegration process driven by insects and commensal fungi feeding on trees to effect renewal. While there are characteristic natural, temporal and spatial patterns to these disturbances, recent work has demonstrated that the disturbances are being perturbed by climatic change that has been compounded by anthropogenic disturbances in forests. Fire influences species composition and age structure, regulates forest insects and diseases, affects nutrient cycling and energy fluxes, and maintains the productivity of different habitats. Longer fire seasons as a result of climatic change will lead to higher intensity fires that may more easily evade initial attacks and become problematic. Fire regimes elevated beyond the range of natural variation will have a dramatic effect on the regional distribution and functioning of forest ecosystems and pose a threat to the safety and prosperity of people. While it was acknowledged that if insect outbreaks were to be controlled on the entire forest estate, the productivity represented by dead wood would be lost, it was suggested that insects such as the forest tent caterpillar and the spruce bud worm may also pose a greater threat as the climate gets warmer and drier. Together with fungal associates, saproxylic arthropods are active in nutrient cycling and ultimately determine the fertility of forest sites. It was suggested that the production of an age class structure and forest mosaic would render the forest landscape less vulnerable to the more negative aspects of climate change on vegetation response. It was concluded that novel management design paradigms are needed to successfully reduce the risk from threats

  6. Production potential and stability of a broadleaved mixed oak/hornbeam forest stand situated on a eutrophic site, Ždánický les

    Directory of Open Access Journals (Sweden)

    Václav Hurt

    2012-01-01

    Full Text Available The paper focuses on assessing the growth and production of a mixed oak/hornbeam forest stand established by combined regeneration in 1940 to 1942. The stand is situated at an altitude of 460 m. Since 1961, it is left to its natural development. The 25–year–old stand was characterized as an individually mixed, both diameter- and height-differentiated pole-stage stand. The proportion of tree species was as follows: sessile oak 77 %, hornbeam 19 %, birch 1 %, lime 1 %, black poplar 1 %, wild cherry tree, wild service tree, and field maple. During 41 years of measurements, the proportion of oak slightly decreased to 76 %, on the other hand, the proportion of hornbeam increased to 22%. The initial growing stock of the 25–year–old stand, 75 m3.ha−1, increased to 323 m3.ha−1 at an age of 66 years in 2008. At present, current volume increment ranged between 6.3 m3.ha−1.year−1 and 11.6 m3.ha−1.year−1 during years 1967 and 1998. Since the age of 61, the growth of the stand has decreased and then even ceased due to increased mortality of oak.

  7. REGULATION OF CARBON SEQUESTRATION AND WATER USE IN A OZARK FOREST: PROPOSING A NEW STRATEGICALLY LOCATED AMERIFLUX TOWER SITE IN MISSOURI

    Energy Technology Data Exchange (ETDEWEB)

    Pallardy, Stephen G

    2013-04-19

    by June 14, 2004, the MOFLUX site was fully instrumented and data streams started to flow. A primary accomplished deliverable for the project period was the data streams of CO{sub 2} and water vapor fluxes and numerous meteorological variables (from which prepared datasets have been submitted to the AmeriFlux data archive for 2004-2006, Additionally, measurements of leaf biochemistry and physiology, biomass inventory, tree allometry, successional trends other variables were obtained.

  8. Impact of Forest Harvesting and Forest Regeneration on Runoff Dynamics at Watersheds of Central Siberia

    Directory of Open Access Journals (Sweden)

    A. A. Onuchin

    2014-02-01

    Full Text Available In the paper disturbance of Angara river region forests were estimated and peculiarities of forest regeneration after logging and wild fires were analyzed. According to the landscape classification of the regional study, three groups of landscapes differencing on types of forest successions were developed. It was shown that water protective and water regulate functions of the Angara river region forests change under commercial forest harvesting. Comparisons of the inventory and hydrological data detected that hydrological consequences of commercial forest harvesting are dependent on climatic parameters and forest regeneration peculiarities. In the continental climate conditions, when forest regeneration is delayed, snow storms are more active, snow evaporation increases and runoff reduces. In the process of logging sites overgrown with secondary small-leaved forest, snow accumulation increases and runoff increases, exceeding the value of annual runoff at undisturbed watersheds.

  9. Evaluating forest land development effects on private forestry in eastern Oregon.

    Science.gov (United States)

    Jeffrey D. Kline; David L. Azuma

    2007-01-01

    Research suggests that forest land development can reduce the productivity of remaining forest land because private forest owners reduce their investments in forest management. We developed empirical models describing forest stocking, thinning, harvest, and postharvest tree planting in eastern Oregon, as functions of stand and site characteristics, ownership, and...

  10. Texas' forests, 2008

    Science.gov (United States)

    James W. Bentley; Consuelo Brandeis; Jason A. Cooper; Christopher M. Oswalt; Sonja N. Oswalt; KaDonna Randolph

    2014-01-01

    This bulletin describes forest resources of the State of Texas at the time of the 2008 forest inventory. This bulletin addresses forest area, volume, growth, removals, mortality, forest health, timber product output, and the economy of the forest sector.

  11. Forest resources of the Lincoln National Forest

    Science.gov (United States)

    John D. Shaw

    2006-01-01

    The Interior West Forest Inventory and Analysis (IWFIA) program of the USDA Forest Service, Rocky Mountain Research Station, as part of its national Forest Inventory and Analysis (FIA) duties, conducted forest resource inventories of the Southwestern Region (Region 3) National Forests. This report presents highlights of the Lincoln National Forest 1997 inventory...

  12. The Wahluke (North) Slope of the Hanford Site: History and present challenges

    International Nuclear Information System (INIS)

    Gerber, M.S.

    1996-01-01

    The Hanford Site was founded in early 1943 for the top secret government mission of producing plutonium for the world's first atomic weapons. A great deal of land was needed, both to separate various Site facilities from each other, and to provide buffer zones for safety and security purposes. In total, 640 square miles were occupied by the original Hanford Site and its buffer zones. Much of this land had been earmarked for inclusion in the Columbia Basin Irrigation Project (CBP). After World War II ended, a series of national decisions led to a long-term mission for the Hanford Site, and area residents learned that the Site lands they had hoped to farm would be withheld from agricultural production for the foreseeable future. A long set of negotiations commenced between the federal management agency responsible for Hanford (the Atomic Energy Commission -- AEC), and the Bureau of Reclamation (BOR), Department of the Interior that managed the CBP. Some lands were turned back to agriculture, and other compromises made, in the Site's far northern buffer lands known as the Wahluke Slope, during the 1950s. In the mid-1960s, further negotiations were about to allow farming on lands just north of the Columbia River, opposite Hanford's reactors, when studies conducted by the BOR found drainage barriers to irrigation. As a result of these findings, two wildlife refuges were created on that land in 1971. Today, after the Hanford Site plutonium production mission has ended and as Site cleanup goes forward, the possibility of total release of Wahluke Slope lands from the control of the Department of Energy (DOE -- a successor agency to the AEC) is under discussion. Such discussion encompasses not just objective and clearly visible criteria, but it resurrects historical debates about the roles of farming and government presence in the Columbia Basin

  13. Eddy covariance fluxes of the NO-O3-NO2 triad above the forest canopy at the ATTO Site in the Amazon Basin

    Science.gov (United States)

    Tsokankunku, Anywhere; Wolff, Stefan; Sörgel, Matthias; Berger, Martina; Zelger, Michael; Dlugi, Ralf

    2017-04-01

    Nitrogen monoxide (NO) and nitrogen dioxide (NO2) (denoted together as NOx) determine the abundance of the tropospheric oxidants OH, O3 and NO3 that regulate atmospheric self-cleaning. The three reactive trace gases NO, NO2 and O3 undergo a series of interconnected photochemical reactions and are often referred to as the NO-O3-NO2 triad. Ozone deposition is mainly controlled by stomatal uptake, thus contributes to oxidative stress for the plants. Similarly, nitrogen dioxide from above or below the canopy is deposited to leaves through stomatal uptake. NO emissions from soils contribute to above canopy O3 formation and accelerate OH recycling. Therefore, quantification of the exchange fluxes of these species between the atmosphere and the biosphere are important for atmospheric chemistry and ecosystem research as well. The eddy covariance method is state of the art for direct measurements of ecosystem fluxes of trace gases. Eddy covariance measurements of NOx in pristine environments are rare because of lack of availability of instruments with the required precision to resolve concentrations characteristic of these environments. The Amazon Tall Tower Observatory (ATTO) is located in a pristine rainforest environment in the Amazon basin about 150 km northeast of the city of Manaus. It is the ideal site for studying the biosphere-atmosphere exchange of the NO-O3-NO2 triad, being largely undisturbed by anthropogenic sources. During an intensive measurement campaign in November 2015 at the ATTO site, measurements of NO, NO2 and O3 were carried out at 42 m above ground level on the 80 m walk-up tower with a fast (5 Hz) and sensitive (radiation. Vertical concentration profile measurements of NO, NO2 and O3 were available at 8 levels on the INSTANT tower from a reactive trace gas profile system which has been operational at the site since 2012. From these measurements, we present eddy covariance fluxes of the NO-O3-NO2 triad. We relate the fluxes to the canopy

  14. Status of Irradiation Control of Insects in Grain; Radiodesinsection des Cereales; Sostoyanie bor'by s hasekomymi-vreditelyami zerna putem oblucheniya; Radiodesinsectacion de Cereales Almacenados

    Energy Technology Data Exchange (ETDEWEB)

    Cornwell, P. B. [Rentokil Laboratories Ltd., East Grinstead, Sussex (United Kingdom)

    1966-11-15

    comestibilidad de los granos irradiados indican que estos no pierden propiedades nutritivas, lo que ha dado lugar a que en los Estados Unidos se autorizara el consumo humano del trigo irradiado y de sus productos. Consideraciones de orden tecnico indican que, en los grandes centros de exportacion o almacenamiento de granos, la irradiacion puede competir economicamente con los metodos quimicos. Una vez establecido que el almacenamiento en grandes cantidades y los sistemas automaticos de transporte son los procedimientos mas rapidos y economicos para hacer llegar el grano a los consumidores, se puede predecir con bastante seguridad que en un futuro no muy lejano la irradiacion constituira una de las etapas del proceso de distribucion del grano. En la memoria se informa sobre algunos de los problemas que plantea la infestacion y se expone la forma en que la distribucion esta organizada en diversos paises a fin de ilustrar las ventajas que encierra la irradiacion para el tratamiento de granos en una escala internacional. (author) [Russian] Issledovanija v oblasti primenenija ionizirujushhego izluchenija dlja bor'by s naseko- mymi-vrediteljami hranimyh na skladah pishhevyh produktov prodemonstrirovali tehnicheskuju osushhestvimost' obluchenija dlja obrabotki zerna. Issledovanija v oblasti radiacionnoj jetimologii vyjavili porazhaemost' glavnyh nasekomyh-vreditelej skladirovannogo zerna i ustanovili prostranstvo, v predelah kotorogo faktory okruzhajushhej sredy mogut vlijat' na dejstvennost' obrabotki. Issledovanija himicheskih i fizicheskih svojstv obluchennogo zerna pokazali otsutstvie kakogo-libo vrednogo vozdejstvija na organolepticheskie svojstva i svojstva, otnosjashhiesja k processu izgotovlenija pri obluchenii dozami, trebujushhimisja dlja dezinfekcii. Raboty nad voprosami, otnosjashhimisja k sohraneniju pitatel'nyh i vkusovyh kachestv obluchennogo zerna pokazali otsutstvie poter' pitatel'nyh svojstv, chto imelo re zul'tatom vydachu razreshenija v SShA na ispol'zovanie v

  15. Birds in Anthropogenic Landscapes: The Responses of Ecological Groups to Forest Loss in the Brazilian Atlantic Forest.

    Directory of Open Access Journals (Sweden)

    José Carlos Morante-Filho

    Full Text Available Habitat loss is the dominant threat to biodiversity and ecosystem functioning in terrestrial environments. In this study, we used an a priori classification of bird species based on their dependence on native forest habitats (forest-specialist and habitat generalists and specific food resources (frugivores and insectivores to evaluate their responses to forest cover reduction in landscapes in the Brazilian Atlantic Forest. From the patch-landscapes approach, we delimited 40 forest sites, and quantified the percentage of native forest within a 2 km radius around the center of each site (from 6 - 85%. At each site, we sampled birds using the point-count method. We used a null model, a generalized linear model and a four-parameter logistic model to evaluate the relationship between richness and abundance of the bird groups and the native forest amount. A piecewise model was then used to determine the threshold value for bird groups that showed nonlinear responses. The richness and abundance of the bird community as a whole were not affected by changes in forest cover in this region. However, a decrease in forest cover had a negative effect on diversity of forest-specialist, frugivorous and insectivorous birds, and a positive effect on generalist birds. The species richness and abundance of all ecological groups were nonlinearly related to forest reduction and showed similar threshold values, i.e., there were abrupt changes in individuals and species numbers when forest amount was less than approximately 50%. Forest sites within landscapes with forest cover that was less than 50% contained a different bird species composition than more extensively forested sites and had fewer forest-specialist species and higher beta-diversity. Our study demonstrated the pervasive effect of forest reduction on bird communities in one of the most important hotspots for bird conservation and shows that many vulnerable species require extensive forest cover to persist.

  16. Birds in Anthropogenic Landscapes: The Responses of Ecological Groups to Forest Loss in the Brazilian Atlantic Forest.

    Science.gov (United States)

    Morante-Filho, José Carlos; Faria, Deborah; Mariano-Neto, Eduardo; Rhodes, Jonathan

    2015-01-01

    Habitat loss is the dominant threat to biodiversity and ecosystem functioning in terrestrial environments. In this study, we used an a priori classification of bird species based on their dependence on native forest habitats (forest-specialist and habitat generalists) and specific food resources (frugivores and insectivores) to evaluate their responses to forest cover reduction in landscapes in the Brazilian Atlantic Forest. From the patch-landscapes approach, we delimited 40 forest sites, and quantified the percentage of native forest within a 2 km radius around the center of each site (from 6 - 85%). At each site, we sampled birds using the point-count method. We used a null model, a generalized linear model and a four-parameter logistic model to evaluate the relationship between richness and abundance of the bird groups and the native forest amount. A piecewise model was then used to determine the threshold value for bird groups that showed nonlinear responses. The richness and abundance of the bird community as a whole were not affected by changes in forest cover in this region. However, a decrease in forest cover had a negative effect on diversity of forest-specialist, frugivorous and insectivorous birds, and a positive effect on generalist birds. The species richness and abundance of all ecological groups were nonlinearly related to forest reduction and showed similar threshold values, i.e., there were abrupt changes in individuals and species numbers when forest amount was less than approximately 50%. Forest sites within landscapes with forest cover that was less than 50% contained a different bird species composition than more extensively forested sites and had fewer forest-specialist species and higher beta-diversity. Our study demonstrated the pervasive effect of forest reduction on bird communities in one of the most important hotspots for bird conservation and shows that many vulnerable species require extensive forest cover to persist.

  17. Monitoring of Slovakian forests, Report of Forest Focus and CMS Forest, 2006

    International Nuclear Information System (INIS)

    Pavlenda, P.; Durkovicova, J.; Istona, J.; Leontovyc, R.; Longauerova, V.; Mindas, J.; Pajtik, J.; Priwitzer, T.; Rasi, R.; Stancikova, A.; Tothova, S.; Stancikova, A.; Tothova, S.; Vodalova, A.

    2007-01-01

    The report presents current information and results from monitoring of forest issues ecosystems. The results of a survey of defoliation and plant health status, crowns and pest factors on permanent observation areas are summarized. In addition to data from representative network of sites, data from areas of intensive monitoring are analyzed, related to air quality and atmospheric deposition, soil solution, gain, lose surveys, vegetation, phonologic observations and soil moisture regime in 2006 and 2005, respectively. In connection with other activities under the Forest Focus scheme also the basic information about Forest Fire in Slovakia and the demonstration project BioSoil are included.

  18. Eddy Covariance Fluxes of the NO-O3-NO2 Triad above the Forest Canopy at the ATTO Site in the Amazon Basin

    Science.gov (United States)

    Tsokankunku, A.; Wolff, S.; Berger, M.; Zelger, M.; Dlugi, R. J. W.; Andreae, M. O.; Sörgel, M.

