Gardić Vojka R.; Petrović Jelena V.; Đurđevac-Ignjatović Lidija V.; Kolaković Srđan R.; Vujović Svetlana R.
2015-01-01
Mining and copper production in Bor, in the past hundred years, had a huge impact on the environment of town, but also in a wide region. In the area of Bor, in the zone of Mining and Smelting Company (RTB) activity, over 29,000 ha of land under forests and fields is degraded. The area of degraded agricultural land in the Bor municipality is over 60% of total agricultural land. Wastewater, generated in the sites of RTB Bor, pollute the Bor River and Krivelj ...
Directory of Open Access Journals (Sweden)
Gardić Vojka R.
2015-01-01
Full Text Available Mining and copper production in Bor, in the past hundred years, had a huge impact on the environment of town, but also in a wide region. In the area of Bor, in the zone of Mining and Smelting Company (RTB activity, over 29,000 ha of land under forests and fields is degraded. The area of degraded agricultural land in the Bor municipality is over 60% of total agricultural land. Wastewater, generated in the sites of RTB Bor, pollute the Bor River and Krivelj River, which still flow into the Timok River and Danube River. These pollutions are often presented by low pH value, increased content of heavy metal ions, suspended particles and fine particles of flotation tailings, which is deposited in the valleys of these rivers on the area of over 2000 hectares. During the decades of exploitation of ore from the open pit Bor at different locations ("Visoki Planir" - also called “Oštreljski planir”, "Severni planir" dump of ore body "H" (RTH gangue and tailings were delayed. The largest amount of tailings, about 150 million tons, was postponed on location Visoki planir. The effect of the mining waste and the impact of the whole process of processing copper ore to the final products on the environment, was conducted during the 4th study period of the project "Management of mining waste-tailing dump in the Bor region," supported by the Japan Society for the Promotion Science (Eng. Japan Society for the Promotion of Science and the Japan international cooperation Agency and the Ministry of environment, Mining and Spatial planning of the Republic of Serbia. Influence of season on the level of pollutants in soil and water, the impact on water quality in the river Timok and the River Danube, was conducted during first three periods of project. This paper presents the results of the third study period. The third period of research, which was conducted over a period of 17. 10. 2012 to 17. 01.2013 year, included a review of pollution sources and define their
İçme ve sulama sularında bor kirliliği ve bor giderme yöntemleri
Directory of Open Access Journals (Sweden)
Meltem Bilici Başkan
2014-03-01
Full Text Available Periyodik cetvelin 3A grubunda yer alan bor yüksek iyonlaşma potansiyeline sahip olması nedeniyle yarı metal olarak kabul edilir. Yerkabuğundaki ortalama bor konsantrasyonu 10 mg/kg'dır. Bor doğada Ca, Na ve Mg'un tuzları şeklinde bulunur. Yüksek konsantrasyonlarda ve ekonomik boyutlardaki bor yatakları; borun oksijen ile bağlanmış bileşikleri şeklinde daha çok Türkiye ve ABD'nin kurak, volkanik ve hidrotermal aktivitesi olan bölgelerinde bulunmaktadır. Bor, bitkiler için gerekli bir mikro besin elementi olmanın yanı sıra, gerekli tüm besin elementleri içerisinde, eksiklik belirtilerine neden olan miktarı ile toksik etki yapan miktarı, birbirine çok yakın olan tek elementtir. Bor su ortamında genellikle borik asit ve kısmen de borat tuzları formlarında bulunmaktadır. Pek çok endüstride kullanım alanı bulan bor bileşiklerinin endüstriyel gelişmelere bağlı olarak yüzeysel sularda bulunan konsantrasyonu artış göstermektedir. Yüzeysel sularda bulunan bor aynı zamanda evsel atıksulardan da kaynaklanmaktadır. Türkiye'de içme ve sulama sularını en çok kirleten toksik elementlerin başında bor gelmektedir. Bu nedenle bor giderimi hem insan sağlığı açısından hem de sağlıklı tarım ürünü yetiştirilebilmesi açısından oldukça önemlidir. Sulardan bor giderimi için uygulanan temel yöntemler arasında iyon değişimi, ultrafiltrasyon, ters osmoz ve adsorbsiyon gelmektedir.
Functional characterization of Citrus macrophylla BOR1 as a boron transporter.
Cañon, Paola; Aquea, Felipe; Rodríguez-Hoces de la Guardia, Amparo; Arce-Johnson, Patricio
2013-11-01
Plants have evolved to develop an efficient system of boron uptake and transport using a range of efflux carriers named BOR proteins. In this work we isolated and characterized a boron transporter of citrus (Citrus macrophylla), which was named CmBOR1 for its high homology to AtBOR1. CmBOR1 has 4403 bp and 12 exons. Its coding region has 2145 bp and encodes for a protein of 714 amino acids. CmBOR1 possesses the molecular features of BORs such as an anion exchanger domain and the presence of 10 transmembrane domains. Functional analysis in yeast indicated that CmBOR1 has an efflux boron transporter activity, and transformants have increased tolerance to excess boron. CmBOR1 is expressed in leaves, stem and flowers and shows the greatest accumulation in roots. The transcript accumulation was significantly increased under boron deficiency conditions in shoots. In contrast, the accumulation of the transcript did not change in boron toxicity conditions. Finally, we observed that constitutive expression of CmBOR1 was able to increase tolerance to boron deficiency conditions in Arabidopsis thaliana, suggesting that CmBOR1 is a xylem loading boron transporter. Based on these results, it was determined that CmBOR1 encodes a boric acid/borate transporter involved in tolerance to boron deficiency in plants. © 2013 Scandinavian Plant Physiology Society.
Evaluation of BOR-60 operation safety
International Nuclear Information System (INIS)
Minakov, A.A.; Antipin, G.K.; Efimov, V.N.; Kuzin, G.G.; Eschenko, L.V.; Eschenko, S.N.
1987-12-01
In this communication, BOR-60 reactor operation anomalies capable to produce a dangerous overheating of the core (SDC) is examined. On bases of calculations and reactor operation experience an event tree for SDC is built. Evaluations of probable anomalies entering in the event tree and reactor parameters modifications in case of anomalies are presented. In conclusion BOR-60 agree with the sovietic nuclear safety [fr
Geoecology of a forest watershed underlain by serpentine in Central Europe
Pavel Krám; Filip Oulehle; Veronika Štedrá; Jakub Hruška; James B. Shanley; Rakesh Minocha; Elena. Traister
2009-01-01
The geoecology of a serpentinite-dominated site in the Czech Republic was investigated by rock, soil, water, and plant analyses. The 22-ha Pluhuv Bor watershed is almost entirely forested by a nearly 110-year old plantation of Picea abies (Norway Spruce) mixed with native Pinus sylvestris (Scots Pine) in the highest elevations...
Optimization of heavy metals total emission, case study: Bor (Serbia)
Ilić, Ivana; Bogdanović, Dejan; Živković, Dragana; Milošević, Novica; Todorović, Boban
2011-07-01
The town of Bor (Serbia) is one of the most polluted towns in southeastern Europe. The copper smelter which is situated in the centre of the town is the main pollutant, mostly because of its old technology, which leads to environmental pollution caused by higher concentrations of SO 2 and PM 10. These facts show that the word is about a very polluted region in Europe which, apart from harming human health in the region itself, poses a particular danger for wider area of southeastern Europe. Optimization of heavy metal's total emission was undertaken because years of long contamination of the soil with heavy metals of anthropogenic origin created a danger that those heavy metals may enter the food chains of animals and people, which can lead to disastrous consequences. This work represents the usage of Geographic Information System (GIS) for establishing a multifactor assessment model to quantitatively divide polluted zones and for selecting control sites in a linear programming model, combined with PROMETHEE/GAIA method, Screen View modeling system, and linear programming model. The results show that emissions at some control sites need to be cut for about 40%. In order to control the background of heavy metal pollution in Bor, the ecological environment must be improved.
Calculated investigation of actinide transmutation in the BOR-60 reactor
International Nuclear Information System (INIS)
Zhemkov, I.Yu.; Ishunina, O.V.; Yakovleva, I.V.
2000-01-01
One of the prospective actinide burner reactor type is the fast reactor with a 'hard' spectrum and small breeding factor, which is the BOR-60. The calculated investigations demonstrate that Loading up to 40% of minor-actinides to the BOR-60 reactor did not lead to the considerable change of neutron-physical characteristics. The performed calculations show that the BOR- 60 reactor possesses a high efficiency of the minor-actinide and plutonium bum-up (up to 37 kg/(TW · h)) hat is comparable with properties of the actinide burner-reactors under design. The BOR-60 reactor can provide a homogeneous minor-actinide Loading (minor-actinide addition to the standard fuel) to the core and heterogeneous Loading (as separate assemblies-targets with a high minor-actinide fraction) to the first rows of a radial blanket that allows the optimum usage of the reactor and its characteristics. (authors)
One-Step Leapfrog LOD-BOR-FDTD Algorithm with CPML Implementation
Directory of Open Access Journals (Sweden)
Yi-Gang Wang
2016-01-01
Full Text Available An unconditionally stable one-step leapfrog locally one-dimensional finite-difference time-domain (LOD-FDTD algorithm towards body of revolution (BOR is presented. The equations of the proposed algorithm are obtained by the algebraic manipulation of those used in the conventional LOD-BOR-FDTD algorithm. The equations for z-direction electric and magnetic fields in the proposed algorithm should be treated specially. The new algorithm obtains a higher computational efficiency while preserving the properties of the conventional LOD-BOR-FDTD algorithm. Moreover, the convolutional perfectly matched layer (CPML is introduced into the one-step leapfrog LOD-BOR-FDTD algorithm. The equation of the one-step leapfrog CPML is concise. Numerical results show that its reflection error is small. It can be concluded that the similar CPML scheme can also be easily applied to the one-step leapfrog LOD-FDTD algorithm in the Cartesian coordinate system.
Eogenetic caves in conglomerate: an example from Udin Boršt, Slovenia
Directory of Open Access Journals (Sweden)
Lipar Matej
2011-01-01
Full Text Available Udin Boršt is a karstified terrace of carbonate rock, which is of fluvioglacial origin, and is situated in the north-western part of Slovenia. There are 15 registered caves, which have been interpreted as caves in conglomerate, while karst of Udin Boršt itself was interpreted as conglomerate karst, shallow karst or isolated karst. In this article, caves in Udin Boršt have been interpreted as eogenetic caves. Based on porosity and bedding material, different types of caves and cave passages have developed. Four general types of eogenetic caves found in Udin Boršt are; linear stream caves, shelter caves, breakdown caves and vadose shafts.
MARKETING MIX BY BED OCCUPANCY RATIO (BOR
Directory of Open Access Journals (Sweden)
Abdul Muhith
2017-04-01
Full Text Available Introduction: Bed Occupancy Ratio (BOR in RSI Arafah Mojosari during the last three years are at under ideal rate and the lowest of the three existing hospitals in the area of Mojosari. The purpose of this study was to determine the relationship marketing mix with Bed Occupancy Ratio in RSI Arafah Mojosari. Methods: This research uses analytic methods with crossectional approach. Variables in the study is marketing mix and Bed Occupancy Ratio (BOR. The population in this study were all patients hospitalized in the RSI Arafah Mojosari. Samples amounted 44 respondents taken by the Stratified random sampling technique. Data were collected using the questionnaire and analyzed using Fisher's Exact test. Result: The results obtained more than 50% of respondents (59.1% rate well against the marketing mix is developed by the hospital management and the majority of respondents (79.5% are in the treatment room that has a number BOR is not ideal. Fisher Exact test test results obtained probabililty value=0.02<0.05 so that H0 is rejected, which means there is a relationship marketing mix with the Bed Occupancy Ratio in RSI Arafah Mojosari. Discussion: Hospitals which able to develop the marketing mix very well, can attract consumers to use inpatient services at the hospital, with that BOR value will increase as the increased use of inpatient services. Hospital management must be able to formulate a good marketing mix strategy that hospital marketing objectives can be achieved. Conformity between service quality and service rates must be addressed, otherwise it extent of media promotions can attract patients to inpatient services.
Directory of Open Access Journals (Sweden)
Filimon M. N.
2016-01-01
Full Text Available The environmental impact of inorganic pollution is pronounced in water adjacent to Bor Copper Smelter Complex (RTB Bor, Serbia, with Cu, Zn, Pb, and As being the main determinants of aquatic pollution pattern. Communities of microorganisms present in the sediments are mainly affected by heavy metal pollution. Some groups of bacteria can be considered pollution bio-indicators, due to their sensibility and ability to bioaccumulate heavy metals, thus contributing to reducing pollution. This study investigates the relationships between trace element accumulation and heterogeneity in sediment bacteria community structure found in water streams adjacent to the Bor Copper Smelter Complex (RTB Bor, Serbia. Our results showed no contamination with copper, zinc, nickel, iron, and chromium, but did show a low to moderate contamination with lead and a moderate to high contamination with arsenic in aquatic sediments within the area of interest. Spatial heterogeneity in sediment-associated bacterial communities did not relate significantly to location of sampling sites, except for iron reducing bacteria. Iron reducing bacteria and nitrifying bacteria were the best distinguishing groups of bacteria. However, only iron reducing bacteria were significantly influenced by sampling locations. The iron reducing bacteria has correlated negatively with the degree of sediment contamination with lead, and therefore, we suggest that this group of bacteria could serve as potential bio-indicators of inorganic water contamination in Bor RTB area.
Possibilities of sustainable development the RTB Bor
Directory of Open Access Journals (Sweden)
Zeković Slavka
2006-01-01
Full Text Available The paper analysis the medium and long-term perspectives, framework and considered possibilities of sustainable development of RTB "Bor" in the period of transition. It is today the giant in the best quality copper production in the Balkans. In the paper are elaborated the problems of privatization, debt, investment, growth of copper production from own mines (and imported raw, opening of new mines, economical efficiency of production, environmental problems and impacts in the last time. The RTB "Bor" is a serious hot spot in Serbia. Unsustainability trends and process are identified, as follows: open-pit waste dumps, flotation tailings, mining and processing waste waters, air pollution; inefficiency useful of energy water and other inputs in copper complex; trans boundary character of emissions of dust; environmental degradation and quality of wide area and ecologically highly risk, etc.