    2017-12-01

    Nitrogen monoxide (NO) and nitrogen dioxide (NO2) (denoted together as NOx) determine the abundance of the tropospheric oxidants OH, O3 and NO3 that regulate atmospheric self-cleaning. The three reactive trace gases NO, NO2 and O3 undergo a series of interconnected photochemical reactions and are therefore often referred to as the NO-O3-NO2 triad. Ozone deposition is mainly controlled by stomatal uptake, therefore resulting in oxidative stress for the plants. Similarly, nitrogen dioxide from above or below the canopy is deposited to leaves through stomatal uptake. NO emissions from soils contribute to above canopy O3 formation and accelerate OH recycling. Therefore, quantification of the biosphere-atmosphere exchange fluxes of these species is important for atmospheric chemistry and ecosystem research. The eddy covariance method is state of the art for direct measurements of ecosystem fluxes of trace gases. Eddy covariance measurements of NOx in pristine environments are rare because of lack of availability of instruments with the required precision to resolve concentrations characteristic of these environments with the required high time resolution. The Amazon Tall Tower Observatory (ATTO) is located in a pristine rainforest environment in the Amazon basin about 150 km northeast of the city of Manaus. It is the ideal site for studying the biosphere-atmosphere exchange of the NO-O3-NO2 triad, because of the absence of nearby anthropogenic sources. During an intensive measurement campaign in November 2015 at the ATTO site, measurements of NO, NO2 and O3 were carried out at 42 m above ground level on the 80 m walk-up tower with a fast (5 Hz) and sensitive (< 30 ppt) instrument (CLD790SR2, Eco Physics) for NO and NO2 and with 10 Hz for O3 (Enviscope GmbH). Additionally, a suite of micrometeorological instruments was installed, including a profile of 3-dimensional sonic anemometers and meteorological sensors. Vertical concentration profile measurements of NO, NO2 and O

  19. Small-scale variations of climate change in mountainous forested terrain - a regional study from H.J. Andrews Long Term Ecological Research site in Oregon, USA

    Science.gov (United States)

    Honzakova, Katerina; Hoffmann, Peter; Jones, Julia; Thomas, Christoph

    2017-04-01

    There has been conflicting evidence as to whether high elevations are experiencing more pronounced climate warming than lower elevations in mountainous regions. In this study we analyze temperature records from H.J. Andrews Long Term Ecological Research, Oregon, USA and several nearby areas, comprising together 28 stations located in Cascade Mountains. The data, starting in 1958, are first checked for quality and homogenized using the Standard Normal Homogeneity Test. As a reference, composite climate time series based on the Global Historic Climate Network is created and together with cross-referencing against station records used to correct breaks and shifts in the data. In the next step, we investigate temperature patterns of the study site from 1958 to 2016 and compare them for valley and hill stations. In particular, we explore seasonality and inter-annual variability of the records and trends of the last day of frost. Additionally, 'cold' sums (positive and negative) are calculated to obtain a link between temperature and ecosystems' responses (such as budbreaks). So far, valley stations seem to be more prone to climate change than ridge or summit stations, contrary to current thinking. Building on previous knowledge, we attempt to provide physical explanations for the temperature records, focusing on wind patterns and associated phenomena such as cold air drainage and pooling. To aid this we analyze wind speed and direction data available for some of the stations since 1996, including seasonality and inter-annual variability of the observed flows.

  20. Effects of Deforestation and Forest Degradation on Forest Carbon Stocks in Collaborative Forests, Nepal

    Directory of Open Access Journals (Sweden)

    Ram Asheshwar MANDAL

    2012-12-01

    Full Text Available There are some key drivers that favor deforestation and forest degradation. Consequently, levels of carbon stock are affected in different parts of same forest types. But the problem lies in exploring the extent of the effects on level of carbon stocking. This paper highlights the variations in levels of carbon stocks in three different collaborative forests of same forest type i.e. tropical sal (Shorea robusta forest in Mahottari district of the central Terai in Nepal. Three collaborative forests namely Gadhanta-Bardibas Collaborative Forest (CFM, Tuteshwarnath CFM and Banke- Maraha CFM were selected for research site. Interview and workshops were organized with the key informants that include staffs, members and representatives of CFMs to collect the socio-economic data and stratified random sampling was applied to collect the bio-physical data to calculate the carbon stocks. Analysis was carried out using statistical tools. It was found five major drivers namely grazing, fire, logging, growth of invasive species and encroachment. It was found highest carbon 269.36 ton per ha in Gadhanta- Bardibash CFM. The findings showed that the levels of carbon stocks in the three studied CFMs are different depending on how the drivers of deforestation and forest degradation influence over them.

  1. Forest - added Turbulence: A parametric study on Turbulence intensity in and around forests

    International Nuclear Information System (INIS)

    Pedersen, Henrik Sundgaard; Langreder, Wiebke

    2007-01-01

    The scope of the investigation is to take on-site measured wind data from a number of sites inside and close to forests. From the collected on-site data the ambient turbulence intensity is calculated and analysed depending on the distance to the forest and height above the forest. From this forest turbulence intensity database it is possible to get an overview of the general behaviour of the turbulence above and down stream from the forest. The database currently consists of 65 measurements points from around the globe, and it will be continually updated as relevant sites are made available. Using the database a number of questions can be answered. How does the ambient turbulence intensity decay with height? What does the turbulence profile look like according to wind speed? Is it the general situation that high wind speeds are creating movement in the canopy tops, resulting in higher turbulence? How does the ambient turbulence intensity decay at different height as a function of distance to the forest? From the forest turbulence database it can be seen that in general, the majority of the turbulence intensity created by the forest is visible within a radius of 5 times the forest height in vertical and 500 meters downstream from the forest edge in horizontal direction. Outside these boundaries the ambient turbulence intensity is rapidly approaching normal values

  2. Forest resilience to drought varies across biomes.

    Science.gov (United States)

    Gazol, Antonio; Camarero, Jesus Julio; Vicente-Serrano, Sergio M; Sánchez-Salguero, Raúl; Gutiérrez, Emilia; de Luis, Martin; Sangüesa-Barreda, Gabriel; Novak, Klemen; Rozas, Vicente; Tíscar, Pedro A; Linares, Juan C; Martín-Hernández, Natalia; Martínez Del Castillo, Edurne; Ribas, Montse; García-González, Ignacio; Silla, Fernando; Camisón, Alvaro; Génova, Mar; Olano, José M; Longares, Luis A; Hevia, Andrea; Tomás-Burguera, Miquel; Galván, J Diego

    2018-05-01

    Forecasted increase drought frequency and severity may drive worldwide declines in forest productivity. Species-level responses to a drier world are likely to be influenced by their functional traits. Here, we analyse forest resilience to drought using an extensive network of tree-ring width data and satellite imagery. We compiled proxies of forest growth and productivity (TRWi, absolutely dated ring-width indices; NDVI, Normalized Difference Vegetation Index) for 11 tree species and 502 forests in Spain corresponding to Mediterranean, temperate, and continental biomes. Four different components of forest resilience to drought were calculated based on TRWi and NDVI data before, during, and after four major droughts (1986, 1994-1995, 1999, and 2005), and pointed out that TRWi data were more sensitive metrics of forest resilience to drought than NDVI data. Resilience was related to both drought severity and forest composition. Evergreen gymnosperms dominating semi-arid Mediterranean forests showed the lowest resistance to drought, but higher recovery than deciduous angiosperms dominating humid temperate forests. Moreover, semi-arid gymnosperm forests presented a negative temporal trend in the resistance to drought, but this pattern was absent in continental and temperate forests. Although gymnosperms in dry Mediterranean forests showed a faster recovery after drought, their recovery potential could be constrained if droughts become more frequent. Conversely, angiosperms and gymnosperms inhabiting temperate and continental sites might have problems to recover after more intense droughts since they resist drought but are less able to recover afterwards. © 2018 John Wiley & Sons Ltd.

  3. Forest succession at elevated CO2; TOPICAL

    International Nuclear Information System (INIS)

    Clark, James S.; Schlesinger, William H.

    2002-01-01

    We tested hypotheses concerning the response of forest succession to elevated CO2 in the FACTS-1 site at the Duke Forest. We quantified growth and survival of naturally recruited seedlings, tree saplings, vines, and shrubs under ambient and elevated CO2. We planted seeds and seedlings to augment sample sites. We augmented CO2 treatments with estimates of shade tolerance and nutrient limitation while controlling for soil and light effects to place CO2 treatments within the context of natural variability at the site. Results are now being analyzed and used to parameterize forest models of CO2 response

  4. Boreal forests

    International Nuclear Information System (INIS)

    Essen, P.A.; Ericson, L.; Ehnstroem, B.; Sjoeberg, K.

    1997-01-01

    We review patterns and processes important for biodiversity in the Fennoscandian boreal forest, describe man's past and present impact and outline a strategy for conservation. Natural disturbances, particularly forest fire and gap formation, create much of the structural and functional diversity in forest ecosystems. Several boreal plants and animals are adapted to fire regimes. In contrast, many organisms (epiphytic lichens, fungi, invertebrates) require stable conditions with long continuity in canopy cover. The highly mechanized and efficient Fennoscandian forest industry has developed during the last century. The result is that most natural forest has been lost and that several hundreds of species, mainly cryptograms and invertebrates, are threatened. The forestry is now in a transition from exploitation to sustainable production and has recently incorporated some measures to protect the environment. Programmes for maintaining biodiversity in the boreal forest should include at least three parts. First, the system of forest reserves must be significantly improved through protection of large representative ecosystems and key biotopes that host threatened species. Second, we must restore ecosystem properties that have been lost or altered. Natural disturbance regimes must be allowed to operate or be imitated, for example by artificial fire management. Stand-level management should particularly increase the amount of coarse woody debris, the number of old deciduous trees and large, old conifers, by using partial cutting. Third, natural variation should also be mimicked at the landscape level, for example, by reducing fragmentation and increasing links between landscape elements. Long-term experiments are required to evaluate the success of different management methods in maintaining biodiversity in the boreal forest. (au) 260 refs

  5. 78 FR 16830 - Notice of New Fee Site

    Science.gov (United States)

    2013-03-19

    ... New Fee Site AGENCY: Rio Grande National Forest, USDA Forest Service. ACTION: Notice of New Fee Site... Forest is proposing to add a cabin for rent to the public for a $50 fee for the overnight rental. It was.... People are invited to comment on this proposal. DATES: Send any comments about these fee proposals by...

  6. Short-term effects of forest disturbances on soil nematode communities in European mountain spruce forests.

    Science.gov (United States)

    Čerevková, A; Renčo, M; Cagáň, L

    2013-09-01

    The nematode communities in spruce forests were compared with the short-term effects of forest damage, caused by windstorm, wildfire and management practices of forest soils. Soil samples were collected in June and October from 2006 to 2008 in four different sites: (1) forest unaffected by the wind (REF); (2) storm-felled forest with salvaged timber (EXT); (3) modified forest affected by timber salvage (wood removal) and forest fire (FIR); and (4) storm-felled forest where timber had been left unsalvaged (NEX). Nematode analysis showed that the dominant species in all four investigated sites were Acrobeloides nanus and Eudorylaimus silvaticus. An increase of A. nanus (35% of the total nematode abundance) in the first year in the FIR site led to the highest total abundance of nematodes compared with other sites, where nematode abundance reached the same level in the third year. In the FIR site bacterial feeders appeared to be the most representative trophic group, although in the second and third year, after disturbance, the abundance of this trophic group gradually decreased. In the NEX site, the number of nematode species, population densities and Maturity Index were similar to that recorded for the FIR site. In EXT and NEX sites, the other dominant species was the plant parasitic nematode Paratylenchus microdorus. Analyses of nematodes extracted from different forest soil samples showed that the highest number of species and diversity index for species (H'spp) were in the REF site. Differences between the nematode fauna in REF and other localities were clearly depicted by cluster analysis. The greatest Structure Index and Enrichment Index values were also in REF. In the EXT site, the number of nematode species, their abundance, H'spp and Maturity Index were not significantly different from those recorded in the reference site.

  7. Operationalizing measurement of forest degradation

    DEFF Research Database (Denmark)

    Dons, Klaus; Smith-Hall, Carsten; Meilby, Henrik

    2015-01-01

    . In Tanzania, charcoal production is considered a major cause of forest degradation, but is challenging to quantify due to sub-canopy biomass loss, remote production sites and illegal trade. We studied two charcoal production sites in dry Miombo woodland representing open woodland conditions near human......Quantification of forest degradation in monitoring and reporting as well as in historic baselines is among the most challenging tasks in national REDD+ strategies. However, a recently introduced option is to base monitoring systems on subnational conditions such as prevalent degradation activities...

  8. ESTIMATION OF CARBON SEQUESTRATION BY RUSSIAN FORESTS: GEOSPATIAL ISSUE

    Directory of Open Access Journals (Sweden)

    N. V. Malysheva

    2017-01-01

    Full Text Available Сategories of carbon sequestration assessment for Russian forests are identified by GIS toolkit. Those are uniform by bioclimatic and site-specific conditions strata corresponding to modern version of bioclimatic forest district division. Stratification of forests at early stage substantially reduces the ambiguity of the evaluation because phytomass conversion sequestration capacity and expansion factor dependent on site-specific condition for calculating of forest carbon sink are absolutely necessary. Forest management units were linked to strata. Biomass conversion and expansion factor for forest carbon sink assessment linked to the strata were recalculated for forest management units. All operations were carried out with GIS analytical toolkit due to accessible functionalities. Units for forest carbon storage inventory and forest carbon balance calculation were localized. Production capacity parameters and forest carbon sequestration capacity have been visualized on maps complied by ArcGIS. Based on spatially-explicit information, we have found out that the greatest annual rates of forest’s carbon accumulation in Russian forests fall into mixed coniferous-deciduous forests of European-Ural part of Russia to Kaliningrad, Smolensk and Briansk Regions, coniferous-deciduous forests close to the boundary of Khabarovsk Region and Primorskij Kray in the Far East, as well as separate forest management units of Kabardino-Balkariya NorthCaucasian mountain area. The geospatial visualization of carbon sequestration by Russian forests and carbon balance assessment has been given.

  9. Biomass resilience of Neotropical secondary forests.

    Science.gov (United States)

    Poorter, Lourens; Bongers, Frans; Aide, T Mitchell; Almeyda Zambrano, Angélica M; Balvanera, Patricia; Becknell, Justin M; Boukili, Vanessa; Brancalion, Pedro H S; Broadbent, Eben N; Chazdon, Robin L; Craven, Dylan; de Almeida-Cortez, Jarcilene S; Cabral, George A L; de Jong, Ben H J; Denslow, Julie S; Dent, Daisy H; DeWalt, Saara J; Dupuy, Juan M; Durán, Sandra M; Espírito-Santo, Mario M; Fandino, María C; César, Ricardo G; Hall, Jefferson S; Hernandez-Stefanoni, José Luis; Jakovac, Catarina C; Junqueira, André B; Kennard, Deborah; Letcher, Susan G; Licona, Juan-Carlos; Lohbeck, Madelon; Marín-Spiotta, Erika; Martínez-Ramos, Miguel; Massoca, Paulo; Meave, Jorge A; Mesquita, Rita; Mora, Francisco; Muñoz, Rodrigo; Muscarella, Robert; Nunes, Yule R F; Ochoa-Gaona, Susana; de Oliveira, Alexandre A; Orihuela-Belmonte, Edith; Peña-Claros, Marielos; Pérez-García, Eduardo A; Piotto, Daniel; Powers, Jennifer S; Rodríguez-Velázquez, Jorge; Romero-Pérez, I Eunice; Ruíz, Jorge; Saldarriaga, Juan G; Sanchez-Azofeifa, Arturo; Schwartz, Naomi B; Steininger, Marc K; Swenson, Nathan G; Toledo, Marisol; Uriarte, Maria; van Breugel, Michiel; van der Wal, Hans; Veloso, Maria D M; Vester, Hans F M; Vicentini, Alberto; Vieira, Ima C G; Bentos, Tony Vizcarra; Williamson, G Bruce; Rozendaal, Danaë M A

    2016-02-11

    Land-use change occurs nowhere more rapidly than in the tropics, where the imbalance between deforestation and forest regrowth has large consequences for the global carbon cycle. However, considerable uncertainty remains about the rate of biomass recovery in secondary forests, and how these rates are influenced by climate, landscape, and prior land use. Here we analyse aboveground biomass recovery during secondary succession in 45 forest sites and about 1,500 forest plots covering the major environmental gradients in the Neotropics. The studied secondary forests are highly productive and resilient. Aboveground biomass recovery after 20 years was on average 122 megagrams per hectare (Mg ha(-1)), corresponding to a net carbon uptake of 3.05 Mg C ha(-1) yr(-1), 11 times the uptake rate of old-growth forests. Aboveground biomass stocks took a median time of 66 years to recover to 90% of old-growth values. Aboveground biomass recovery after 20 years varied 11.3-fold (from 20 to 225 Mg ha(-1)) across sites, and this recovery increased with water availability (higher local rainfall and lower climatic water deficit). We present a biomass recovery map of Latin America, which illustrates geographical and climatic variation in carbon sequestration potential during forest regrowth. The map will support policies to minimize forest loss in areas where biomass resilience is naturally low (such as seasonally dry forest regions) and promote forest regeneration and restoration in humid tropical lowland areas with high biomass resilience.