Directory of Open Access Journals (Sweden)
N. V. Miroshnik
2016-01-01
Full Text Available Pine forests Chigirinsky Bor grow on fresh sod-podzolic soils formed on ancient alluvial deposits. Pine forests are characterized by stringent moisture regimes and constantly suffer from lack of productive moisture in soil. Industrial development of Cherkasy in 60th years of ХХ century leaded air pollution and emissions of SO2, NOx, NH3, and dust. This contributed to significant negative influence on the surrounding forest ecosystems from enterprises of Cherkassy industrial agglomeration. The grass cover in pine stands of Chigirinsky Bor transforms into xerophytic grasses and ruderal communities under the impact of negative biotic and abiotic factors. They are namely the anthropogenic violation of forest conditions, stands decline, recreational and industrial tree crowns understocking, xerophytic and heliophytic transformations of forest conditions. All the above mentioned caused strong ruderal and adventive transformation of grass cover. We registered the changes in nitrophilous plant spread regards the Cherkasy industrial agglomeration approaching which emits toxic with nitrogen-containing gases. Adventive and other non-forest species displace ferns and mosses, the ratio of ecomorfs is also changes due to increase of the quantity and development activation of annuals, xerophytic, ruderal, and nitrofil plants. The Asteraceae/Brassicaceae 3:1 ratio indicates significant anthropogenic violations in the region. We fixed the xerophytic, ruderal, and adventive transformation of grass cover in forest ecosystems. It is also founded the tendency of expanding the fraction of mesophilic plant species due to alterations in water regime (creation of Kremenchug reservoir and draining of floodplain Tyasmyn. When approaching the Cherkasy industrial agglomeration the grass cover degradation is clearly observed on the environmental profile. All this causes the forest ecosystem degradation and gradual loss of forest vegetation typical characteristics. We
Wakuta, Shinji
2015-01-24
Boron (B) is an essential micronutrient for plants but is toxic when accumulated in excess. The plant BOR family encodes plasma membrane-localized borate exporters (BORs) that control translocation and homeostasis of B under a wide range of conditions. In this study, we examined the evolutionary divergence of BORs among terrestrial plants and showed that the lycophyte Selaginella moellendorffii and angiosperms have evolved two types of BOR (clades I and II). Clade I includes AtBOR1 and homologs previously shown to be involved in efficient transport of B under conditions of limited B availability. AtBOR1 shows polar localization in the plasma membrane and high-B-induced vacuolar sorting, important features for efficient B transport under low-B conditions, and rapid down-regulation to avoid B toxicity. Clade II includes AtBOR4 and barley Bot1 involved in B exclusion for high-B tolerance. We showed, using yeast complementation and B transport assays, that three genes in S. moellendorffii, SmBOR1 in clade I and SmBOR3 and SmBOR4 in clade II, encode functional BORs. Furthermore, amino acid sequence alignments identified an acidic di-leucine motif unique in clade I BORs. Mutational analysis of AtBOR1 revealed that the acidic di-leucine motif is required for the polarity and high-B-induced vacuolar sorting of AtBOR1. Our data clearly indicated that the common ancestor of vascular plants had already acquired two types of BOR for low- and high-B tolerance, and that the BOR family evolved to establish B tolerance in each lineage by adapting to their environments. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists.
The choice of forest site for recreation
DEFF Research Database (Denmark)
Agimass, Fitalew; Lundhede, Thomas; Panduro, Toke Emil
2018-01-01
logit as well as a random parameter logit model. The variables that are found to affect the choice of forest site to a visit for recreation include: forest area, tree species composition, forest density, availability of historical sites, terrain difference, state ownership, and distance. Regarding......In this paper, we investigate the factors that can influence the site choice of forest recreation. Relevant attributes are identified by using spatial data analysis from a questionnaire asking people to indicate their most recent forest visits by pinpointing on a map. The main objectives...
New evidence for prehistoric copper metallurgy in the vicinity of Bor
Directory of Open Access Journals (Sweden)
Kapuran Aleksandar
2016-01-01
Full Text Available The last three years of archaeological investigations at the site Ru`ana in Banjsko Polje, in the immediate vicinity of Bor, have provided new evidence regarding the role of non-ferrous metallurgy in the economy of the prehistoric communities of north-eastern Serbia. The remains of metallurgical furnaces and a large amount of metallic slags at two neighbouring sites in the mentioned settlement reveal that locations with many installations for the thermal processing of copper ore existed in the Bronze Age. We believe, judging by the finds of material culture, that metallurgical activities in this area also continued into the Iron Age and, possibly, into the 4th century AD. [Projekat Ministarstva nauke Republike Srbije, br. 177020: Archaeology of Serbia: Cultural identity, integration factors, technological processes and the role of the central Balkans in the development of European prehistory
Yamauchi, Noboru; Gosho, Tadashi; Asatuma, Satoru; Toyooka, Kiminori; Fujiwara, Toru; Matsuoka, Ken
2013-01-01
In Arabidopsis the borate transporter BOR1, which is located in the plasma membrane, is degraded in the presence of excess boron by an endocytosis-mediated mechanism. A similar mechanism was suggested in rice as excess boron decreased rice borate transporter levels, although in this case whether the decrease was dependent on an increase in degradation or a decrease in protein synthesis was not elucidated. To address whether the borate-dependent degradation mechanism is conserved among plant cells, we analyzed the fate of GFP-tagged BOR1 (BOR1-GFP) in transformed tobacco BY-2 cells. Cells expressing BOR1-GFP displayed GFP fluorescence at the plasma membrane, especially at the membrane between two attached cells. The plasma membrane signal was abolished when cells were incubated in medium with a high concentration of borate (3 to 5 mM). This decrease in BOR1-GFP signal was mediated by a specific degradation of the protein after internalization by endocytosis from the plasma membrane. Pharmacological analysis indicated that the decrease in BOR1-GFP largely depends on the increase in degradation rate and that the degradation was mediated by a tyrosine-motif and the actin cytoskeleton. Tyr mutants of BOR1-GFP, which has been shown to inhibit borate-dependent degradation in Arabidopsis root cells, did not show borate-dependent endocytosis in tobacco BY-2 cells. These findings indicate that the borate-dependent degradation machinery of the borate transporter is conserved among plant species.
In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species
Directory of Open Access Journals (Sweden)
Ertuğrul Filiz
2013-01-01
Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.
Energy Technology Data Exchange (ETDEWEB)
Chen, Y.; Chopra, O. K.; Soppet, W. K.; Shack, W. J.; Yang, Y.; Allen, T. R.; Univ. of Wisconsin at Madison
2010-02-16
Cracking behavior of stainless steels specimens irradiated in the BOR-60 at about 320 C is studied. The primary objective of this research is to improve the mechanistic understanding of irradiation-assisted stress corrosion cracking (IASCC) of core internal components under conditions relevant to pressurized water reactors. The current report covers several baseline tests in air, a comparison study in high-dissolved-oxygen environment, and TEM characterization of irradiation defect structure. Slow strain rate tensile (SSRT) tests were conducted in air and in high-dissolved-oxygen (DO) water with selected 5- and 10-dpa specimens. The results in high-DO water were compared with those from earlier tests with identical materials irradiated in the Halden reactor to a similar dose. The SSRT tests produced similar results among different materials irradiated in the Halden and BOR-60 reactors. However, the post-irradiation strength for the BOR-60 specimens was consistently lower than that of the corresponding Halden specimens. The elongation of the BOR-60 specimens was also greater than that of their Halden specimens. Intergranular cracking in high-DO water was consistent for most of the tested materials in the Halden and BOR-60 irradiations. Nonetheless, the BOR-60 irradiation was somewhat less effective in stimulating IG fracture among the tested materials. Microstructural characterization was also carried out using transmission electron microscopy on selected BOR-60 specimens irradiated to {approx}25 dpa. No voids were observed in irradiated austenitic stainless steels and cast stainless steels, while a few voids were found in base and grain-boundary-engineered Alloy 690. All the irradiated microstructures were dominated by a high density of Frank loops, which varied in mean size and density for different alloys.
Yoshinari, Akira; Fujimoto, Masaru; Ueda, Takashi; Inada, Noriko; Naito, Satoshi; Takano, Junpei
2016-09-01
Boron (B) is essential for plants but toxic in excess. The borate efflux transporter BOR1 is expressed in various root cells and localized to the inner/stele-side domain of the plasma membrane (PM) under low-B conditions. BOR1 is rapidly degraded through endocytosis upon sufficient B supply. The polar localization and degradation of BOR1 are considered important for efficient B translocation and avoidance of B toxicity, respectively. In this study, we first analyzed the subcellular localization of BOR1 in roots, cotyledons and hypocotyls, and revealed a polar localization in various cell types. We also found that the inner polarity of BOR1 is established after completion of cytokinesis in the root meristem. Moreover, variable-angle epifluorescence microscopy visualized BOR1-green fluorescent protein (GFP) as particles in the PM with significant lateral movements but in restricted areas. Importantly, a portion of BOR1-GFP particles co-localized with DYNAMIN-RELATED PROTEIN 1A (DRP1A), which is involved in scission of the clathrin-coated vesicles, and they disappeared together from the PM. To examine the contribution of DRP1A-mediated endocytosis to BOR1 localization and degradation, we developed an inducible expression system of the DRP1A K47A variant. The DRP1A variant prolonged the residence time of clathrin on the PM and inhibited endocytosis of membrane lipids. The dominant-negative DRP1A blocked endocytosis of BOR1 and disturbed its polar localization and B-induced degradation. Our results provided insight into the endocytic mechanisms that modulate the subcellular localization and abundance of a mineral transporter for nutrient homeostasis in plant cells. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.
Information system of forest growth and productivity by site quality type and elements of forest
Khlyustov, V.
2012-04-01
Information system of forest growth and productivity by site quality type and elements of forest V.K. Khlustov Head of the Forestry Department of Russian State Agrarian University named after K.A.Timiryazev doctor of agricultural sciences, professor The efficiency of forest management can be improved substantially by development and introduction of principally new models of forest growth and productivity dynamics based on regionalized site specific parameters. Therefore an innovative information system was developed. It describes the current state and gives a forecast for forest stand parameters: growth, structure, commercial and biological productivity depend on type of site quality. In contrast to existing yield tables, the new system has environmental basis: site quality type. The information system contains set of multivariate statistical models and can work at the level of individual trees or at the stand level. The system provides a graphical visualization, as well as export of the emulation results. The System is able to calculate detailed description of any forest stand based on five initial indicators: site quality type, site index, stocking, composition, and tree age by elements of the forest. The results of the model run are following parameters: average diameter and height, top height, number of trees, basal area, growing stock (total, commercial with distribution by size, firewood and residuals), live biomass (stem, bark, branches, foliage). The system also provides the distribution of mentioned above forest stand parameters by tree diameter classes. To predict the future forest stand dynamics the system require in addition the time slot only. Full set of forest parameters mention above will be provided by the System. The most conservative initial parameters (site quality type and site index) can be kept in the form of geo referenced polygons. In this case the system would need only 3 dynamic initial parameters (stocking, composition and age) to
Aspects of energy reduction by autogenous copper production in the copper smelting plant Bor
International Nuclear Information System (INIS)
Najdenov, Ivan; Raić, Karlo T.; Kokeza, Gordana
2012-01-01
This work presents a comparative analysis of the energy consumption during copper production by the “standard” procedure (roasting in a fluo–solid reactor and smelting in a reverberatory furnace) in the Smelting Plant in Bor with modern autogenous procedures. All forms of expended energy were reduced to primary energy or to the same energy form, i.e., to the energy equivalent of the process (EEP), the raw material and the process materials. In addition, the energy equivalent of the process and waste products (water vapour, thermal energy and similar) were balanced. To complete the consumption of all energy generating products in copper production, they were reduced to conditional fuel (coal equivalent = 29.3 MJ/kg). Additionally, this study suggests replacement of the existing technology by an appropriate autogenous procedure and considers the prospects for further development of mining and metallurgy in Bor. Estimates of development perspectives for copper production should be comprehensive, based on complete and relevant data, as well as on real considerations of future development in world production. -- Highlights: ► “Standard” autogenous copper production in the Smelting Plant, Bor, Serbia. ► Comparation of energy consumption in “standard” with other autogenous procedures. ► All forms of energy are reduced to energy equivalent and conditional fuel. ► Replacement of existing technology with the appropriate autogenous procedure. ► Perspectives of further development of mining and metallurgy in Bor.
Necropolis on Bor lake: New reports on Bronze age burial
Directory of Open Access Journals (Sweden)
Kapuran Aleksandar
2011-01-01
Full Text Available This article deals with the social and anthropological aspects of burial rituals during the Middle Bronze Age in Timočka Krajina. Decades of systematic research of necropolises and reconnaissance in the basin of the Crni Timok proved an increase in number of sites around ore - rich areas of the east Kučaj mountains as well as around Romuliana site and the fertile valleys of Džanovo polje (Map. 1. The quantitative increase in settlements was reflected by the emergence of large necropolises, only three of which have been systematically explored; those in Trnjani, Magura and Bor Lake (Fig. 1; Plan 1. Analysis of geographical features of many settlements and their position in relation to natural resources helped define two communities, one of which carried out mining and metallurgical activities, while the other group engaged in the production of food. Both groups lived in the immediate vicinity and mutual dependence, functioning within a developed market for copper production. During the exploration of the necropolis near Bor Lake in 1997, the remains of burnt skeletons were collected from burial structures 2/97 and 13/97 (Fig. 2; Plans 2 and 3. Anthropological analysis of the cremated remains of the deceased showed that high temperatures were used during the cremation process, which we assume could have only been achieved in metallurgical furnaces. This is confirmed by the fact that the skeletal fragments contain traces of melted metal, as well as finds of bronze slag inside urns and grave structures in the necropolis in Trnjani (Figs. 3 and 4; Tables 1-4. Burial ritual of this kind was not proved by systematic archaeological research of necropolises in the basin of Crni Timok, although anthropological data collected from necropolises linked to metallurgical settlements may indicate some guidelines in the ritual cremation of prominent members of these communities. [Projekat Ministarstva nauke Republike Srbije, br. 177020: Arheologija Srbije
Transgenic tobacco plants expressing BoRS1 gene from Brassica ...
Indian Academy of Sciences (India)
Water stress is by far the leading environmental stress limiting crop yields worldwide. Genetic engineering techniques hold great promise for developing crop cultivars with high tolerance to water stress. In this study, the Brassica oleracea var. acephala BoRS1 gene was transferred into tobacco through ...