  10. Forest biomass carbon stocks and variation in Tibet's carbon-dense forests from 2001 to 2050.

    Science.gov (United States)

    Sun, Xiangyang; Wang, Genxu; Huang, Mei; Chang, Ruiying; Ran, Fei

    2016-10-05

    Tibet's forests, in contrast to China's other forests, are characterized by primary forests, high carbon (C) density and less anthropogenic disturbance, and they function as an important carbon pool in China. Using the biomass C density data from 413 forest inventory sites and a spatial forest age map, we developed an allometric equation for the forest biomass C density and forest age to assess the spatial biomass C stocks and variation in Tibet's forests from 2001 to 2050. The results indicated that the forest biomass C stock would increase from 831.1 Tg C in 2001 to 969.4 Tg C in 2050, with a net C gain of 3.6 Tg C yr -1 between 2001 and 2010 and a decrease of 1.9 Tg C yr -1 between 2040 and 2050. Carbon tends to allocate more in the roots of fir forests and less in the roots of spruce and pine forests with increasing stand age. The increase of the biomass carbon pool does not promote significant augmentation of the soil carbon pool. Our findings suggest that Tibet's mature forests will remain a persistent C sink until 2050. However, afforestation or reforestation, especially with the larger carbon sink potential forest types, such as fir and spruce, should be carried out to maintain the high C sink capacity.

  11. Impacts of access and benefit sharing on livelihoods and forest

    DEFF Research Database (Denmark)

    Yietagesu, Aklilu Ameha; Nielsen, Oystein Juul; Larsen, Helle Overgaard

    2014-01-01

    The introduction of participatory forest management (PFM) may involve the exclusion of previous forest users from accessing forest resources. This is the case for PFM in the two Ethiopian pioneer sites, Dodola and Chilimo that represent two distinct PFM approaches in Ethiopia. This paper analyses...

  12. Long-term response of Caribbean palm forests to hurricanes

    Science.gov (United States)

    Ariel Lugo; J.L. Frangi

    2016-01-01

    We studied the response of Prestoea montana (Sierra Palm, hereafter Palm) brakes and a Palm floodplain forest to hurricanes in the Luquillo Experimental Forest in Puerto Rico. Over a span of 78 years, 3 hurricanes passed over the study sites for which we have 64 years of measurements for Palm brakes and 20 years for the Palm floodplain forest. For each stand, species...

  13. Air pollution impacts on forests in changing climate

    Science.gov (United States)

    M. Lorenz; N. Clarke; E. Paoletti; A. Bytnerowicz; N. Grulke; N. Lukina; H. Sase; J. Staelens

    2010-01-01

    Growing awareness of air pollution effects on forests has, from the early 1980s on, led to intensive forest damage research and monitoring. This has fostered air pollution control, especially in Europe and North America, and to a smaller extent also in other parts of the world. At several forest sites in these regions, there are first indications of a recovery of...

  14. Testing for change in structural elements of forest inventories

    Science.gov (United States)

    Melinda Vokoun; David Wear; Robert Abt

    2009-01-01

    In this article we develop a methodology to test for changes in the underlying relationships between measures of forest productivity (structural elements) and site characteristics, herein referred to as structural changes, using standard forest inventories. Changes in measures of forest growing stock volume and number of trees for both...

  15. Use of Aerial Hyperspectral Imaging For Monitoring Forest Health

    Science.gov (United States)

    Milton O. Smith; Nolan J. Hess; Stephen Gulick; Lori G. Eckhardt; Roger D. Menard

    2004-01-01

    This project evaluates the effectiveness of aerial hyperspectral digital imagery in the assessment of forest health of loblolly stands in central Alabama. The imagery covers 50 square miles, in Bibb and Hale Counties, south of Tuscaloosa, AL, which includes intensive managed forest industry sites and National Forest lands with multiple use objectives. Loblolly stands...

  16. Research related to roads in USDA experimental forests [Chapter 16

    Science.gov (United States)

    W. J. Elliot; P. J. Edwards; R. B. Foltz

    2014-01-01

    Forest roads are essential in experimental forests and rangelands (EFRs) to allow researchers and the public access to research sites and for fire suppression, timber extraction, and fuel management. Sediment from roads can adversely impact watershed health. Since the 1930s, the design and management of forest roads has addressed both access issues and watershed health...

  17. Quantifying deforestation and forest degradation with thermal response.

    Science.gov (United States)

    Lin, Hua; Chen, Yajun; Song, Qinghai; Fu, Peili; Cleverly, James; Magliulo, Vincenzo; Law, Beverly E; Gough, Christopher M; Hörtnagl, Lukas; Di Gennaro, Filippo; Matteucci, Giorgio; Montagnani, Leonardo; Duce, Pierpaolo; Shao, Changliang; Kato, Tomomichi; Bonal, Damien; Paul-Limoges, Eugénie; Beringer, Jason; Grace, John; Fan, Zexin

    2017-12-31

    Deforestation and forest degradation cause the deterioration of resources and ecosystem services. However, there are still no operational indicators to measure forest status, especially for forest degradation. In the present study, we analysed the thermal response number (TRN, calculated by daily total net radiation divided by daily temperature range) of 163 sites including mature forest, disturbed forest, planted forest, shrubland, grassland, savanna vegetation and cropland. TRN generally increased with latitude, however the regression of TRN against latitude differed among vegetation types. Mature forests are superior as thermal buffers, and had significantly higher TRN than disturbed and planted forests. There was a clear boundary between TRN of forest and non-forest vegetation (i.e. grassland and savanna) with the exception of shrubland, whose TRN overlapped with that of forest vegetation. We propose to use the TRN of local mature forest as the optimal TRN (TRN opt ). A forest with lower than 75% of TRN opt was identified as subjected to significant disturbance, and forests with 66% of TRN opt was the threshold for deforestation within the absolute latitude from 30° to 55°. Our results emphasized the irreplaceable thermal buffer capacity of mature forest. TRN can be used for early warning of deforestation and degradation risk. It is therefore a valuable tool in the effort to protect forests and prevent deforestation. Copyright © 2017 Elsevier B.V. All rights reserved.

  18. Disruption of calcium nutrition at Hubbard Brook Experimental Forest (New Hampshire) alters the health and productivity of red spruce and sugar maple trees and provides lessons pertinent to other sites and regions

    Science.gov (United States)

    Paul G. Schaberg; Gary J. Hawley

    2010-01-01

    Pollution-induced acidification and other anthropogenic factors are leaching calcium (Ca) and mobilizing aluminum (Al) in many forest soils. Because Ca is an essential nutrient and Al is a potential toxin, resulting depletions of Ca and increases in available Al may significantly alter the health and productivity of forest trees. Controlled experiments on red spruce (...

  19. Effects of national forest-management regimes on unprotected forests of the Himalaya.

    Science.gov (United States)

    Brandt, Jodi S; Allendorf, Teri; Radeloff, Volker; Brooks, Jeremy

    2017-12-01

    Globally, deforestation continues, and although protected areas effectively protect forests, the majority of forests are not in protected areas. Thus, how effective are different management regimes to avoid deforestation in non-protected forests? We sought to assess the effectiveness of different national forest-management regimes to safeguard forests outside protected areas. We compared 2000-2014 deforestation rates across the temperate forests of 5 countries in the Himalaya (Bhutan, Nepal, China, India, and Myanmar) of which 13% are protected. We reviewed the literature to characterize forest management regimes in each country and conducted a quasi-experimental analysis to measure differences in deforestation of unprotected forests among countries and states in India. Countries varied in both overarching forest-management goals and specific tenure arrangements and policies for unprotected forests, from policies emphasizing economic development to those focused on forest conservation. Deforestation rates differed up to 1.4% between countries, even after accounting for local determinants of deforestation, such as human population density, market access, and topography. The highest deforestation rates were associated with forest policies aimed at maximizing profits and unstable tenure regimes. Deforestation in national forest-management regimes that emphasized conservation and community management were relatively low. In India results were consistent with the national-level results. We interpreted our results in the context of the broader literature on decentralized, community-based natural resource management, and our findings emphasize that the type and quality of community-based forestry programs and the degree to which they are oriented toward sustainable use rather than economic development are important for forest protection. Our cross-national results are consistent with results from site- and regional-scale studies that show forest-management regimes that

  20. Illinois' Forests 2005

    Science.gov (United States)

    Susan J. Crocker; Gary J. Brand; Brett J. Butler; David E. Haugen; Dick C. Little; Dacia M. Meneguzzo; Charles H. Perry; Ronald J. Piva; Barry T. Wilson; Christopher W. Woodall

    2009-01-01

    The first full, annualized inventory of Illinois' forests reports more than 4.5 million acres of forest land with an average of 459 trees per acre. Forest land is dominated by oak/hickory forest types, which occupy 65 percent of total forest land area. Seventy-two percent of forest land consists of sawtimber, 20 percent contains poletimber, and 8 percent contains...

  1. Minnesota's Forests 2008

    Science.gov (United States)

    Patrick D. Miles; David Heinzen; Manfred E. Mielke; Christopher W. Woodall; Brett J. Butler; Ron J. Piva; Dacia M. Meneguzzo; Charles H. Perry; Dale D. Gormanson; Charles J. Barnett

    2011-01-01

    The second full annual inventory of Minnesota's forests reports 17 million acres of forest land with an average volume of more than 1,000 cubic feet per acre. Forest land is dominated by the aspen forest type, which occupies nearly 30 percent of the total forest land area. Twenty-eight percent of forest land consists of sawtimber, 35 percent poletimber, 35 percent...

  2. Successful stock production for forest regeneration: What foresters should ask nursery managers about their crops (and vice versa)

    Science.gov (United States)

    R.K. Dumroese; D.F. Jacobs; T.D. Landis

    2005-01-01

    Forest regeneration is a cyclic operation. Seeds are collected from mature trees and planted in nurseries so that the resulting seedlings can be outplanted to the forest after the mature trees are harvested. Similarly, the process of deciding upon, and growing, the best seedlings for that site should be a cyclic process between foresters and nursery managers. The ideal...

  3. A GIS-derived integrated moisture index to predict forest composition and productivity of Ohio forests (U.S.A.)

    Science.gov (United States)

    Louis R. Iverson; Martin E. Dale; Charles T. Scott; Anantha Prasad; Anantha Prasad

    1997-01-01

    A geographic information system (GIS) approach was used in conjunction with forest-plot data to develop an integrated moisture index (IMI), which was then used to predict forest productivity (site index) and species composition for forests in Ohio. In this region, typical of eastern hardwoods across the Midwest and southern Appalachians, topographic aspect and position...

  4. The distribution of nitrogen and phosphorus in forest floor layers of oak-hickory forests of varying productivity

    Science.gov (United States)

    Karyn S. Rodkey; Donald J. Kaczmarek; Phillip E. Pope

    1995-01-01

    The forest floor plays a major role in the storage and recycling of nutrients which, in turn, are important in maintaining the growth and productivity of forest ecosystems. The development of forest floor organic layers as influenced by litter quality and site quality is unclear. Previous studies in this lab have shown that the size and distribution of available...

  5. System of ecological monitoring and assessment (EMA) for nuclear power plant site areas

    International Nuclear Information System (INIS)

    Vorob'ev, E.I.; Oleinikov, N.F.; Reznichenko, V.Yu.

    1988-01-01

    The goal of the EMA program is to improve the utilization of the natural and labor resources of the city of Sosnovyi Bor due to the opportune discovery of negative changes in the state of the surrounding environment and human health and to predict and assess the possible consequences of implementing technological and economic decisions and their optimization from the point of view of ecology with regard to reactor siting and sizing. The EMA system provides monitoring means and a data bank on the environment and health of workers and the population, a packet of programs for processing and analyzing data, and a set of models to describe and predict the condition of the object/environment/man system. The system monitors contamination sources, monitors and assesses aquatic and terrestrial ecosystems, and accounts for meteorological and biosolar factors which impact on reactor siting

  6. A Forest Tent Caterpillar Outbreak Increased Resource Levels and Seedling Growth in a Northern Hardwood Forest.

    Directory of Open Access Journals (Sweden)

    Danaë M A Rozendaal

    Full Text Available In closed-canopy forests, gap formation and closure are thought to be major drivers of forest dynamics. Crown defoliation by insects, however, may also influence understory resource levels and thus forest dynamics. We evaluate the effect of a forest tent caterpillar outbreak on understory light availability, soil nutrient levels and tree seedling height growth in six sites with contrasting levels of canopy defoliation in a hardwood forest in northern lower Michigan. We compared resource levels and seedling growth of six hardwood species before, during and in the three years after the outbreak (2008-2012. Canopy openness increased strongly during the forest tent caterpillar outbreak in the four moderately and severely defoliated sites, but not in lightly defoliated sites. Total inorganic soil nitrogen concentrations increased in response to the outbreak in moderately and severely defoliated sites. The increase in total inorganic soil nitrogen was driven by a strong increase in soil nitrate, and tended to become stronger with increasing site defoliation. Seedling height growth increased for all species in the moderately and severely defoliated sites, but not in lightly defoliated sites, either during the outbreak year or in the year after the outbreak. Growth increases did not become stronger with increasing site defoliation, but were strongest in a moderately defoliated site with high soil nutrient levels. Growth increases tended to be strongest for the shade intolerant species Fraxinus americana and Prunus serotina, and the shade tolerant species Ostrya virginiana. The strong growth response of F. americana and P. serotina suggests that recurring forest tent caterpillar outbreaks may facilitate the persistence of shade intolerant species in the understory in the absence of canopy gaps. Overall, our results suggest that recurrent canopy defoliation resulting from cyclical forest insect outbreaks may be an additional driver of dynamics in

  7. A Forest Tent Caterpillar Outbreak Increased Resource Levels and Seedling Growth in a Northern Hardwood Forest.

    Science.gov (United States)

    Rozendaal, Danaë M A; Kobe, Richard K

    2016-01-01

    In closed-canopy forests, gap formation and closure are thought to be major drivers of forest dynamics. Crown defoliation by insects, however, may also influence understory resource levels and thus forest dynamics. We evaluate the effect of a forest tent caterpillar outbreak on understory light availability, soil nutrient levels and tree seedling height growth in six sites with contrasting levels of canopy defoliation in a hardwood forest in northern lower Michigan. We compared resource levels and seedling growth of six hardwood species before, during and in the three years after the outbreak (2008-2012). Canopy openness increased strongly during the forest tent caterpillar outbreak in the four moderately and severely defoliated sites, but not in lightly defoliated sites. Total inorganic soil nitrogen concentrations increased in response to the outbreak in moderately and severely defoliated sites. The increase in total inorganic soil nitrogen was driven by a strong increase in soil nitrate, and tended to become stronger with increasing site defoliation. Seedling height growth increased for all species in the moderately and severely defoliated sites, but not in lightly defoliated sites, either during the outbreak year or in the year after the outbreak. Growth increases did not become stronger with increasing site defoliation, but were strongest in a moderately defoliated site with high soil nutrient levels. Growth increases tended to be strongest for the shade intolerant species Fraxinus americana and Prunus serotina, and the shade tolerant species Ostrya virginiana. The strong growth response of F. americana and P. serotina suggests that recurring forest tent caterpillar outbreaks may facilitate the persistence of shade intolerant species in the understory in the absence of canopy gaps. Overall, our results suggest that recurrent canopy defoliation resulting from cyclical forest insect outbreaks may be an additional driver of dynamics in temperate closed

  8. Comparison of an empirical forest growth and yield simulator and a forest gap simulator using actual 30-year growth from two even-aged forests in Kentucky

    Science.gov (United States)

    Daniel A. Yaussy

    2000-01-01

    Two individual-tree growth simulators are used to predict the growth and mortality on a 30-year-old forest site and an 80-year-old forest site in eastern Kentucky. The empirical growth and yield model (NE-TWIGS) was developed to simulate short-term (

  9. Temperate forest impacts on maritime snowpacks across an elevation gradient: An assessment of the snow surface energy balance and airborne lidar derived forest structure

    Science.gov (United States)

    Roth, T. R.; Nolin, A. W.

    2016-12-01

    Temperate forests modify snow evolution patterns both spatially and temporally relative to open areas. Dense, warm forests both impede snow accumulation through increased canopy snow interception and increase sub-canopy longwave energy inputs onto the snow surface. These process modifications vary in magnitude and duration depending on climatic, topographic and forest characteristics. Here we present results from a four year study of paired forested and open sites at three elevations, Low - 1150 m, Mid - 1325 m and High - 1465 m. Snowpacks are deeper and last up to 3-4 weeks longer at the Low and Mid elevation Open sites relative to the adjacent Forest sites. Conversely, at the High Forest site, snow is retained 2-4 weeks longer than the Open site. This change in snowpack depth and persistence is attributed to deposition patterns at higher elevations and forest structure differences that alter the canopy interception efficiency and the sub-canopy energy balance. Canopy interception efficiency (CIE) in the Low and Mid Forest sites, over the duration of the study were 79% and 76% of the total event snowfall, whereas CIE was 31% at the High Forest site. Longwave radiation in forested environments is the primary energy component across each elevation band due to the warm winter environment and forest presence, accounting for 82%, 88%, and 59% of the energy balance at the Low, Mid, and High Forest sites, respectively. High wind speeds in the High elevation Open site significantly increases the turbulent energy and creates preferential snowfall deposition in the nearby Forest site. These results show the importance of understanding the effects of forest cover on sub-canopy snowpack evolution and highlight the need for improved forest cover model representation to accurately predict water resources in maritime forests.