A new approach to the spectral analysis of liquid membrane oscillators by Gábor transformation
DEFF Research Database (Denmark)
Płocharska-Jankowska, E.; Szpakowska, M.; Mátéfi-Tempfli, Stefan
2006-01-01
Liquid membrane oscillators very frequently have an irregular oscillatory behavior. Fourier transformation cannot be used for these nonstationary oscillations to establish their power spectra. This important point seems to be overlooked in the field of chemical oscillators. A new approach...... is presented here based on Gábor transformation allowing one to obtain power spectra of any kind of oscillations that can be met experimentally. The proposed Gábor analysis is applied to a liquid membrane oscillator containing a cationic surfactant. It was found that the power spectra are strongly influenced...
Structure of Bor1 supports an elevator transport mechanism for SLC4 anion exchangers.
Thurtle-Schmidt, Bryan H; Stroud, Robert M
2016-09-20
Boron is essential for plant growth because of its incorporation into plant cell walls; however, in excess it is toxic to plants. Boron transport and homeostasis in plants is regulated in part by the borate efflux transporter Bor1, a member of the solute carrier (SLC) 4 transporter family with homology to the human bicarbonate transporter Band 3. Here, we present the 4.1-Å resolution crystal structure of Arabidopsis thaliana Bor1. The structure displays a dimeric architecture in which dimerization is mediated by centralized Gate domains. Comparisons with a structure of Band 3 in an outward-open state reveal that the Core domains of Bor1 have rotated inwards to achieve an occluded state. Further structural comparisons with UapA, a xanthine transporter from the nucleobase-ascorbate transporter family, show that the downward pivoting of the Core domains relative to the Gate domains may access an inward-open state. These results suggest that the SLC4, SLC26, and nucleobase-ascorbate transporter families all share an elevator transport mechanism in which alternating access is provided by Core domains that carry substrates across a membrane.
Öztürk, Melih; Bolat, İlyas
2014-04-01
This study investigates the effects of forest transformation into recreation site. A fragment of a Pinus pinaster plantation forest was transferred to a recreation site in the city of Bartın located close to the Black Sea coast of northwestern Turkey. During the transformation, some of the trees were selectively removed from the forest to generate more open spaces for the recreationists. As a result, Leaf Area Index (LAI) decreased by 0.20 (about 11%). Additionally, roads and pathways were introduced into the site together with some recreational equipment sealing parts of the soil surface. Consequently, forest environment was altered with a semi-natural landscape within the recreation site. The purpose of this study is to assess the effects of forest transformation into recreation site particularly in terms of the LAI parameter, forest floor, and soil properties. Preliminary monitoring results indicate that forest floor biomass is reduced by 26% in the recreation site compared to the control site. Soil temperature is increased by 15% in the recreation site where selective removal of trees expanded the gaps allowing more light transmission. On the other hand, the soil bulk density which is an indicator of soil compaction is unexpectedly slightly lower in the recreation site. Organic carbon (C(org)) and total nitrogen (N(total)) together with the other physical and chemical parameter values indicate that forest floor and soil have not been exposed to much disturbance. However, subsequent removal of trees that would threaten the vegetation, forest floor, and soil should not be allowed. The activities of the recreationists are to be concentrated on the paved spaces rather than soil surfaces. Furthermore, long-term monitoring and management is necessary for both the observation and conservation of the site.
International Nuclear Information System (INIS)
Gryazev, V.M.; Gadzhiev, G.I.; Alekseev, I.N.
1979-01-01
Under a contract with the International Atomic Energy Agency, the V.I. Lenin Atomic Reactor Research Institute is currently carrying out a study of ways of organizing a nuclear materials accounting and control system for the BOR-60 fast reactor. Some results of this study are presented in the paper. The special physical and technological features of fast reactors create additional difficulties in safeguards systems and give rise to a number of new possibilities for the illicit removal of nuclear materials. These questions are discussed with reference to the BOR-60 reactor but the conclusions are probably applicable to all fast reactors. The proposed accounting and control system is based on non-destructive measurements of the amount of fissile materials in the operating fuel assemblies and screened bundles of the reactor, on the independent control of the principal facility parameters (a list of which is given) and on an automated information collection and evaluation system. Visual means of inspection can be very effective in fast reactor safeguards systems, especially for controlling storage, but they are not used with the BOR-60 reactor. (author)
Wakuta, Shinji; Mineta, Katsuhiko; Amano, Taro; Toyoda, Atsushi; Fujiwara, Toru; Naito, Satoshi; Takano, Junpei
2015-01-01
Boron (B) is an essential micronutrient for plants but is toxic when accumulated in excess. The plant BOR family encodes plasma membrane-localized borate exporters (BORs) that control translocation and homeostasis of B under a wide range
A hypothetical severe reactor accident in Sosnovyj Bor, Russia
International Nuclear Information System (INIS)
Lahtinen, J.; Toivonen, H.; Poellaenen, R.; Nordlund, G.
1993-12-01
Individual doses and short-term radiological consequences from a hypothetical severe accident at the Russian nuclear power plant in Sosnovyj Bor were estimated for two sites in Finland. The sites are Kotka, located 140 km from the plant, and Helsinki, 220 km from the plant. The release was assumed to start immediately after the shutdown of the reactor (a 1000 MW RBMK unit) which had been operating at nominal power level for a long time. An effective release height of 500 m was assumed. The prevailing meteorological conditions during the release were taken to present the situation typical of the area (effective wind speed 9 m/s, neutral dispersion conditions). The release fractions applied in the study were of the same order as in the Chernobyl accident, i.e. 100% for noble gases, 60% for iodines, 40% for cesium and 1-10% for other radiologically important nuclides. The release was assumed to last 24 hours. However, half of the nuclides were released during the first hour. No attention was paid to the actual sequence of events that could lead to such release characteristics and time behaviour. The concentration and dose calculations were performed with a modified version of the computer code OIVA developed in Finnish Centre for Radiation and Nuclear Safety. Inhalation dose and external doses from the release plume and from the deposited activity were calculated for adults only, and no sheltering was considered. (11 refs., 4 figs., 6 tabs.)
2012-02-28
... Invasive Plant Treatment Project and Forest Plan Amendment Number 28 AGENCY: Forest Service, USDA. ACTION... Forest. The current Forest-wide treatment approach pre-dates the Pacific Northwest Region Invasive Plant... interdisciplinary analysis: (1) Whether or not to authorize site- specific invasive plant treatments using...
Stefańska-Krzaczek, Ewa; Pech, Paweł
2014-01-01
The utility of phytocenotic indices in the diagnosis and classification of forest sites might be limited because of vegetation degeneration in managed forests. However, even in secondary communities it may be possible to determine indicator species, although these may differ from typical and well known plant indicators. The aim of this work was to assess the vegetation diversity of Scots pine stands in representative forest site types along a moisture and fertility gradient. In total ...
Finanční analýza podniku BRISK Tábor, a.s.
Hašek, Jan
2008-01-01
Diploma is focused on Financial analysis, importance of it, users, implementation analysis on factual company -- BRISK Tábor, a.s., evaluation based on analysis financial statements, ratio indicators, working capital, balance order, scheme of indicators, analysis of financial arm and comparison intercompany.
DEFF Research Database (Denmark)
Collalti, A.; Marconi, S.; Ibrom, Andreas
2016-01-01
This study evaluates the performances of the new version (v.5.1) of 3D-CMCC Forest Ecosystem Model (FEM) in simulating gross primary productivity (GPP), against eddy covariance GPP data for 10 FLUXNET forest sites across Europe. A new carbon allocation module, coupled with new both phenological...... over Europe without a site-related calibration, the model has been deliberately parametrized with a single set of species-specific parametrizations for each forest ecosystem. The model consistently reproduces both in timing and in magnitude daily and monthly GPP variability across all sites...... sites we evaluate whether a more accurate representation of forest structural characteristics (i.e. cohorts, forest layers) and species composition can improve model results. In two of the three sites results reveal that model slightly increases its performances although, statistically speaking...
2011-11-17
... Settlement; River Forest Dry Cleaners Site, River Forest, Cook County, IL AGENCY: Environmental Protection... response costs concerning the River Forest Dry Cleaners site in River Forest, Cook County, Illinois with... code: C-14J, Chicago, Illinois 60604. Comments should reference the River Forest Dry Cleaners Site...
Shear Punch Testing of BOR-60 Irradiated TEM Specimens
Energy Technology Data Exchange (ETDEWEB)
Saleh, Tarik A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Quintana, Matthew Estevan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Romero, Tobias J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-06-13
As a part of the project “High Fidelity Ion Beam Simulation of High Dose Neutron Irradiation” an Integrated Research Program (IRP) project from the U.S. Department of Energy, Nuclear Energy University Programs (NEUP), TEM geometry samples of ferritic cladding alloys, Ni based super alloys and model alloys were irradiated in the BOR-60 reactor to ~16 dpa at ~370°C and ~400°C. Samples were sent to Los Alamos National Laboratory and subjected to shear punch testing. This report presents the results from this testing.
Directory of Open Access Journals (Sweden)
Noboru Yamauchi
2013-09-01
Full Text Available In Arabidopsis the borate transporter BOR1, which is located in the plasma membrane, is degraded in the presence of excess boron by an endocytosis-mediated mechanism. A similar mechanism was suggested in rice as excess boron decreased rice borate transporter levels, although in this case whether the decrease was dependent on an increase in degradation or a decrease in protein synthesis was not elucidated. To address whether the borate-dependent degradation mechanism is conserved among plant cells, we analyzed the fate of GFP-tagged BOR1 (BOR1-GFP in transformed tobacco BY-2 cells. Cells expressing BOR1-GFP displayed GFP fluorescence at the plasma membrane, especially at the membrane between two attached cells. The plasma membrane signal was abolished when cells were incubated in medium with a high concentration of borate (3 to 5 mM. This decrease in BOR1-GFP signal was mediated by a specific degradation of the protein after internalization by endocytosis from the plasma membrane. Pharmacological analysis indicated that the decrease in BOR1-GFP largely depends on the increase in degradation rate and that the degradation was mediated by a tyrosine-motif and the actin cytoskeleton. Tyr mutants of BOR1-GFP, which has been shown to inhibit borate-dependent degradation in Arabidopsis root cells, did not show borate-dependent endocytosis in tobacco BY-2 cells. These findings indicate that the borate-dependent degradation machinery of the borate transporter is conserved among plant species.
Finanční analýza podniku IDEAL AUTOMOTIVE Bor, s.r.o.
Velebová, Štěpánka
2009-01-01
The aim of this bachelor thesis is to identify the financial situation of IDEAL AUTOMOTIVE Bor, Ltd., determine the strenghts and weaknesses of the company, and suggest some ideas of what to do in the future, so that the company could prosper
Directory of Open Access Journals (Sweden)
Renata Kovačević
2010-09-01
Full Text Available In this paper, the levels of twenty one elements (Ag, Al, As, B, Ba, Ca, Cd, Cr, Cu, Fe, K, Mg, Mn, Mo, Na, Ni, Pb, S, Se, Sr and Zn in PM10 are presented, as well as SO2 concentration, measured at the sampling site in an urban area of the town of Bor (40,000 inhabitants in eastern Serbia. The sampling site was located in a densely populated city center about 0.65 km away from one of the largest copper mines and copper smelters in Europe. For the first time PM10 was collected using the European standard sampler, during a preliminary campaign in duration of 7 days in early spring 2009. PM10 were sampled on PTFE membrane filters and element concentrations were quantified by GF AAS and ICP AES. Concentration levels and correlations within trace elements, PM10 and SO2 indicated that industrial activities underpinned with meteorological conditions of low wind speed (calm are the main factors that influence air pollution in a densely populated area. It was evident that both PM10 mass concentration and SO2 concentration once exceeded the daily limit values during a measuring period of seven days. Strong relationship was found between PM10 and Mn, Mg, Ca and B daily average concentrations. On the other hand, SO2 correlated strongly with As, Pb, Cd, Cu and S daily average concentrations. These results confirm the relationship between emissions of SO2 from the Copper Smelter Bor and calm meteorological conditions (wind speed less than 0.5 m/sec with the concentration levels of carcinogenic substances of arsenic, lead and cadmium in ambient air.
Coeli M. Hoover; James E. Smith
2012-01-01
The documented role of United States forests in sequestering carbon, the relatively low cost of forest-based mitigation, and the many co-benefits of increasing forest carbon stocks all contribute to the ongoing trend in the establishment of forest-based carbon offset projects. We present a broad analysis of forest inventory data using site quality indicators to provide...
Peculiarities of 137Cs accumulation by macromycetes in dry bors of Ukrainian Polessye
International Nuclear Information System (INIS)
Orlov, O.O.; Kurbet, T.B.; Kalyish, O.B.; Prishchepa, O.L.
2001-01-01
The main ecological peculiarities of dry bor in Ukrainian Polessye were given. Research were carried out in Central Polessie of Ukraine during 1997 - 1999. Results were obtained due to spectrometric measurement of specific activity of 137 Cs in fruit bodies of mushrooms and in the soil. Species composition of macromycetes was divided on homogeneous groups on intensity of 13 7Cs accumulation. Amanita porphyria, A. muscaria and Tricholoma portentosum belong to the group of weak 137 Cs accumulation from the soil (TF = 15 - 20); Amanita pantherina, A. phalloides, Cantharellus cibarius, Boletus edulis, Tricholoma flavovirens and Laccaria laccata - to the group of moderate radionuclide accumulation (TF = 30 - 55). The group of strong 137 Cs accumulation (TF = 100 - 180) consists of Suillus variegates, S. bovines and Hydnum imbricatum; and group of very strong accumulation (TF 200 - 280) - of Xerocomus badius, Lactarius rufus, Russula xerampelina, Cortinarius varius and Paxillus involutus. Cortinarius sanguineus (with TF 400) is an accumulator of 137 Cs. Comparative evaluation of dry bor was given from the point of view of purchase of edible macromycetes in it
LBA-ECO CD-04 Dendrometry, km 83 Tower Site, Tapajos National Forest, Brazil
National Aeronautics and Space Administration — A dendrometry study was conducted at the logged forest tower site, km 83 site, Tapajos National Forest, Para, Brazil over a period of 4 years following the...