  10. Restoration of biogeochemical function in mangrove forests

    Science.gov (United States)

    McKee, K.L.; Faulkner, P.L.

    2000-01-01

    Forest structure of mangrove restoration sites (6 and 14 years old) at two locations (Henderson Creek [HC] and Windstar [WS]) in southwest Florida differed from that of mixed-basin forests (>50 years old) with which they were once contiguous. However, the younger site (HC) was typical of natural, developing forests, whereas the older site (WS) was less well developed with low structural complexity. More stressful physicochemical conditions resulting from incomplete tidal flushing (elevated salinity) and variable topography (waterlogging) apparently affected plant survival and growth at the WS restoration site. Lower leaf fall and root production rates at the WS restoration site, compared with that at HC were partly attributable to differences in hydroedaphic conditions and structural development. However, leaf and root inputs at each restoration site were not significantly different from that in reference forests within the same physiographic setting. Macrofaunal consumption of tethered leaves also did not differ with site history, but was dramatically higher at HC compared with WS, reflecting local variation in leaf litter processing rates, primarily by snails (Melampus coffeus). Degradation of leaves and roots in mesh bags was slow overall at restoration sites, however, particularly at WS where aerobic decomposition may have been more limited. These findings indicate that local or regional factors such as salinity regime act together with site history to control primary production and turnover rates of organic matter in restoration sites. Species differences in senescent leaf nitrogen content and degradation rates further suggest that restoration sites dominated by Laguncularia racemosa and Rhizophora mangle should exhibit slower recycling of nutrients compared with natural basin forests where Avicennia germinans is more abundant. Structural development and biogeochemical functioning of restored mangrove forests thus depend on a number of factors, but site

  11. Large-scale indicators for monitoring forest diversity of the main forest types in Calabria (Italy

    Directory of Open Access Journals (Sweden)

    Infusino M

    2017-02-01

    Full Text Available Recently, the Society’s perception of forest resources has gone through significant changes. Forest ecosystems play a multifunctional role and host an important portion of the whole biodiversity, particularly in the Mediterranean area. Remote sensing technologies provide a unique way to obtain spatially extensive information on forest ecosystems, but relatively few studies used such information to evaluate forest habitat and biotic diversity. In this paper we evaluate the effectiveness of remote sensing to predict forest diversity by linking remotely sensed information with diversity metrics obtained from ground measurements of butterfly diversity. The field work was carried out in Calabria in four different forest types (beech, chestnut, black pine and silver fir forests. The sampling of Lepidoptera was carried out by LED light traps. We positioned 9 traps per forest type, for a total of 36 sites chosen to sample the different stages of forest succession in each forest type. Samples were carried out once a month from May to November 2015. Data from in situ butterfly measurements were compared with above ground forest biomass estimated from airborne LiDAR with NDVI estimated from Landsat 8. Results indicated that the Geometridae/Noctuideae ratio of lepidopteran communities was significantly correlated with the tree biomass, its distribution among tree size classes and the NDVI. The Geometridae/Noctuidae ratio, therefore, represents an index easy to calculate, which can be employed to integrate data acquired from remote sensing in order to obtain continuous spatial estimates of forest naturalness.

  12. How People Domesticated Amazonian Forests

    NARCIS (Netherlands)

    Levis, C.; Flores, Bernardo; Moreira, Priscilla; Luize, Bruno G.; Alves, Rubana; Franco-Moraes, Juliano; Lins, Juliana; Konings, Evelien; Pena Claros, M.; Bongers, F.; Costa, Flavia; Clement, Charles

    2018-01-01

    For millennia, Amazonian peoples have managed forest resources, modifying the natural environment in subtle and persistent ways. Legacies of past human occupation are striking near archaeological sites, yet we still lack a clear picture of how human management practices resulted in the domestication

  13. Forest insurance

    Science.gov (United States)

    Ellis T. Williams

    1949-01-01

    Standing timber is one of the few important kinds of property that are not generally covered by insurance. Studies made by the Forest Service and other agencies have indicated that the risks involved in the insurance of timber are not unduly great, provided they can be properly distributed. Such studies, however, have thus far failed to induce any notable development...

  14. Forest Imaging

    Science.gov (United States)

    1992-01-01

    NASA's Technology Applications Center, with other government and academic agencies, provided technology for improved resources management to the Cibola National Forest. Landsat satellite images enabled vegetation over a large area to be classified for purposes of timber analysis, wildlife habitat, range measurement and development of general vegetation maps.

  15. Creation of forest edges has a global impact on forest vertebrates

    Science.gov (United States)

    Peres, CA; Banks-Leite, C; Wearn, OR; Marsh, CJ; Butchart, SHM; Arroyo-Rodríguez, V; Barlow, J; Cerezo, A; Cisneros, L; D’Cruze, N; Faria, D; Hadley, A; Harris, S; Klingbeil, BT; Kormann, U; Lens, L; Medina-Rangel, GF; Morante-Filho, JC; Olivier, P; Peters, SL; Pidgeon, A; Ribeiro, DB; Scherber, C; Schneider-Maunory, L; Struebig, M; Urbina-Cardona, N; Watling, JI; Willig, MR; Wood, EM; Ewers, RM

    2017-01-01

    Summary Forest edges influence more than half the world’s forests and contribute to worldwide declines in biodiversity and ecosystem functions. However, predicting these declines is challenging in heterogeneous fragmented landscapes. We assembled an unmatched global dataset on species responses to fragmentation and developed a new statistical approach for quantifying edge impacts in heterogeneous landscapes to quantify edge-determined changes in abundance of 1673 vertebrate species. We show that 85% of species’ abundances are affected, either positively or negatively, by forest edges. Forest core species, which were more likely to be listed as threatened by the IUCN, only reached peak abundances at sites farther than 200-400 m from sharp high-contrast forest edges. Smaller-bodied amphibians, larger reptiles and medium-sized non-volant mammals experienced a larger reduction in suitable habitat than other forest core species. Our results highlight the pervasive ability of forest edges to restructure ecological communities on a global scale. PMID:29088701

  16. EUFODOS: European Forest Downstream Services - Improved Information on Forest Structure and Damage

    Science.gov (United States)

    Hirschmugl, M.; Gallaun, H.; Wack, R.; Granica, K.; Schardt, M.

    2013-05-01

    Forests play a key role in the European economy and environment. This role incorporates ecological functions which can be affected by the occurrence of insect infestations, forest fire, heavy snowfall or windfall events. Local or Regional Authorities (LRAs) thus require detailed information on the degradation status of their forests to be able to take appropriate measures for their forest management plans. In the EUFODOS project, state-of-the-art satellite and laser scanning technologies are used to provide forest authorities with cost-effective and comprehensive information on forest structure and damage. One of the six test sites is located in the Austrian province of Styria where regional forest authorities have expressed a strong need for detailed forest parameters in protective forest. As airborne laser-scanning data is available, it will be utilized to derive detailed forest parameters such as the upper forest border line, tree height, growth classes, forest density, vertical structure or volume. At the current project status, the results of (i) the forest border line, (ii) the segmentation of forest stands and (iii) the tree top detection are available and presented including accuracy assessment and interim results are shown for timber volume estimations. The final results show that the forest border can be mapped operationally with an overall accuracy of almost 99% from LiDAR data. For the segmentation of forest stands, a comparison of the automatically derived result with visual-manual delineation showed in general a more detailed segmentation result, but for all visual-manual segments a congruence of 87% within a 4 m buffer. Tree top detections were compared to stem numbers estimated based on angle-count samplings in a field campaign, which led to a correlation coefficient (R) of 0.79.

  17. EUFODOS: European Forest Downstream Services – Improved Information on Forest Structure and Damage

    Directory of Open Access Journals (Sweden)

    M. Hirschmugl

    2013-05-01

    Full Text Available Forests play a key role in the European economy and environment. This role incorporates ecological functions which can be affected by the occurrence of insect infestations, forest fire, heavy snowfall or windfall events. Local or Regional Authorities (LRAs thus require detailed information on the degradation status of their forests to be able to take appropriate measures for their forest management plans. In the EUFODOS project, state-of-the-art satellite and laser scanning technologies are used to provide forest authorities with cost-effective and comprehensive information on forest structure and damage. One of the six test sites is located in the Austrian province of Styria where regional forest authorities have expressed a strong need for detailed forest parameters in protective forest. As airborne laser-scanning data is available, it will be utilized to derive detailed forest parameters such as the upper forest border line, tree height, growth classes, forest density, vertical structure or volume. At the current project status, the results of (i the forest border line, (ii the segmentation of forest stands and (iii the tree top detection are available and presented including accuracy assessment and interim results are shown for timber volume estimations. The final results show that the forest border can be mapped operationally with an overall accuracy of almost 99% from LiDAR data. For the segmentation of forest stands, a comparison of the automatically derived result with visual-manual delineation showed in general a more detailed segmentation result, but for all visual-manual segments a congruence of 87% within a 4 m buffer. Tree top detections were compared to stem numbers estimated based on angle-count samplings in a field campaign, which led to a correlation coefficient (R of 0.79.

  18. Focused sunlight factor of forest fire danger assessment using Web-GIS and RS technologies

    Science.gov (United States)

    Baranovskiy, Nikolay V.; Sherstnyov, Vladislav S.; Yankovich, Elena P.; Engel, Marina V.; Belov, Vladimir V.

    2016-08-01

    Timiryazevskiy forestry of Tomsk region (Siberia, Russia) is a study area elaborated in current research. Forest fire danger assessment is based on unique technology using probabilistic criterion, statistical data on forest fires, meteorological conditions, forest sites classification and remote sensing data. MODIS products are used for estimating some meteorological conditions and current forest fire situation. Geonformation technologies are used for geospatial analysis of forest fire danger situation on controlled forested territories. GIS-engine provides opportunities to construct electronic maps with different levels of forest fire probability and support raster layer for satellite remote sensing data on current forest fires. Web-interface is used for data loading on specific web-site and for forest fire danger data representation via World Wide Web. Special web-forms provide interface for choosing of relevant input data in order to process the forest fire danger data and assess the forest fire probability.

  19. Ages of tuff beds at East African early hominid sites and sediments in the Gulf of Aden

    Science.gov (United States)

    Sarna-Wojcicki, A. M.; Meyer, C.E.; Roth, P.H.; Brown, F.H.

    1985-01-01

    The early hominids of East Africa were dated by determining the ages of tuff beds at the sites. Despite much research using palaeomagnetic and K/Ar-dating techniques, some of those ages are still controversial 1,2. To obtain independent age estimates for these tephra layers, we have examined cores from DSDP Sites 231 and 232 in the Gulf of Aden (Fig. 1a) which consist mainly of calcareous nannofossil ooze, but also contain rare tephra horizons3 dated by interpolation from the established nannofossil stratigraphy (Fig. 1b). Chemical analysis confirms that the identity and sequence of these horizons is the same as that at the East African sites. We conclude that the age of the Tulu Bor Tuff is <3.4 Myr and hence that the Hadar hominid specimens are also

  20. Combating Forest Corruption: the Forest Integrity Network

    NARCIS (Netherlands)

    Gupta, A.; Siebert, U.

    2004-01-01

    This article describes the strategies and activities of the Forest Integrity Network. One of the most important underlying causes of forest degradation is corruption and related illegal logging. The Forest Integrity Network is a timely new initiative to combat forest corruption. Its approach is to

  1. Forest ownership dynamics of southern forests

    Science.gov (United States)

    Brett J. Butler; David N. Wear

    2013-01-01

    Key FindingsPrivate landowners hold 86 percent of the forest area in the South; two-thirds of this area is owned by families or individuals.Fifty-nine percent of family forest owners own between 1 and 9 acres of forest land, but 60 percent of family-owned forests are in holdings of 100 acres or more.Two-...

  2. Forest structure and downed woody debris in boreal, temperate, and tropical forest fragments.

    Science.gov (United States)

    Gould, William A; González, Grizelle; Hudak, Andrew T; Hollingsworth, Teresa Nettleton; Hollingsworth, Jamie

    2008-12-01

    Forest fragmentation affects the heterogeneity of accumulated fuels by increasing the diversity of forest types and by increasing forest edges. This heterogeneity has implications in how we manage fuels, fire, and forests. Understanding the relative importance of fragmentation on woody biomass within a single climatic regime, and along climatic gradients, will improve our ability to manage forest fuels and predict fire behavior. In this study we assessed forest fuel characteristics in stands of differing moisture, i.e., dry and moist forests, structure, i.e., open canopy (typically younger) vs. closed canopy (typically older) stands, and size, i.e., small (10-14 ha), medium (33 to 60 ha), and large (100-240 ha) along a climatic gradient of boreal, temperate, and tropical forests. We measured duff, litter, fine and coarse woody debris, standing dead, and live biomass in a series of plots along a transect from outside the forest edge to the fragment interior. The goal was to determine how forest structure and fuel characteristics varied along this transect and whether this variation differed with temperature, moisture, structure, and fragment size. We found nonlinear relationships of coarse woody debris, fine woody debris, standing dead and live tree biomass with mean annual median temperature. Biomass for these variables was greatest in temperate sites. Forest floor fuels (duff and litter) had a linear relationship with temperature and biomass was greatest in boreal sites. In a five-way multivariate analysis of variance we found that temperature, moisture, and age/structure had significant effects on forest floor fuels, downed woody debris, and live tree biomass. Fragment size had an effect on forest floor fuels and live tree biomass. Distance from forest edge had significant effects for only a few subgroups sampled. With some exceptions edges were not distinguishable from interiors in terms of fuels.

  3. Tree Regeneration in Church Forests of Ethiopia: Effects of Microsites and Management

    NARCIS (Netherlands)

    Wassie Eshete, A.; Sterck, F.J.; Teketay, D.; Bongers, F.

    2009-01-01

    Tree regeneration is severely hampered in the fragmented afromontane forests of northern Ethiopia. We explored how trees regenerate in remnant forests along the gradient from open field, forest edge to closed sites and canopy gaps inside the forest. We investigated the effects of seed sowing, litter

  4. The Results of the Project on Creation of Special Protection Zones in Pine Forests of the Altai Kray Based on Data from the Long-term Monitoring of Raptors’ Nesting Sites, Russia

    Directory of Open Access Journals (Sweden)

    Igor V. Karyakin

    2016-02-01

    Full Text Available This article provides the review of the condition of rare raptors’ species, nesting in strip-shaped pine forests of the Altai Kray. It also reflects negative trends for some species including the Golden Eagle (Aquila chrysaetos and the Eurasian Eagle Owl (Bubo Bubo due to constant felling. Criteria of selection of special protection zones of forests and zones of special protection in nature reserves in the pine forests of the Altai Kray were designed according to the results of the long-term monitoring of raptors. According to researches of 2015 zones of special protection were designed for Kamsalinsky, Mamontovsky and Kornilovsky nature reserves. Inspections conducted in all mentioned nature reserves and in Zavyalovsky nature reserve showed numerous violations of environmental legislation. Thereafter checks on compliance with the legislation in forest exploitation were initiated.

  5. Protecting and restoring longleaf pine forests on the Kisatchie National Forest in Louisiana

    Science.gov (United States)

    James D. Haywood; Michael Elliot-Smith; Finis Harris; Alton Martin

    2000-01-01

    Longleaf pine (Pinus palustris Mill.) forests once constituted a major ecosystem in the Southern United States stretching from southeastern Virginia south to central Florida and west into East Texas. These forests covered a wide range of site conditions, from wet pine flatwoods to dry mountain slopes. Intensive exploitation reduced the extent of old-...

  6. US Forest Service experimental forests and ranges: an untapped resource for social science

    Science.gov (United States)

    Susan Charnley; Lee K. Cerveny

    2011-01-01

    For a century, US Forest Service experimental forests and ranges (EFRs) have been a resource for scientists conducting long-term research relating to forestry and range management social science research has been limited, despite the history of occupation and current use of these sites for activities ranging from resource extraction and recreation to public education....

  7. Edge effects at an induced forest-grassland boundary: forest birds in ...

    African Journals Online (AJOL)

    Bird species diversity and guild composition between the edge (5-10 m from the margin) of primary forest abutting grassland and the deep interior (> 500 m from the margin) in the Dngoye Forest Reserve were compared. Edge and interior sites were chosen that were homogeneous with respect to habitat physiognomy i.e. ...