Mechanical site preparation for forest restoration
Magnus Lof; Daniel C. Dey; Rafael M. Navarro; Douglass F. Jacobs
2012-01-01
Forest restoration projects have become increasingly common around the world and planting trees is almost always a key component. Low seedling survival and growth may result in restoration failures and various mechanical site preparation techniques for treatment of soils and vegetation are important tools used to help counteract this. In this article, we synthesize the...
Directory of Open Access Journals (Sweden)
Julia Bock
2016-10-01
Full Text Available Csapody, Tamás. 2014. Bortól Szombathelyig - Tanulmányok a bori munkaszolgálatról és a bori munkaszolgálatosok részleges névlistája ('From Bor to Szombathely- Studies on the Forced Labor Service at Bor Camp and the Partial List of the Forced Laborers in Bor'. Budapest: Zrinyi Kadó. 254 pp. ; Csapody, Tamás. 2015. A Cservenkai tömeggyilkosság ('The Mass Murder at Cservenka'. Budapest: Zsidó Tudományok Szabadegyeteme Alapítvány. 150 pp. (e-book; a shorter version is accessible at: http://zsido.com/konyvek/a-cservenkai-tomeggyilkossag/.
Directory of Open Access Journals (Sweden)
Birgit Reger
2015-05-01
Full Text Available Because of some land-use practices (such as overstocking with wild ungulates, historical clear-cuts for mining, and locally persisting forest pasture, protective forests in the montane vegetation belt of the Northern Limestone Alps are now frequently overaged and poorly structured over large areas. Windthrow and bark beetle infestations have generated disturbance areas in which forests have lost their protective functions. Where unfavorable site conditions hamper regeneration for decades, severe soil loss may ensue. To help prioritize management interventions, we developed a geographic information system-based model for assessing sensitivity to site degradation and applied it to 4 test areas in the Northern Limestone Alps of Austria and Bavaria. The model consists of (1 analysis of site conditions and forest stand structures that could increase sensitivity to degradation, (2 evaluation of the sensitivity of sites and stands, and (3 evaluation and mapping of mountain forests' sensitivity to degradation. Site conditions were modeled using regression algorithms with data on site parameters from pointwise soil and vegetation surveys as responses and areawide geodata on climate, relief, and substrate as predictors. The resulting predictor–response relationships were applied to test areas. Stand structure was detected from airborne laser scanning data. Site and stand parameters were evaluated according to their sensitivity to site degradation. Sensitivities of sites and stands were summarized in intermediate-scale sensitivity maps. High sensitivity was identified in 3 test areas with pure limestone and dolomite as the prevailing sensitivity level. Moderately sensitive forests dominate in the final test area, Grünstein, where the bedrock in some strata contains larger amounts of siliceous components (marl, mudstone, and moraines; degraded and slightly sensitive forests were rare or nonexistent in all 4 test areas. Providing a comprehensive overview
The influence of site factors on nitrogen mineralization in forest soils ...
African Journals Online (AJOL)
The influence of site factors on nitrogen mineralization in forest soils of the ... on N mineralization, as well as the effect of N mineralization on forest productivity. ... of the natural log of mean annual temperature, geological substrate and total N ...
Acoustic monitoring of the BOR-60 reactor circulating pump state
International Nuclear Information System (INIS)
Efimov, V.N.; Myntsov, A.A.
1988-01-01
Diagnostics methods for circulation pumps of the experimental BOR-60 fast reactor are described. The results of signal processing during a microcompain, as well as detected anomalies in pump operation in the earth stage are presented. Analysis carried out for an acoustic signal envelope has shown high efficiency of the method. When oscillations of a mechanical shaft are present, the envelope level increases 1.5 times. More detailed investigation is carried out by the analysis of the spectrum of the pump acoustic signal envelope. During abnormal operation there are peaks, corresponding to the circulation frequency, and harmonics multiple of it, in the spectrum. 6 figs
Characterization of BOR-60 Irradiated 14YWT-NFA1 Tubes
Energy Technology Data Exchange (ETDEWEB)
Saleh, Tarik A. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Maloy, Stuart Andrew [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Aydogan, Eda [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Quintana, Matthew Estevan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Romero, Tobias J. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-02-15
Tubes of FCRD 14YWT-NFA1 Alloy were placed in the BOR-60 reactor and irradiated under a fast flux neutron environment to two conditions: 7 dpa at 360-370 °C and 6 dpa at 385-430 °C. Small sections of the tube were cut and sent to UC Berkeley for nanohardness testing and focused ion beam (FIB) milling of TEM specimens. FIB specimens were sent back to LANL for final FIB milling and TEM imaging. Hardness data and TEM images are presented in this report. This is the first fast reactor neutron irradiated information on the 14YWT-NFA1 alloy.
Energy partitioning at treeline forest and tundra sites and its sensitivity to climate change
Energy Technology Data Exchange (ETDEWEB)
Lafleur, P.M. [Trent Univ., Peterborough, ON (Canada); Rouse, W.R. [McMaster Univ., Hamilton, ON (Canada)
1995-12-31
A study was conducted to examine the inter-annual variability in energy fluxes of treeline tundra and forest and to investigate the sensitivity of forest and tundra energy balances to climatic changes. A five year record of energy balance data from contiguous wetland tundra and subarctic forest sites near Churchill, Manitoba was analyzed. The data included snow free periods only. Wind direction was used as an analogue for changing climatic conditions where onshore winds are cooler and moister than offshore winds. Sensible and latent heat fluxes at both sites varied significantly between onshore and offshore wind regimes. The differences between onshore and offshore fluxes at the tundra site were larger than for the forest. The tundra-to-forest Bowen ratios decreased with increasing vapour pressure deficit and increasing air temperature. Results suggest that energy partitioning in the wetland tundra is more sensitive to climate change than in the treeline forests. 22 refs., 1 tab., 6 figs.
Nikolić, Djordje; Milošević, Novica; Mihajlović, Ivan; Zivković, Zivan; Tasić, Viša; Kovačević, Renata; Petrović, Nevenka
2010-02-01
This work presents the results of 4 years long monitoring of concentrations of SO(2) gas and PM(10) in the urban area around the copper smelter in Bor. The contents of heavy metals Pb, Cd, Cu, Ni, and As in PM(10) were determined and obtained values were compared to the limit values provided in EU Directives. Manifold excess concentrations of all the components in the atmosphere of the urban area of the townsite Bor were registered. Through application of a multi-criteria analysis by using PROMETHEE/GAIA method, the zones were ranked according to the level of pollution.
Directory of Open Access Journals (Sweden)
Liyong Fu
2017-04-01
Full Text Available Accurate estimates of forest site productivity are essential for environmental planning and forest management. In this study, we developed a new productivity index, hereafter termed basal area potential productivity index (BAPP, to estimate site productivity for irregular and complex forests characterized by multi-aged, multi-species, and multi-layer stands. We presented the biological relevance of BAPP with its computational details. We also compared BAPP against basal area realized productivity (BARP in order to verify the practicability and reliability of BAPP. Time-series data of the national forest inventory on 1912 permanent sample plots that were located in two main forest types and consisted of oak-dominated mixed forests and other broadleaf forests in northeast China were used to demonstrate the application of BAPP. The results showed that the value of BAPP for each sample plot was larger than or equal to the corresponding BARP value for each forest type. For appropriately managed stands with relatively better site conditions, the values of both BARP and BAPP were almost identical. The values of the difference between BAPP and BARP could therefore be used to effectively assess forest site productivity. Meanwhile, BAPP also provides much reliable and valuable information that can aid decision-making in forest management.