  8. Overview of approaches to sustain forest productivity during forest road development and timber harvesting activities

    Science.gov (United States)

    Charles R. Blinn; Rick Dahlamn; James A. Mattson; Michael A. Thompson

    1999-01-01

    Various approaches are available to minimize impacts on forest productivity during forest road building and timber harvesting activities. These approaches include a variety of practices and technologies. They include practices such as reducing road and trail development, using designated trails, and leaving slash at the stump on nutrient deficient sites. Technology...

  9. Forest fires

    International Nuclear Information System (INIS)

    Fuller, M.

    1991-01-01

    This book examines the many complex and sensitive issues relating to wildland fires. Beginning with an overview of the fires of 1980s, the book discusses the implications of continued drought and considers the behavior of wildland fires, from ignition and spread to spotting and firestorms. Topics include the effects of weather, forest fuels, fire ecology, and the effects of fire on plants and animals. In addition, the book examines firefighting methods and equipment, including new minimum impact techniques and compressed air foam; prescribed burning; and steps that can be taken to protect individuals and human structures. A history of forest fire policies in the U.S. and a discussion of solutions to fire problems around the world completes the coverage. With one percent of the earth's surface burning every year in the last decade, this is a penetrating book on a subject of undeniable importance

  10. Forest Islands and Castaway Communities: REDD+ and Forest Restoration in Prey Lang Forest

    Directory of Open Access Journals (Sweden)

    Courtney Work

    2017-02-01

    Full Text Available Climate Change policies are playing an ever-increasing role in global development strategies and their implementation gives rise to often-unforeseen social conflicts and environmental degradations. A landscape approach to analyzing forest-based Climate Change Mitigation policies (CCM and land grabs in the Prey Lang Forest landscape, Cambodia revealed two Korea-Cambodia partnership projects designed to increase forest cover that are juxtaposed in this paper. Case study data revealed a REDD+ project with little negative impact or social conflict in the project area and an Afforestation/Reforestation (A/R project that created both social and ecological conflicts. The study concludes that forest-based CCM policies can reduce conflict through efforts at minimal transformation of local livelihoods, maximal attention to the tenure rights, responsibilities, and authority of citizens, and by improving, not degrading, the project landscapes. The paper presents the circumstances under which these guidelines are sidestepped by the A/R project, and importantly reveals that dramatic forest and livelihood transformation had already affected the community and environment in the REDD+ project site. There are deep contradictions at the heart of climate change policies toward which attention must be given, lest we leave our future generations with nothing but forest islands and castaway communities.

  11. Coarse woody debris in undisturbed and logged forests in the eastern Brazilian Amazon.

    Science.gov (United States)

    Michael Keller; Michael Palace; Gregory P. Asner; Rodrigo Jr. Pereira; Jose Natalino M. Silva

    2004-01-01

    Coarse woody debris (CWD) is an important component of the carbon cycle in tropical forests. We measured the volume and density of fallen CWD at two sites, Cauaxi and Tapajós in the Eastern Amazon. At both sites we studied undisturbed forests (UFs) and logged forests 1 year after harvest. Conventional logging (CL) and reduced impact logging (RIL) were...

  12. Dwarf forest recovery after disturbances in the Luquillo Mountains of Puerto Rico

    Science.gov (United States)

    P.L. Weaver

    2008-01-01

    Dwarf forest in Puerto Rico’s Luquillo Mountains varies according to substrate and topography with very short, dense forest growing on exposed, rocky sites. High elevation level sites suffered considerable damage during past hurricanes whereas the trees on certain lower slopes were protected by ridges or spurs. Post-disturbance recovery of dwarf forest on two types of...

  13. Avian distribution in treefall gaps and understorey of terra firme forest in the lowland Amazon

    Science.gov (United States)

    JR WUNDERLE; MICHAEL R. WILLIG; LUIZA MAGALLI PINTO HENRIQUES

    2005-01-01

    We compared the bird distributions in the understorey of treefall gaps and sites with intact canopy in Amazonian terra firme forest in Brazil. We compiled 2216 mist-net captures (116 species) in 32 gap and 32 forest sites over 22.3 months. Gap habitats differed from forest habitats in having higher capture rates, total captures, species richness and diversity....

  14. Soil carbon sequestration and changes in fungal and bacterial biomass following incorporation of forest residues

    Science.gov (United States)

    Matt D. Busse; Felipe G. Sanchez; Alice W. Ratcliff; John R. Butnor; Emily A. Carter; Robert F. Powers

    2009-01-01

    Sequestering carbon (C) in forest soils can benefit site fertility and help offset greenhouse gas emissions. However, identifying soil conditions and forest management practices which best promote C accumulation remains a challenging task. We tested whether soil incorporation of masticated woody residues alters short-term C storage at forested sites in western and...

  15. NACP North American Forest Dynamics Project: Forest Disturbance and Regrowth Data

    Data.gov (United States)

    National Aeronautics and Space Administration — ABSTRACT: This data set provides the results of time-series analyses of Landsat imagery for 55 selected forested sites across the conterminous U.S.A. The output is a...

  16. Dispersal of forest insects

    Science.gov (United States)

    Mcmanus, M. L.

    1979-01-01

    Dispersal flights of selected species of forest insects which are associated with periodic outbreaks of pests that occur over large contiguous forested areas are discussed. Gypsy moths, spruce budworms, and forest tent caterpillars were studied for their massive migrations in forested areas. Results indicate that large dispersals into forested areas are due to the females, except in the case of the gypsy moth.

  17. South Dakota's forests 2005

    Science.gov (United States)

    Ronald J. Piva; W. Keith Moser; Douglas D. Haugan; Gregory J. Josten; Gary J. Brand; Brett J. Butler; Susan J. Crocker; Mark H. Hansen; Dacia M. Meneguzzo; Charles H. Perry; Christopher W. Woodall

    2009-01-01

    The first completed annual inventory of South Dakota's forests reports almost 1.7 million acres of forest land. Softwood forests make up 74 percent of the total forest land area; the ponderosa pine forest type by itself accounts for 69 percent of the total.

  18. Forest report 2016

    International Nuclear Information System (INIS)

    2016-01-01

    This forest condition report of Hesse (Germany) includes the following topics: forest condition survey for all tree species, forest in the in the Rhine-Main area, weather and climate, soil water balance and drought stress, insects and fungi, Forestry Environment Monitoring, infiltrated substances, main results of Forest soil survey in Hesse (BZE II), the substrate group red sandstone, heavy metal contamination of forests.

  19. Mapping Forest Inventory and Analysis forest land use: timberland, reserved forest land, and other forest land

    Science.gov (United States)

    Mark D. Nelson; John Vissage

    2007-01-01

    The Forest Inventory and Analysis (FIA) program produces area estimates of forest land use within three subcategories: timberland, reserved forest land, and other forest land. Mapping these subcategories of forest land requires the ability to spatially distinguish productive from unproductive land, and reserved from nonreserved land. FIA field data were spatially...

  20. Forests and Forest Cover - MDC_NaturalForestCommunity

    Data.gov (United States)

    NSGIC Local Govt | GIS Inventory — A point feature class of NFCs - Natural Forest Communities. Natural Forest Community shall mean all stands of trees (including their associated understory) which...

  1. Canada's forest biomass resources: deriving estimates from Canada's forest inventory

    International Nuclear Information System (INIS)

    Penner, M.; Power, K.; Muhairwe, C.; Tellier, R.; Wang, Y.

    1997-01-01

    A biomass inventory for Canada was undertaken to address the data needs of carbon budget modelers, specifically to provide estimates of above-ground tree components and of non-merchantable trees in Canadian forests. The objective was to produce a national method for converting volume estimates to biomass that was standardized, repeatable across the country, efficient and well documented. Different conversion methods were used for low productivity forests (productivity class 1) and higher productivity forests (productivity class 2). The conversion factors were computed by constructing hypothetical stands for each site, age, species and province combination, and estimating the merchantable volume and all the above-ground biomass components from suitable published equations. This report documents the procedures for deriving the national biomass inventory, and provides illustrative examples of the results. 46 refs., 9 tabs., 5 figs

  2. Numerical modeling of the airflow around a forest edge using LiDAR-derived forest heigths

    DEFF Research Database (Denmark)

    Boudreault, Louis-Etienne; Dellwik, Ebba; Bechmann, Andreas

    A 3D methodology to quantify the effect of forests on the mean wind flow field is presented. The methodology is based on the treatment of forest raw data of light detection and ranging (LiDAR) scans, and a computational fluid dynamics (CFD) method based on a Reynolds-averaged Navier-Stokes (Ra......NS) approach using the k−e turbulence model with a corresponding canopy model. The example site investigated is a forest edge located on the Falster island in Denmark, where a measurement campaign was conducted. The LiDAR scans are used in order to obtain the forest heights, which served as input...

  3. Evaluation of forest structure, biomass and carbon sequestration in subtropical pristine forests of SW China.

    Science.gov (United States)

    Nizami, Syed Moazzam; Yiping, Zhang; Zheng, Zheng; Zhiyun, Lu; Guoping, Yang; Liqing, Sha

    2017-03-01

    Very old natural forests comprising the species of Fagaceae (Lithocarpus xylocarpus, Castanopsis wattii, Lithocarpus hancei) have been prevailing since years in the Ailaoshan Mountain Nature Reserve (AMNR) SW China. Within these forest trees, density is quite variable. We studied the forest structure, stand dynamics and carbon density at two different sites to know the main factors which drives carbon sequestration process in old forests by considering the following questions: How much is the carbon density in these forest trees of different DBH (diameter at breast height)? How much carbon potential possessed by dominant species of these forests? How vegetation carbon is distributed in these forests? Which species shows high carbon sequestration? What are the physiochemical properties of soil in these forests? Five-year (2005-2010) tree growth data from permanently established plots in the AMNR was analysed for species composition, density, stem diameter (DBH), height and carbon (C) density both in aboveground and belowground vegetation biomass. Our study indicated that among two comparative sites, overall 54 species of 16 different families were present. The stem density, height, C density and soil properties varied significantly with time among the sites showing uneven distribution across the forests. Among the dominant species, L. xylocarpus represents 30% of the total carbon on site 1 while C. wattii represents 50% of the total carbon on site 2. The average C density ranged from 176.35 to 243.97 t C ha -1 . The study emphasized that there is generous degree to expand the carbon stocking in this AMNR through scientific management gearing towards conservation of old trees and planting of potentially high carbon sequestering species on good site quality areas.

  4. dwindling ethiopian forests

    African Journals Online (AJOL)

    eliasn

    1999-05-26

    May 26, 1999 ... Shelter for animals: Forests are natural “habitats for many wild animals. .... nificance of forest conservation and development in Ethiopia's combat ...... of forests are not, unfortunately, analogues to traffic lights where the impact.

  5. Tenure and forest income

    DEFF Research Database (Denmark)

    Jagger, Pamela; Luckert, Martin K.; Duchelle, Amy E.

    2014-01-01

    We explore the relationship between tenure and forest income in 271 villages throughout the tropics. We find that state-owned forests generate more forest income than private and community-owned forests both per household and per hectare. We explore whether forest income varies according...... to the extent of rule enforcement, and congruence (i.e., overlap of user rights between owners and users). We find negative associations between enforcement and smallholder forest income for state-owned and community forests, and positive associations for privately owned forests. Where user rights are limited...... to formal owners we find negative associations for state-owned forests. Overlapping user rights are positively associated with forest income for community forests. Our findings suggest that policy reforms emphasizing enforcement and reducing overlapping claims to forest resources should consider possible...

  6. ORGEST: Regional guidelines and silvicultural models for sustainable forest management

    Energy Technology Data Exchange (ETDEWEB)

    Piqué, Míriam; Vericat, Pau; Beltrán, Mario

    2017-11-01

    Aim of the study: To develop regional guidelines for sustainable forest management. Area of the study: Forests of Catalonia (NE Spain). Material and methods: The process of developing the forest management guidelines (FMG) started by establishing a thorough classification of forest types at stand level. This classification hinges on two attributes: tree species composition and site quality based on ecological variables, which together determine potential productivity. From there, the management guidelines establish certain objectives and silvicultural models for each forest type. The forest type classifications, like the silvicultural models, were produced using both existing and newly-built growth models based on data from the National Forest Inventory (NFI) and expert knowledge. The effort involved over 20 expert working groups in order to better integrate the expertise and vision of different sectorial agents. Main results: The FMG consist in quantitative silvicultural models that include typical silvicultural variables, technical descriptions of treatments and codes of good practice. Guidelines now cover almost all forest types in Catalonia (spanning up to 90% of the Catalan forest area). Different silvicultural models have been developed for pure and mixed stands, different site quality classes (2–3 classes per species), and even- and multi-aged stands. Research highlights: FMG: i) orient the management of private and public forests, (ii) provide a technical scaffold for efficient allocation/investment of public subsidies in forest management, and (iii) bridge forest planning instruments at regional (strategic-tactical) and stand (operational) level.

  7. ORGEST: Regional guidelines and silvicultural models for sustainable forest management

    International Nuclear Information System (INIS)

    Piqué, Míriam; Vericat, Pau; Beltrán, Mario

    2017-01-01

    Aim of the study: To develop regional guidelines for sustainable forest management. Area of the study: Forests of Catalonia (NE Spain). Material and methods: The process of developing the forest management guidelines (FMG) started by establishing a thorough classification of forest types at stand level. This classification hinges on two attributes: tree species composition and site quality based on ecological variables, which together determine potential productivity. From there, the management guidelines establish certain objectives and silvicultural models for each forest type. The forest type classifications, like the silvicultural models, were produced using both existing and newly-built growth models based on data from the National Forest Inventory (NFI) and expert knowledge. The effort involved over 20 expert working groups in order to better integrate the expertise and vision of different sectorial agents. Main results: The FMG consist in quantitative silvicultural models that include typical silvicultural variables, technical descriptions of treatments and codes of good practice. Guidelines now cover almost all forest types in Catalonia (spanning up to 90% of the Catalan forest area). Different silvicultural models have been developed for pure and mixed stands, different site quality classes (2–3 classes per species), and even- and multi-aged stands. Research highlights: FMG: i) orient the management of private and public forests, (ii) provide a technical scaffold for efficient allocation/investment of public subsidies in forest management, and (iii) bridge forest planning instruments at regional (strategic-tactical) and stand (operational) level.

  8. The public forests of tomorrow

    International Nuclear Information System (INIS)

    Reidel, C.

    1992-01-01

    The author presents three different scenarios in this paper. First US national forests in 1890 and the political and economic conditions that directly affected them are discussed. Second, forests in 2092 are described, taking into account world population, climatic change, air pollution, energy supplies, water shortages, water management, wood-based products, changes in governments and government policies. Finally, the author discusses possible changes in public land management designations (e.g. National Parks, Nation Forests) and single purpose agencies (e.g. Park Service, Fish and Wildlife), merged into a new Department of Conservancy. Future government input into planning, carbon credits, easements for conservation land management, decentralized industrial sites, and multi-disciplinary management are suggested

  9. Methods of ecological capability evaluation of forest

    International Nuclear Information System (INIS)

    Hosseini, M.; Makhdoum, M.F.; Akbarnia, M.; Saghebtalebi, Kh.

    2000-01-01

    In this research common methods of ecological capability evaluation of forests were reviewed and limitations for performance were analysed. Ecological capability of forests is an index that show site potential in several role of wood production, soil conservation, flood control, biodiversity, conservation and water supply. This index is related to ecological characteristics of land, such as soil, micro climate, elevation, slope and aspect that affect potential of sites. Suitable method of ecological capability evaluation must be chosen according to the objective of forestry. Common methods for ecological capability evaluation include plant and animal diversity, site index curve, soil and land form, inter branches, index plants, leave analyses, analyses regeneration and ecological mapping

  10. Stakeholders’ perception of forest management: a Portuguese mountain case study

    Energy Technology Data Exchange (ETDEWEB)

    Marta-Costa, A.; Torres-Manso, F.; Pinto, R.; Tibério, L.; Carneiro, I.

    2016-07-01

    Aim of study: The Natura 2000 Network “Montemuro Mountain” Site in Portugal. Material and methods: This study combined several consultation and citizen participation techniques. Main results: The perceptions shared by the stakeholders are some similar, others not similar and others still quite paradoxical regarding forest characteristics and the opportunities they offer. The study has shown that it is possible to implement and improve citizen participation methodologies. This can be a viable way towards more effective forest management and fire prevention as this may help blunt conflicts of interest in forest space management. However, for participation to be truly effective and representative, a policy regarding training and awareness of the importance of information is necessary. Research highlights: The stakeholder perceptions on forests and forest management are assessed; forest fires and agrarian abandonment are central for territory’s development; depopulation, old age and absenteeism emphasize degradation of forest areas; Conscious citizen participation benefit policymaking and forest management. (Author)

  11. Indiana's Forests 2008

    Science.gov (United States)

    Christopher W. Woodall; Mark N. Webb; Barry T. Wilson; Jeff Settle; Ron J. Piva; Charles H. Perry; Dacia M. Meneguzzo; Susan J. Crocker; Brett J. Butler; Mark Hansen; Mark Hatfield; Gary Brand; Charles. Barnett

    2011-01-01

    The second full annual inventory of Indiana's forests reports more than 4.75 million acres of forest land with an average volume of more than 2,000 cubic feet per acre. Forest land is dominated by the white oak/red oak/hickory forest type, which occupies nearly a third of the total forest land area. Seventy-six percent of forest land consists of sawtimber, 16...

  12. Leaching of nitrate from temperate forests - effects of air pollution and forest management

    DEFF Research Database (Denmark)

    Gundersen, Per; Schmidt, Inger Kappel; Raulund-Rasmussen, Karsten

    2006-01-01

    deposition (> 8-10 kg ha(-1) a(-1)). We synthesized the current understanding of factors controlling N leaching in relation to three primary causes of N cycle disruption: (i) Increased N input (air pollution, fertilization, N-2 fixing plants). In European forests, elevated N deposition explains approximately...... half of the variability in N leaching, some of the remaining variability could be explained by differences in N availability or "N status". For coniferous forests, needle N content above 1.4% and (or) forest floor C:N ratio lower than 25 were thresholds for elevated nitrate leaching. At adjacent sites...... conifer forests receive higher N deposition and exhibit higher nitrate loss than deciduous forests; an exception is alder that shows substantial nitrate leaching through N fixation input. Fertilization with N poses limited risk to water quality, when applied to N-limited forests. (ii) Reduced plant uptake...

  13. Percent Forest Cover (Future)

    Data.gov (United States)

    U.S. Environmental Protection Agency — Forests provide economic and ecological value. High percentages of forest cover (FORPCTFuture) generally indicate healthier ecosystems and cleaner surface water....

  14. Percent Forest Cover

    Data.gov (United States)

    U.S. Environmental Protection Agency — Forests provide economic and ecological value. High percentages of forest cover (FORPCT) generally indicate healthier ecosystems and cleaner surface water. More...

  15. Analysis of trends in isoprene and monoterpenes in a remote forest and an anthropogenic influenced forest

    Science.gov (United States)

    Usenko, S.; Sheesley, R. J.; Winfield, Z.; Yoon, S.; Erickson, M.; Flynn, J. H., III; Alvarez, S. L.; Wallace, H. W., IV; Griffin, R. J.

    2017-12-01

    The University of Houston Mobile Air Quality Laboratory (MAQL) was deployed to the University of Michigan Biological Station (UMBS) in July 2016 as part of the PROPHET-AMOS study and then was deployed to Jones Forest located north of Houston, TX from August 12 through September 23, 2016. Both sites are heavily forested, but UMBS is remote with no anthropogenic influence while Jones Forest sees frequent pollution transport from Houston. UMBS experienced periods of high isoprene:monoterpenes and periods of equivalent isoprene:monoterpenes, while Jones Forest had a consistently high isoprene:monoterpenes. This provided for a test bed to look at the interactions within two forested environments as well as the influence of anthropogenic sources. The MAQL was outfitted to measure O3 (2B Technology), NOy and SO2 (Thermo Scientific), NO/NOx (Air Quality Design), CO (Los Gatos), and select biogenic volatile organic carbon (BVOC) with their oxidation products (Ionicon PTR-MS). The instruments sampled from MAQL's 6 m tower at both sites. The UMBS site was below canopy and the Jones Forest site was in an open field surrounded by forest. The trends in isoprene and monoterpenes were explored in relation to time-of-day, temperature, and precipitation for both locations. In addition, the production of methyl vinyl ketone and methacrolein under these different conditions of meteorology, trace gas composition and BVOC composition was explored.

  16. Recovery of Biomass Following Shifting Cultivation in Dry Tropical Forests of the Yucatan

    OpenAIRE

    Read, L; Lawrence, Deborah; Foster, David Russell

    2003-01-01

    Land-use change in the tropics is creating secondary forest at an unprecedented rate. In the tropical Americas, mature dry tropical forest is rapidly being converted to secondary forest during the fallow period of shifting cultivation. This study addresses changes in forest biomass during forest recovery following shifting cultivation of maize (corn) in the Southern Yucatan Peninsular Region (SYPR), Mexico. We sampled stems .1 cm diameter at breast height at 36 study sites in t...

  17. Management of western coniferous forest habitat for nesting accipiter hawks

    Science.gov (United States)

    Richard T. Reynolds

    1983-01-01

    Availability of nesting sites can limit accipiter populations. Because accipiters nest in dense forest stands, any alteration that opens these stands is likely to lessen their desirability as nest sites. Tree growth and the associated changes in the vegetative structure of aging nest sites limit the number of years sites will be suitable. Therefore, prospective...

  18. Transforming forest landscape conflicts: the promises and perils of global forest management initiatives such as REDD+

    Directory of Open Access Journals (Sweden)

    Seth Kane

    2018-04-01

    Full Text Available Implementation of Reducing Emissions from Deforestation and Forest Degradation (REDD+ is designed to relieve pressure on tropical forests, however, many are concerned that it is a threat to the rights of forest communities. These potential risks need serious attention as earlier studies have shown that the Asia-Pacific region is a forest conflict hotspot, with many economic, environmental and social implications at global (e.g. climate change to local levels (e.g. poverty. Drawing on an analysis of nine case studies from four countries (Cambodia, Myanmar, Nepal and Vietnam this paper examines why and how REDD+ can be a driver for forest conflict and how it also has the potential to simultaneously transform these conflicts. The analytical framework, “sources of impairment”, applied in the study was developed to increase understanding and facilitate the resolution of forest landscape conflicts in a sustainable manner (i.e. transformation. The main findings are that REDD+ can be a source of conflict in the study sites, but also had transformative potential when good practices were followed. For example, in some sites, the REDD+ projects were sources of impairment for forest communities by restricting access to forest resources. However, the research also identified REDD+ projects that enabled the participation of traditionally marginalized groups and built local forest management capacities, leading to strengthened tenure for some forest communities. Similarly, in some countries REDD+ has served as a mechanism to pilot Free, Prior and Informed Consent (FPIC, which will likely have significant impacts in mitigating conflicts by addressing the sources at local to national levels. Based on these findings, there are many reasons to be optimistic that REDD+ can address the underlying causes of forest landscape conflicts, especially when linked with other governance initiatives such as Forest Law Enforcement, Governance and Trade – Voluntary

  19. European mixed forests

    DEFF Research Database (Denmark)

    Bravo-Oviedo, Andres; Pretzsch, Hans; Ammer, Christian

    2014-01-01

    Aim of study: We aim at (i) developing a reference definition of mixed forests in order to harmonize comparative research in mixed forests and (ii) review the research perspectives in mixed forests. Area of study: The definition is developed in Europe but can be tested worldwide. Material...... and Methods: Review of existent definitions of mixed forests based and literature review encompassing dynamics, management and economic valuation of mixed forests. Main results: A mixed forest is defined as a forest unit, excluding linear formations, where at least two tree species coexist at any...... density in mixed forests, (iii) conversion of monocultures to mixed-species forest and (iv) economic valuation of ecosystem services provided by mixed forests. Research highlights: The definition is considered a high-level one which encompasses previous attempts to define mixed forests. Current fields...

  20. Forest tenure and sustainable forest management

    Science.gov (United States)

    J.P. Siry; K. McGinley; F.W. Cubbage; P. Bettinger

    2015-01-01

    We reviewed the principles and key literature related to forest tenure and sustainable forest management, and then examined the status of sustainable forestry and land ownership at the aggregate national level for major forested countries. The institutional design principles suggested by Ostrom are well accepted for applications to public, communal, and private lands....

  1. Control of coal-dust in mines. Second edition. Bor'ba s ugol'noi i porodnoi pyl'yu v shakhtakh

    Energy Technology Data Exchange (ETDEWEB)

    Pemrukhin, P.M.; Grodel, G.S.; Zhilyaev, N.I.; Korenev, A.P.; Krivokhizha, B.M.; Kul' bachnyi, A.N.; Lyubimoba, A.I.; Medvedev, E.N.; Yaremachenko, P.P.

    1981-01-01

    An examination is made of problems concerned with over-all removal of dust from the air in mines. A description is given of physical and physico-chemical properties of ore mine dust that are of importance to evaluating processes in the formation, propagation and suppression of dust. Results are given for theoretical and on-site studies of dust aerodynamics in mines. A presentation is made of contemporary measures for controlling coal and rock dust in mines as well as means and methods of controlling air dust-level. Technical characteristics are given for new instruments for measuring air dust level. Brief data are given on preliminary wetting of coal in a massif, and a discussion is made of theoretical and practical problems related to hydro-dedusting, dust suppression, and dust removal during the operation of mining machinery as well as instruments for dedusting air on the surface complex of a mine. The book is intended for engineering-technical personnel in coal mines, design-planning and scientific-research institutes. 52 references, 61 tables.

  2. Forest biomass carbon stocks and variation in Tibet’s carbon-dense forests from 2001 to 2050

    Science.gov (United States)

    Sun, Xiangyang; Wang, Genxu; Huang, Mei; Chang, Ruiying; Ran, Fei

    2016-01-01

    Tibet’s forests, in contrast to China’s other forests, are characterized by primary forests, high carbon (C) density and less anthropogenic disturbance, and they function as an important carbon pool in China. Using the biomass C density data from 413 forest inventory sites and a spatial forest age map, we developed an allometric equation for the forest biomass C density and forest age to assess the spatial biomass C stocks and variation in Tibet’s forests from 2001 to 2050. The results indicated that the forest biomass C stock would increase from 831.1 Tg C in 2001 to 969.4 Tg C in 2050, with a net C gain of 3.6 Tg C yr−1 between 2001 and 2010 and a decrease of 1.9 Tg C yr−1 between 2040 and 2050. Carbon tends to allocate more in the roots of fir forests and less in the roots of spruce and pine forests with increasing stand age. The increase of the biomass carbon pool does not promote significant augmentation of the soil carbon pool. Our findings suggest that Tibet’s mature forests will remain a persistent C sink until 2050. However, afforestation or reforestation, especially with the larger carbon sink potential forest types, such as fir and spruce, should be carried out to maintain the high C sink capacity. PMID:27703215

  3. Capturing forest dependency in the central Himalayan region: Variations between Oak (Quercus spp.) and Pine (Pinus spp.) dominated forest landscapes.

    Science.gov (United States)

    Chakraborty, Anusheema; Joshi, Pawan Kumar; Sachdeva, Kamna

    2018-05-01

    Our study explores the nexus between forests and local communities through participatory assessments and household surveys in the central Himalayan region. Forest dependency was compared among villages surrounded by oak-dominated forests (n = 8) and pine-dominated forests (n = 9). Both quantitative and qualitative analyses indicate variations in the degree of dependency based on proximity to nearest forest type. Households near oak-dominated forests were more dependent on forests (83.8%) compared to households near pine-dominated forests (69.1%). Forest dependency is mainly subsistence-oriented for meeting basic household requirements. Livestock population, cultivated land per household, and non-usage of alternative fuels are the major explanatory drivers of forest dependency. Our findings can help decision and policy makers to establish nested governance mechanisms encouraging prioritized site-specific conservation options among forest-adjacent households. Additionally, income diversification with respect to alternate livelihood sources, institutional reforms, and infrastructure facilities can reduce forest dependency, thereby, allowing sustainable forest management.

  4. Global demand for gold is another threat for tropical forests

    International Nuclear Information System (INIS)

    Alvarez-Berríos, Nora L; Mitchell Aide, T

    2015-01-01

    The current global gold rush, driven by increasing consumption in developing countries and uncertainty in financial markets, is an increasing threat for tropical ecosystems. Gold mining causes significant alteration to the environment, yet mining is often overlooked in deforestation analyses because it occupies relatively small areas. As a result, we lack a comprehensive assessment of the spatial extent of gold mining impacts on tropical forests. In this study, we provide a regional assessment of gold mining deforestation in the tropical moist forest biome of South America. Specifically, we analyzed the patterns of forest change in gold mining sites between 2001 and 2013, and evaluated the proximity of gold mining deforestation to protected areas (PAs). The forest cover maps were produced using the Land Mapper web application and images from the MODIS satellite MOD13Q1 vegetation indices 250 m product. Annual maps of forest cover were used to model the incremental change in forest in ∼1600 potential gold mining sites between 2001–2006 and 2007–2013. Approximately 1680 km 2 of tropical moist forest was lost in these mining sites between 2001 and 2013. Deforestation was significantly higher during the 2007–2013 period, and this was associated with the increase in global demand for gold after the international financial crisis. More than 90% of the deforestation occurred in four major hotspots: Guianan moist forest ecoregion (41%), Southwest Amazon moist forest ecoregion (28%), Tapajós–Xingú moist forest ecoregion (11%), and Magdalena Valley montane forest and Magdalena–Urabá moist forest ecoregions (9%). In addition, some of the more active zones of gold mining deforestation occurred inside or within 10 km of ∼32 PAs. There is an urgent need to understand the ecological and social impacts of gold mining because it is an important cause of deforestation in the most remote forests in South America, and the impacts, particularly in aquatic systems

  5. Preferences for variation in forest characteristics

    DEFF Research Database (Denmark)

    Filyushkina, Anna; Taye, Fitalew Agimass; Lundhede, Thomas

    2017-01-01

    . This study aims at evaluating the effects of variation both within and between stands on recreational values. A choice experiment (CE) was applied to elicit people's preferences for forest types on their next recreational visit. Each alternative is presented with drawings of three forest stands which differ...... with respect to tree species, height (age) and distance to the site, the latter representing the cost factor – willingness-to-travel. Respondents also compose their ideal recreational forest by selecting three types of stands from the catalogue of drawings. We find that mixed tree species are preferred...

  6. Carbon carry capacity and carbon sequestration potential in China based on an integrated analysis of mature forest biomass.

    Science.gov (United States)

    Liu, YingChun; Yu, GuiRui; Wang, QiuFeng; Zhang, YangJian; Xu, ZeHong

    2014-12-01

    Forests play an important role in acting as a carbon sink of terrestrial ecosystem. Although global forests have huge carbon carrying capacity (CCC) and carbon sequestration potential (CSP), there were few quantification reports on Chinese forests. We collected and compiled a forest biomass dataset of China, a total of 5841 sites, based on forest inventory and literature search results. From the dataset we extracted 338 sites with forests aged over 80 years, a threshold for defining mature forest, to establish the mature forest biomass dataset. After analyzing the spatial pattern of the carbon density of Chinese mature forests and its controlling factors, we used carbon density of mature forests as the reference level, and conservatively estimated the CCC of the forests in China by interpolation methods of Regression Kriging, Inverse Distance Weighted and Partial Thin Plate Smoothing Spline. Combining with the sixth National Forest Resources Inventory, we also estimated the forest CSP. The results revealed positive relationships between carbon density of mature forests and temperature, precipitation and stand age, and the horizontal and elevational patterns of carbon density of mature forests can be well predicted by temperature and precipitation. The total CCC and CSP of the existing forests are 19.87 and 13.86 Pg C, respectively. Subtropical forests would have more CCC and CSP than other biomes. Consequently, relying on forests to uptake carbon by decreasing disturbance on forests would be an alternative approach for mitigating greenhouse gas concentration effects besides afforestation and reforestation.

  7. Forest structure and carbon dynamics in Amazonian tropical rain forests.

    Science.gov (United States)

    Vieira, Simone; de Camargo, Plinio Barbosa; Selhorst, Diogo; da Silva, Roseana; Hutyra, Lucy; Chambers, Jeffrey Q; Brown, I Foster; Higuchi, Niro; dos Santos, Joaquim; Wofsy, Steven C; Trumbore, Susan E; Martinelli, Luiz Antonio

    2004-08-01

    Living trees constitute one of the major stocks of carbon in tropical forests. A better understanding of variations in the dynamics and structure of tropical forests is necessary for predicting the potential for these ecosystems to lose or store carbon, and for understanding how they recover from disturbance. Amazonian tropical forests occur over a vast area that encompasses differences in topography, climate, and geologic substrate. We observed large differences in forest structure, biomass, and tree growth rates in permanent plots situated in the eastern (near Santarém, Pará), central (near Manaus, Amazonas) and southwestern (near Rio Branco, Acre) Amazon, which differed in dry season length, as well as other factors. Forests at the two sites experiencing longer dry seasons, near Rio Branco and Santarém, had lower stem frequencies (460 and 466 ha(-1) respectively), less biodiversity (Shannon-Wiener diversity index), and smaller aboveground C stocks (140.6 and 122.1 Mg C ha(-1)) than the Manaus site (626 trees ha(-1), 180.1 Mg C ha(-1)), which had less seasonal variation in rainfall. The forests experiencing longer dry seasons also stored a greater proportion of the total biomass in trees with >50 cm diameter (41-45 vs 30% in Manaus). Rates of annual addition of C to living trees calculated from monthly dendrometer band measurements were 1.9 (Manaus), 2.8 (Santarém), and 2.6 (Rio Branco) Mg C ha(-1) year(-1). At all sites, trees in the 10-30 cm diameter class accounted for the highest proportion of annual growth (38, 55 and 56% in Manaus, Rio Branco and Santarém, respectively). Growth showed marked seasonality, with largest stem diameter increment in the wet season and smallest in the dry season, though this may be confounded by seasonal variation in wood water content. Year-to-year variations in C allocated to stem growth ranged from nearly zero in Rio Branco, to 0.8 Mg C ha(-1) year(-1) in Manaus (40% of annual mean) and 0.9 Mg C ha(-1) year(-1) (33% of

  8. Forest management type influences diversity and community composition of soil fungi across temperate forest ecosystems

    Directory of Open Access Journals (Sweden)

    Kezia eGoldmann

    2015-11-01

    Full Text Available Fungal communities have been shown to be highly sensitive towards shifts in plant diversity and species composition in forest ecosystems. However, little is known about the impact of forest management on fungal diversity and community composition of geographically separated sites. This study examined the effects of four different forest management types on soil fungal communities. These forest management types include age class forests of young managed beech (Fagus sylvatica L., with beech stands age of approximately 30 years, age class beech stands with an age of approximately 70 years, unmanaged beech stands, and coniferous stands dominated by either pine (Pinus sylvestris L. or spruce (Picea abies Karst. which are located in three study sites across Germany. Soil were sampled from 48 study plots and we employed fungal ITS rDNA pyrotag sequencing to assess the soil fungal diversity and community structure.We found that forest management type significantly affects the Shannon diversity of soil fungi and a significant interaction effect of study site and forest management on the fungal OTU richness. Consequently distinct fungal communities were detected in the three study sites and within the four forest management types, which were mainly related to the main tree species. Further analysis of the contribution of soil properties revealed that C/N ratio being the most important factor in all the three study sites whereas soil pH was significantly related to the fungal community in two study sites. Functional assignment of the fungal communities indicated that 38% of the observed communities were Ectomycorrhizal fungi (ECM and their distribution is significantly influenced by the forest management. Soil pH and C/N ratio were found to be the main drivers of the ECM fungal community composition. Additional fungal community similarity analysis revealed the presence of study site and management type specific ECM genera.This study extends our knowledge

  9. Forest Management Type Influences Diversity and Community Composition of Soil Fungi across Temperate Forest Ecosystems.

    Science.gov (United States)

    Goldmann, Kezia; Schöning, Ingo; Buscot, François; Wubet, Tesfaye

    2015-01-01

    Fungal communities have been shown to be highly sensitive toward shifts in plant diversity and species composition in forest ecosystems. However, little is known about the impact of forest management on fungal diversity and community composition of geographically separated sites. This study examined the effects of four different forest management types on soil fungal communities. These forest management types include age class forests of young managed beech (Fagus sylvatica L.), with beech stands age of approximately 30 years, age class beech stands with an age of approximately 70 years, unmanaged beech stands, and coniferous stands dominated by either pine (Pinus sylvestris L.) or spruce (Picea abies Karst.) which are located in three study sites across Germany. Soil were sampled from 48 study plots and we employed fungal ITS rDNA pyrotag sequencing to assess the soil fungal diversity and community structure. We found that forest management type significantly affects the Shannon diversity of soil fungi and a significant interaction effect of study site and forest management on the fungal operational taxonomic units richness. Consequently distinct fungal communities were detected in the three study sites and within the four forest management types, which were mainly related to the main tree species. Further analysis of the contribution of soil properties revealed that C/N ratio being the most important factor in all the three study sites whereas soil pH was significantly related to the fungal community in two study sites. Functional assignment of the fungal communities indicated that 38% of the observed communities were Ectomycorrhizal fungi (ECM) and their distribution is significantly influenced by the forest management. Soil pH and C/N ratio were found to be the main drivers of the ECM fungal community composition. Additional fungal community similarity analysis revealed the presence of study site and management type specific ECM genera. This study extends our

  10. Boreal Forests of Kamchatka: Structure and Composition

    Directory of Open Access Journals (Sweden)

    Markus P. Eichhorn

    2010-09-01

    Full Text Available Central Kamchatka abounds in virgin old-growth boreal forest, formed primarily by Larix cajanderi and Betula platyphylla in varying proportions. A series of eight 0.25–0.30 ha plots captured the range of forests present in this region and their structure is described. Overall trends in both uplands and lowlands are for higher sites to be dominated by L. cajanderi with an increasing component of B. platyphylla with decreasing altitude. The tree line on wet sites is commonly formed by mono-dominant B. ermanii forests. Basal area ranged from 7.8–38.1 m2/ha and average tree height from 8.3–24.7 m, both being greater in lowland forests. Size distributions varied considerably among plots, though they were consistently more even for L. cajanderi than B. platyphylla. Upland sites also contained a dense subcanopy of Pinus pumila averaging 38% of ground area. Soil characteristics differed among plots, with upland soils being of lower pH and containing more carbon. Comparisons are drawn with boreal forests elsewhere and the main current threats assessed. These forests provide a potential baseline to contrast with more disturbed regions elsewhere in the world and therefore may be used as a target for restoration efforts or to assess the effects of climate change independent of human impacts.

  11. Sustaining Urban Forests

    Science.gov (United States)

    John F. Dwyer; David J. Nowak

    2003-01-01

    The significance of the urban forest resource and the powerful forces for change in the urban environment make sustainability a critical issue in urban forest management. The diversity, connectedness, and dynamics of the urban forest establish the context for management that will determine the sustainability of forest structure, health, functions, and benefits. A...

  12. North Dakota's forests 2005

    Science.gov (United States)

    David E. Haugen; Michael Kangas; Susan J. Crocker; Charles H. Perry; Christopher W. Woodall; Brett J. Butler; Barry T. Wilson; Dan J. Kaisershot

    2009-01-01

    The first completed annual inventory of North Dakota's forests reports estimates of more than 724,000 acres of forest land. Information about forest attributes and forest health is presented along with information on agents of change including changing land use patterns and the introduction of nonnative plants, insects, and disease.

  13. Forest Health Detectives

    Science.gov (United States)

    Bal, Tara L.

    2014-01-01

    "Forest health" is an important concept often not covered in tree, forest, insect, or fungal ecology and biology. With minimal, inexpensive equipment, students can investigate and conduct their own forest health survey to assess the percentage of trees with natural or artificial wounds or stress. Insects and diseases in the forest are…

  14. Wisconsin's forests, 2004

    Science.gov (United States)

    Charles H. (Hobie) Perry; Vern A. Everson; Ian K. Brown; Jane Cummings-Carlson; Sally E. Dahir; Edward A. Jepsen; Joe Kovach; Michael D. Labissoniere; Terry R. Mace; Eunice A. Padley; Richard B. Rideout; Brett J. Butler; Susan J. Crocker; Greg C. Liknes; Randall S. Morin; Mark D. Nelson; Barry T. (Ty) Wilson; Christopher W. Woodall

    2008-01-01

    The first full, annualized inventory of Wisconsin's forests was completed in 2004 after 6,478 forested plots were visited. There are more than 16.0 million acres of forest land in the Wisconsin, nearly half of the State's land area; 15.8 million acres meet the definition of timberland. The total area of both forest land and timberland continues an upward...

  15. Managing Sierra Nevada forests

    Science.gov (United States)

    Malcolm North

    2012-01-01

    There has been widespread interest in applying new forest practices based on concepts presented in U.S. Forest Service General Technical Report PSW-GTR-220, "An Ecosystem Management Strategy for Sierran Mixed-Conifer Forests." This collection of papers (PSW-GTR-237) summarizes the state of the science in some topics relevant to this forest management approach...

  16. Re-evaluation of forest biomass carbon stocks and lessons from the world's most carbon-dense forests.

    Science.gov (United States)

    Keith, Heather; Mackey, Brendan G; Lindenmayer, David B

    2009-07-14

    From analysis of published global site biomass data (n = 136) from primary forests, we discovered (i) the world's highest known total biomass carbon density (living plus dead) of 1,867 tonnes carbon per ha (average value from 13 sites) occurs in Australian temperate moist Eucalyptus regnans forests, and (ii) average values of the global site biomass data were higher for sampled temperate moist forests (n = 44) than for sampled tropical (n = 36) and boreal (n = 52) forests (n is number of sites per forest biome). Spatially averaged Intergovernmental Panel on Climate Change biome default values are lower than our average site values for temperate moist forests, because the temperate biome contains a diversity of forest ecosystem types that support a range of mature carbon stocks or have a long land-use history with reduced carbon stocks. We describe a framework for identifying forests important for carbon storage based on the factors that account for high biomass carbon densities, including (i) relatively cool temperatures and moderately high precipitation producing rates of fast growth but slow decomposition, and (ii) older forests that are often multiaged and multilayered and have experienced minimal human disturbance. Our results are relevant to negotiations under the United Nations Framework Convention on Climate Change regarding forest conservation, management, and restoration. Conserving forests with large stocks of biomass from deforestation and degradation avoids significant carbon emissions to the atmosphere, irrespective of the source country, and should be among allowable mitigation activities. Similarly, management that allows restoration of a forest's carbon sequestration potential also should be recognized.

  17. Re-evaluation of forest biomass carbon stocks and lessons from the world's most carbon-dense forests

    Science.gov (United States)

    Keith, Heather; Mackey, Brendan G.; Lindenmayer, David B.

    2009-01-01

    From analysis of published global site biomass data (n = 136) from primary forests, we discovered (i) the world's highest known total biomass carbon density (living plus dead) of 1,867 tonnes carbon per ha (average value from 13 sites) occurs in Australian temperate moist Eucalyptus regnans forests, and (ii) average values of the global site biomass data were higher for sampled temperate moist forests (n = 44) than for sampled tropical (n = 36) and boreal (n = 52) forests (n is number of sites per forest biome). Spatially averaged Intergovernmental Panel on Climate Change biome default values are lower than our average site values for temperate moist forests, because the temperate biome contains a diversity of forest ecosystem types that support a range of mature carbon stocks or have a long land-use history with reduced carbon stocks. We describe a framework for identifying forests important for carbon storage based on the factors that account for high biomass carbon densities, including (i) relatively cool temperatures and moderately high precipitation producing rates of fast growth but slow decomposition, and (ii) older forests that are often multiaged and multilayered and have experienced minimal human disturbance. Our results are relevant to negotiations under the United Nations Framework Convention on Climate Change regarding forest conservation, management, and restoration. Conserving forests with large stocks of biomass from deforestation and degradation avoids significant carbon emissions to the atmosphere, irrespective of the source country, and should be among allowable mitigation activities. Similarly, management that allows restoration of a forest's carbon sequestration potential also should be recognized. PMID:19553199

  18. Survival, growth and reproduction by big-leaf mahogany (Swietenia macrophylla) in open clearing vs. forested conditions in Brazil

    Science.gov (United States)

    James Grogan; Mark Schulze; Jurandir Galvao

    2010-01-01

    Big-leaf mahogany (Swietenia macrophylla) trees are often retained in agricultural fields and pastures for seed and timber production after selective logging and forest clearing in the Brazilian Amazon. At a forest management site in southeast Para´, we censused trees growing scattered across a large open clearing after forest removal and in heavily disturbed forest...

  19. Variations in dung beetles assemblages (Coleoptera: Scarabaeidae within two rain forest habitats in French Guiana

    Directory of Open Access Journals (Sweden)

    François Feer

    2013-06-01

    Full Text Available The structure of dung beetle communities inhabiting tropical forests are known to be sensitive to many kinds of environmental changes such as microclimate related to vegetation structure. I examined Scarabaeinae assemblages in two sites of undisturbed high forest and two sites of low forest forming a transitional zone with the open habitat of an inselberg in French Guiana. Sampling was made with pitfall and flight interception traps during 2003 and 2004. The driest and warmest conditions characterized the low forest sites. Across two years we obtained 2 927 individuals from 61 species with pitfall traps and 1 431 individuals from 85 species with flight interception traps. Greater species richness and abundance characterized all sites sampled with pitfall traps during 2003 more than 2004. In 2003 no differences were detected among sites by rarefaction analyses. In 2004 the species richest high forest site was significantly different from one of the low forest sites. For both years Clench model asymptotes for species richness were greater in high forest than in low forest sites. For both years, mean per-trap species richness, abundance and biomass among high forest sites were similar and higher than in low forest sites, especially where the lowest humidity and the highest temperature were recorded. Within the two low forest sites, species richness and abundance recorded during the second year, decreased with distance to edge. Different dominant roller species characterized the pitfall samples in one site of low forest and in other sites. Small variations in microclimatic conditions correlated to canopy height and openness likely affected dung beetle assemblages but soil depth and the presence of large mammals providing dung resource may also play a significant role.

  20. Using Biomass to Improve Site Quality and Carbon Sequestration

    Science.gov (United States)

    Bryce J. Stokes; Felipe G. Sanchez; Emily A. Carter

    1998-01-01

    The future demands on forest lands are a concern because of reduced productivity, especially on inherently poor sites, sites with long-depleted soils, or those soils that bear repeated, intensive short rotations. Forests are also an important carbon sink and, when well managed, can make even more significant contributions to sequestration and to reduction of greenhouse...

  1. West Virginia Forests 2013

    Science.gov (United States)

    Randall S. Morin; Gregory W. Cook; Charles J. Barnett; Brett J. Butler; Susan J. Crocker; Mark A. Hatfield; Cassandra M. Kurtz; Tonya W. Lister; William G. Luppold; William H. McWilliams; Patrick D. Miles; Mark D. Nelson; Charles H. (Hobie) Perry; Ronald J. Piva; James E. Smith; Jim Westfall; Richard H. Widmann; Christopher W. Woodall

    2016-01-01

    The annual inventory of West Virginia's forests, completed in 2013, covers nearly 12.2 million acres of forest land with an average volume of more than 2,300 cubic feet per acre. This report is based data collected from 2,808 plots located across the State. Forest land is dominated by the oak/hickory forest-type group, which occupies 74 percent of total forest...

  2. Illinois' Forests 2010

    Science.gov (United States)

    Susan J. Crocker; Mark D. Nelson; Charles J. Barnett; Brett J. Butler; Grant M. Domke; Mark H. Hansen; Mark A. Hatfield; Tonya W. Lister; Dacia M. Meneguzzo; Ronald J. Piva; Barry T. Wilson; Christopher W. Woodall

    2013-01-01

    The second full annual inventory of Illinois' forests, completed in 2010, reports more than 4.8 million acres of forest land and 97 tree species. Forest land is dominated by oak/hickory and elm/ash/cottonwood forest-type groups, which occupy 93 percent of total forest land area. The volume of growing stock on timberland totals 7.2 billion cubic feet. The average...

  3. Nebraska's Forests 2010

    Science.gov (United States)

    Dacia M Meneguzzo; Susan J. Crocker; Mark D. Nelson; Charles J. Barnett; Brett J. Butler; Grant M. Domke; Mark H. Hansen; Mark A. Hatfield; Greg C. Liknes; Andrew J. Lister; Tonya W. Lister; Ronald J. Piva; Barry T. (Ty) Wilson; Christopher W. Woodall

    2012-01-01

    The second full annual inventory of Nebraska's forests reports more than 1.5 million acres of forest land and 39 tree species. Forest land is dominated by the elm/ash/cottonwood and oak/hickory forest types, which occupy nearly half of the total forest land area. The volume of growing stock on timberland currently totals 1.1 billion cubic feet. The average annual...

  4. New Jersey's forests, 2008

    Science.gov (United States)

    Susan J. Crocker; Mark D. Nelson; Charles J. Barnett; Gary J. Brand; Brett J. Butler; Grant M. Domke; Mark H. Hansen; Mark A. Hatfield; Tonya W. Lister; Dacia M. Meneguzzo; Charles H. Perry; Ronald J. Piva; Barry T. Wilson; Christopher W. Woodall; Bill. Zipse

    2011-01-01

    The first full annual inventory of New Jersey's forests reports more than 2.0 million acres of forest land and 83 tree species. Forest land is dominated by oak-hickory forest types in the north and pitch pine forest types in the south. The volume of growing stock on timberland has been rising since 1956 and currently totals 3.4 billion cubic feet. The average...

  5. Forest Grammar(Ⅰ)

    Institute of Scientific and Technical Information of China (English)

    张松懋

    1994-01-01

    Forest grammar,a new type of high-dimensional grammar,is proposed in this paper,of which both the left and the right parts of every production are concatenations of tree structures.A classification of forest grammar is studied,especially,a subclass of the forest grammar,i.e.the context-sensitive forest grammar,and one of its subclasses is defined,called the weak precedence forest grammar.

  6. New Jersey Forests 2013

    Science.gov (United States)

    Susan J. Crocker; Charles J. Barnett; Brett J. Butler; Mark A. Hatfield; Cassandra M. Kurtz; Tonya W. Lister; Dacia M. Meneguzzo; Patrick D. Miles; Randall S. Morin; Mark D. Nelson; Ronald J. Piva; Rachel Riemann; James E. Smith; Christopher W. Woodall; William. Zipse

    2017-01-01

    The second full annual inventory of New Jersey’s forests reports more than 2.0 million acres of forest land and 77 tree species. Forest land is dominated by oak/hickory forest types in the north and pitch pine forest types in the south. The volume of growing stock on timberland has been rising since 1956 and currently totals 3.3 billion cubic feet. Average annual net...

  7. Michigan's Forests 2009

    Science.gov (United States)

    Scott A. Pugh; Lawrence D. Pedersen; Douglas C. Heym; Ronald J. Piva; Christopher W. Woodall; Charles J. Barnett; Cassandra M. Kurtz; W. Keith. Moser

    2012-01-01

    The seventh inventory of Michigan's forests, completed in 2009, describes more than 19.9 million acres of forest land. The data in this report are based on visits to 7,516 forested plots from 2005 to 2009. Timberland accounts for 97 percent of this forest land, and 62 percent is privately owned. The sugar maple/beech/yellow birch forest type accounts for 18...

  8. Michigan's forests 2004

    Science.gov (United States)

    Scott A. Pugh; Mark H. Hansen; Lawrence D. Pedersen; Douglas C. Heym; Brett J. Butler; Susan J. Crocker; Dacia Meneguzzo; Charles H. Perry; David E. Haugen; Christopher Woodall; Ed Jepsen

    2009-01-01

    The first annual inventory of Michigan's forests, completed in 2004, covers more than 19.3 million acres of forest land. The data in this report are based on visits to 10,355 forested plots from 2000 to 2004. In addition to detailed information on forest attributes, this report includes data on forest health, biomass, land-use change, and timber-product outputs....

  9. Data base for early postfire succession in Northern Rocky Mountain forests

    Science.gov (United States)

    Peter F. Stickney; Robert B. Campbell

    2000-01-01

    Web site and CD-ROM include 21 pages of text plus electronic data for 55 succession sites including color plates, tables, and figures. Provides data on quantitative postfire changes of plant species and forest vegetation components for up to the first 25 years of secondary plant succession for 55 forest sites in northern Idaho and northwestern Montana. Cover (aerial...

  10. Visually Determined Soil Disturbance Classes Used as Indices of Forest Harvesting Disturbance

    Science.gov (United States)

    W. Michael Aust; James A. Burger; Emily A. Carter; David P. Preston; Steven C. Patterson

    1998-01-01

    Visual estimates of soil and site disturbances are used by foresters, soil scientists, logging supervisors. and machinery operators to minimize harvest disturbances to forest sites, to evaluate compliance with forestry Best Management Practices (BMPs), and to determine the need for ameliorative practices such as tnechanical site preparation. Although estimates are...

  11. Forest impacts on snow accumulation and ablation across an elevation gradient in a temperate montane environment

    Science.gov (United States)

    Roth, Travis R.; Nolin, Anne W.

    2017-11-01

    Forest cover modifies snow accumulation and ablation rates via canopy interception and changes in sub-canopy energy balance processes. However, the ways in which snowpacks are affected by forest canopy processes vary depending on climatic, topographic and forest characteristics. Here we present results from a 4-year study of snow-forest interactions in the Oregon Cascades. We continuously monitored snow and meteorological variables at paired forested and open sites at three elevations representing the Low, Mid, and High seasonal snow zones in the study region. On a monthly to bi-weekly basis, we surveyed snow depth and snow water equivalent across 900 m transects connecting the forested and open pairs of sites. Our results show that relative to nearby open areas, the dense, relatively warm forests at Low and Mid sites impede snow accumulation via canopy snow interception and increase sub-canopy snowpack energy inputs via longwave radiation. Compared with the Forest sites, snowpacks are deeper and last longer in the Open site at the Low and Mid sites (4-26 and 11-33 days, respectively). However, we see the opposite relationship at the relatively colder High sites, with the Forest site maintaining snow longer into the spring by 15-29 days relative to the nearby Open site. Canopy interception efficiency (CIE) values at the Low and Mid Forest sites averaged 79 and 76 % of the total event snowfall, whereas CIE was 31 % at the lower density High Forest site. At all elevations, longwave radiation in forested environments appears to be the primary energy component due to the maritime climate and forest presence, accounting for 93, 92, and 47 % of total energy inputs to the snowpack at the Low, Mid, and High Forest sites, respectively. Higher wind speeds in the High Open site significantly increase turbulent energy exchanges and snow sublimation. Lower wind speeds in the High Forest site create preferential snowfall deposition. These results show the importance of

  12. Monitoring and Modeling Carbon Dynamics at a Network of Intensive Sites in the USA and Mexico

    Science.gov (United States)

    Birdsey, R.; Wayson, C.; Johnson, K. D.; Pan, Y.; Angeles, G.; De Jong, B. H.; Andrade, J. L.; Dai, Z.

    2013-05-01

    The Forest Services of the USA and Mexico, supported by NASA and USAID, have begun to establish a network of intensive forest carbon monitoring sites. These sites are used for research and teaching, developing forest management practices, and forging links to the needs of communities. Several of the sites have installed eddy flux towers to basic meteorology data and daily estimates of forest carbon uptake and release, the processes that determine forest growth. Field sampling locations at each site provide estimates of forest biomass and carbon stocks, and monitor forest dynamic processes such as growth and mortality rates. Remote sensing facilitates scaling up to the surrounding landscapes. The sites support information requirements for implementing programs such as Reducing Emissions from Deforestation and Forest Degradation (REDD+), enabling communities to receive payments for ecosystem services such as reduced carbon emissions or improved forest management. In addition to providing benchmark data for REDD+ projects, the sites are valuable for validating state and national estimates from satellite remote sensing and the national forest inventory. Data from the sites provide parameters for forest models that support strategic management analysis, and support student training and graduate projects. The intensive monitoring sites may be a model for other countries in Latin America. Coordination among sites in the USA, Mexico and other Latin American countries can ensure harmonization of approaches and data, and share experiences and knowledge among countries with emerging opportunities for implementing REDD+ and other conservation programs.

  13. Effects of coffee management on deforestation rates and forest integrity.

    Science.gov (United States)

    Hylander, Kristoffer; Nemomissa, Sileshi; Delrue, Josefien; Enkosa, Woldeyohannes

    2013-10-01

    Knowledge about how forest margins are utilized can be crucial for a general understanding of changes in forest cover, forest structure, and biodiversity across landscapes. We studied forest-agriculture transitions in southwestern Ethiopia and hypothesized that the presence of coffee (Coffea arabica)decreases deforestation rates because of coffee's importance to local economies and its widespread occurrence in forests and forest margins. Using satellite images and elevation data, we compared changes in forest cover over 37 years (1973-2010) across elevations in 2 forest-agriculture mosaic landscapes (1100 km(2) around Bonga and 3000 km(2) in Goma-Gera). In the field in the Bonga area, we determined coffee cover and forest structure in 40 forest margins that differed in time since deforestation. Both the absolute and relative deforestation rates were lower at coffee-growing elevations compared with at higher elevations (-10/20% vs. -40/50% comparing relative rates at 1800 m asl and 2300-2500 m asl, respectively). Within the coffee-growing elevation, the proportion of sites with high coffee cover (>20%) was significantly higher in stable margins (42% of sites that had been in the same location for the entire period) than in recently changed margins (0% of sites where expansion of annual crops had changed the margin). Disturbance level and forest structure did not differ between sites with 30% or 3% coffee. However, a growing body of literature on gradients of coffee management in Ethiopia reports coffee's negative effects on abundances of forest-specialist species. Even if the presence of coffee slows down the conversion of forest to annual-crop agriculture, there is a risk that an intensification of coffee management will still threaten forest biodiversity, including the genetic diversity of wild coffee. Conservation policy for Ethiopian forests thus needs to develop strategies that acknowledge that forests without coffee production may have higher deforestation

  14. The assessment of environmentally sensitive forest road construction in Calabrian pine forest areas of Turkey.

    Science.gov (United States)

    Tunay, Metin

    2006-07-01

    Forest road construction by bulldozers in Calabrian Pine (Pinus brutia Ten.) forests on mountainous terrain of Turkey causes considerable damage to the environment and the forest standing alongside the road. This situation obliges a study of environmentally sound road construction in Turkey. This study was carried out in 4 sample sites of Antalya Forest Directorate in steep (34-50% gradient) and very steep terrain (51-70% gradient) conditions with bulldozer and excavator machine and direct damages to forest during road construction was determined, including forest area losses and damages to downhill trees in mountainous areas. It was determined that in steep terrain when excavators were used, less forest area (22.16%) was destroyed compared to bulldozers and 26.54% less area in very steep terrain. The proportion of damage on trees where bulldozer worked was nearly twofold higher than excavator was used. The results of this research show that the environmentally sensitive techniques applied for the road construction projects are considerably superior to the traditional use of bulldozers on steep slopes. The environmentally sound forest road construction by use of excavator must be considered an appropriate and reliable solution for mountainous terrain where areas of sensitive forest ecosystems are to be opened up.

  15. Part 6: Forest monitoring

    International Nuclear Information System (INIS)

    1997-01-01

    In this part the results of forest monitoring on Hungarian and Slovak territory are presented. The two countries examine the growth and the health conditions of trees in similar ways. The monitoring sites in the Slovak and Hungarian territories, included in the joint monitoring, are shown on figure. The Slovak Party has already evaluated the wood yield data for 1996, the weekly girth growth observations in 1996 were not performed yet. So far on the Hungarian side only the weekly girth growth data are available for the year 1996, the wood yield data for 1996 are being processed. In the evaluation of Hungarian side only the results obtained for the period from 1992 to 1995 were analysed. Moreover, on the Slovak side an evaluation of the health conditions of trees based on aerial was carried out. The Hungarian party did not carried out such a survey, therefore the evaluation is based only on field (on-the-spot) observations

  16. Structural Dynamics of Tropical Moist Forest Gaps

    Science.gov (United States)

    Hunter, Maria O.; Keller, Michael; Morton, Douglas; Cook, Bruce; Lefsky, Michael; Ducey, Mark; Saleska, Scott; de Oliveira, Raimundo Cosme; Schietti, Juliana

    2015-01-01

    Gap phase dynamics are the dominant mode of forest turnover in tropical forests. However, gap processes are infrequently studied at the landscape scale. Airborne lidar data offer detailed information on three-dimensional forest structure, providing a means to characterize fine-scale (1 m) processes in tropical forests over large areas. Lidar-based estimates of forest structure (top down) differ from traditional field measurements (bottom up), and necessitate clear-cut definitions unencumbered by the wisdom of a field observer. We offer a new definition of a forest gap that is driven by forest dynamics and consistent with precise ranging measurements from airborne lidar data and tall, multi-layered tropical forest structure. We used 1000 ha of multi-temporal lidar data (2008, 2012) at two sites, the Tapajos National Forest and Ducke Reserve, to study gap dynamics in the Brazilian Amazon. Here, we identified dynamic gaps as contiguous areas of significant growth, that correspond to areas > 10 m2, with height gap at Tapajos National Forest (4.8 %) as compared to Ducke Reserve (2.0 %). On average, gaps were smaller at Ducke Reserve and closed slightly more rapidly, with estimated height gains of 1.2 m y-1 versus 1.1 m y-1 at Tapajos. At the Tapajos site, height growth in gap centers was greater than the average height gain in gaps (1.3 m y-1 versus 1.1 m y-1). Rates of height growth between lidar acquisitions reflect the interplay between gap edge mortality, horizontal ingrowth and gap size at the two sites. We estimated that approximately 10 % of gap area closed via horizontal ingrowth at Ducke Reserve as opposed to 6 % at Tapajos National Forest. Height loss (interpreted as repeat damage and/or mortality) and horizontal ingrowth accounted for similar proportions of gap area at Ducke Reserve (13 % and 10 %, respectively). At Tapajos, height loss had a much stronger signal (23 % versus 6 %) within gaps. Both sites demonstrate limited gap contagiousness defined by an

  17. Insights on Forest Structure and Composition from Long-Term Research in the Luquillo Mountains

    OpenAIRE

    Tamara Heartsill Scalley

    2017-01-01

    The science of ecology fundamentally aims to understand species and their relation to the environment. At sites where hurricane disturbance is part of the environmental context, permanent forest plots are critical to understand ecological vegetation dynamics through time. An overview of forest structure and species composition from two of the longest continuously measured tropical forest plots is presented. Long-term measurements, 72 years at the leeward site, and 25 years at windward site, o...

  18. [Structural recovering in Andean successional forests from Porce (Antioquia, Colombia)].

    Science.gov (United States)

    Yepes, Adriana P; del Valle, Jorge I; Jaramillo, Sandra L; Orrego, Sergio A

    2010-03-01

    Places subjected to natural or human disturbance can recover forest through an ecological process called secondary succession. Tropical succession is affected by factors such as disturbances, distance from original forest, surface configuration and local climate. These factors determine the composition of species and the time trend of the succession itself. We studied succession in soils used for cattle ranching over various decades in the Porce Region of Colombia (Andean Colombian forests). A set of twenty five permanent plots was measured, including nine plots (20 x 50 m) in primary forests and sixteen (20 x 25 m) in secondary forests. All trees with diameter > or =1.0 cm were measured. We analyzed stem density, basal area, above-ground biomass and species richness, in a successional process of ca. 43 years, and in primary forests. The secondary forests' age was estimated in previous studies, using radiocarbon dating, aerial photographs and a high-resolution satellite image analysis (7 to >43 years). In total, 1,143 and 1,766 stems were measured in primary and secondary forests, respectively. Basal area (5.7 to 85.4 m2 ha(-1)), above-ground biomass (19.1 to 1,011.5 t ha(-1)) and species richness (4 to 69) directly increased with site age, while steam density decreased (3,180 to 590). Diametric distributions were "J-inverted" for primary forests and even-aged size-class structures for secondary forests. Three species of palms were abundant and exclusive in old secondary forests and primary forests: Oenocarpus mapora, Euterpe precatoria and Oenocarpus bataua. These palms happened in cohorts after forest disturbances. Secondary forest structure was 40% in more than 43 years of forest succession and indicate that many factors are interacting and affecting the forests succession in the area (e.g. agriculture, cattle ranching, mining, etc.).

  19. Forest dynamics.

    Science.gov (United States)

    Frelich, Lee

    2016-01-01

    Forest dynamics encompass changes in stand structure, species composition, and species interactions with disturbance and environment over a range of spatial and temporal scales. For convenience, spatial scale is defined as individual tree, neighborhood, stand, and landscape. Whether a given canopy-leveling disturbance will initiate a sequence of development in structure with little change in composition or initiate an episode of succession depends on a match or mismatch, respectively, with traits of the dominant tree species that allow the species to survive disturbance. When these match, certain species-disturbance type combinations lock in a pattern of stand and landscape dynamics that can persist for several generations of trees; thus, dominant tree species regulate, as well as respond to, disturbance. A complex interaction among tree species, neighborhood effects, disturbance type and severity, landform, and soils determines how stands of differing composition form and the mosaic of stands that compose the landscape. Neighborhood effects (e.g., serotinous seed rain, sprouting, shading, leaf-litter chemistry, and leaf-litter physical properties) operate at small spatial extents of the individual tree and its neighbors but play a central role in forest dynamics by contributing to patch formation at stand scales and dynamics of the entire landscape. Dominance by tree species with neutral to negative neighborhood effects leads to unstable landscape dynamics in disturbance-prone regions, wherein most stands are undergoing succession; stability can only occur under very low-severity disturbance regimes. Dominance by species with positive effects leads to stable landscape dynamics wherein only a small proportion of stands undergo succession at any one time. Positive neighborhood effects are common in temperate and boreal zones, whereas negative effects are more common in tropical climates. Landscapes with positive dynamics have alternate categories of dynamics

  20. Non-native grass removal and shade increase soil moisture and seedling performance during Hawaiian dry forest restoration

    Science.gov (United States)

    Jared M. Thaxton; Susan Cordell; Robert J. Cabin; Darren R. Sandquist

    2012-01-01

    Invasive non-native species can create especially problematic restoration barriers in subtropical and tropical dry forests. Native dry forests in Hawaii presently cover less than 10% of their original area. Many sites that historically supported dry forest are now completely dominated by non-native species, particularly grasses. Within a grass-dominated site in leeward...