Ongoing change of site conditions important for sustainable forest management planning
Bidló, András; Horváth, Adrienn; Gulyás, Krisztina; Gálos, Borbála
2016-04-01
Observed tree mortality of the last decades has shown that the vulnerable forest ecosystems are especially affected by the recurrent, long lasting droughts, heat waves and their consequences. From all site conditions climate is changing the fastest, in this way it can be the largest threatening factor in the 21st century. Beyond climate, soil characteristics are playing an important influencing role. Until now, silvicultural technologies and species preferences of many countries are prescribed by binding regulation based on climate conditions that are assumed to be constant over time. Therefore the aim of our research was to investigate the ongoing and projected change of site conditions that are considered to be of primary importance in terms of tree species selection. For a case study region in Hungary (Keszthely Mountains, near to Lake Balaton) long-term climate tendencies have been determined for the period 1961-2100, as well as a detailed soil sample analysis has been carried out including ~100 sites. Results show a 0.5 degree increase of temperature and a 6-7 % decrease of the precipitation amount for the summer months in the last decades. For the future, significant warming and drying of summers is expected. Decrease of the summer precipitation sum can exceed 25 % until the end of the century, probability of extreme hot days may increase. These tendencies together with the unfavourable soil conditions and biotic damages can be the reason of the ongoing forest dieback. One of the characteristic soil type of the region is rendzina with a thin topsoil layer and an unfavourable water holding capacity. These properties are limiting the amount of available water for plants, especially in case of intense precipitation events. Black pine stands planted on rendzinas after many years of grazing; therefore erosion may have played a significant role. Not only microclimate conditions but also soil types show a large diversity within a relatively small distance. However
Application of two forest succession models at sites in Northeast Germany
International Nuclear Information System (INIS)
Lasch, P.; Lindner, M.
1995-06-01
In order to simulate potential impacts of climate change on forests, two succession models were applied to sites in the Northeast German lowlands. The models, which had been developed for Alpine (FORECE) and Boreal (FORSKA) forests differ from each other in the way they represent tree growth processes and the impact of environmental factors on establishment and growth. Both models were adjusted and compared with each other at sites that are situated along an ecological gradient from maritime to subcontinental climate. These sites are extending the former environmental space of model application towards water limited conditions, which under a predicted climatic change may have increasing importance for European forests. First results showed that FORECE was unrealistically sensitive to changes in soil moisture. On the other hand, FORSKA generally simulated very low biomasses. Since the structure of FORSKA seemed to be better suited for the simulation of changing environmental conditions, this model was chosen for further model development, applications and sensitivity analyses. Among other changes, establishment rates were increased and some environmental response factors were analysed. The function of account for resource depletion was modified. After the modifications for Central European conditions were made, there was a decrease in performance for the Boreal site. Both simulated total biomasses and species composition had changed. We conclude, that with currently available models, realistic forest dynamics within different climatic zones of Europe cannot be simulated without more substantial model modifications. (orig.)
Prediction of glycosylation sites using random forests
Directory of Open Access Journals (Sweden)
Hirst Jonathan D
2008-11-01
Full Text Available Abstract Background Post translational modifications (PTMs occur in the vast majority of proteins and are essential for function. Prediction of the sequence location of PTMs enhances the functional characterisation of proteins. Glycosylation is one type of PTM, and is implicated in protein folding, transport and function. Results We use the random forest algorithm and pairwise patterns to predict glycosylation sites. We identify pairwise patterns surrounding glycosylation sites and use an odds ratio to weight their propensity of association with modified residues. Our prediction program, GPP (glycosylation prediction program, predicts glycosylation sites with an accuracy of 90.8% for Ser sites, 92.0% for Thr sites and 92.8% for Asn sites. This is significantly better than current glycosylation predictors. We use the trepan algorithm to extract a set of comprehensible rules from GPP, which provide biological insight into all three major glycosylation types. Conclusion We have created an accurate predictor of glycosylation sites and used this to extract comprehensible rules about the glycosylation process. GPP is available online at http://comp.chem.nottingham.ac.uk/glyco/.
International Nuclear Information System (INIS)
Ikondn, A.T.K.; Afo, L.
2004-01-01
In Finland, Olkiluoto Island has been selected as the site for final disposal of spent nuclear fuel, in addition to the existing repository for low and intermediate level waste. When creating biosphere models for safety assessments, local main features and processes need to be taken into account. A special characteristic of the site, as well as the coastal area of the Gulf of Bothnia in general, is the land uplift (6-9 mm/a). This continuously exposes new land to soil-formation processes and provides surfaces for colonization by plant communities. The forest vegetation succession on stony, fine-grained till soils starts from deciduous shoreline vegetation and ends in almost pure Norway spruce forests. This has enabled to study ecological and microbiological processes in soils and forests of different developmental stages, to monitor forest condition and the factors affecting it in sites locating close to each other. It has also made possible gradient studies of the succession of boreal mire ecosystems without a need to wait thousands of years. Applying a methodology described in the full paper, a descriptive model on the evolution of the biosphere will be established to indicate possible ecosystem distributions and main characteristics on the area on the basis of above-mentioned studies carried out by Finnish Forest Research Institute, and of results of the site investigations at Olkiluoto. In future, the evolution description will be used as a basis for selection of appropriate ecosystem modules and parameter values in the subsequent coupled assessment model systems. (author)
Directory of Open Access Journals (Sweden)
Bussotti F
2012-12-01
Full Text Available The Italian forest sites of FunDivEUROPE: a new FP7 project on the functional significance of forest biodiversity in Europe. FunDivEUROPE is a new project aiming at a deeper understanding of the role of forest diversity on ecosystem functions and service provisioning for society. This project combines three scientific platforms: experimental, exploratory and inventory. The exploratory platform is based on the observation of a broad range of properties, traits and ecological processes on a network of ca. 240 natural forest sites representing a gradient of tree species diversity in six focal regions of Europe (Spain, Italy, Germany, Poland, Finland and Romania. The Italian sites are located on the hills of central and Southern Tuscany and represent the category “thermophilous deciduous forest”. Almost one year of fieldwork was needed to select and characterize 36 plots measuring 30 x 30 m. Selection was based on criteria concerning tree mixtures and richness, structural parameters and main environmental variables. The main features of these sites are synthetically presented in this paper together with a short description of the project structure and scope. The aim is also to enhance dissemination of the potential implications for a sustainable forest management in Italy.
Niculovic, Milica; Zivkovic, Dragana; Manasijevic, Dragan; Strbac, Nada
2012-01-01
A large number of criteria for evaluating Internet addiction have been developed recently. The research of Internet addiction among students of the Technical faculty in Bor, University of Belgrade has been conducted and its results are presented in this paper. The study included 270 students using criteria of Young's Internet Addiction Test. In…
Jin, Zhengzhong; Lei, Jiaqiang; Li, Shengyu; Xu, Xinwen
2013-10-01
Soil microbes in forest land are crucial to soil development in extreme areas. In this study, methods of conventional culture, PLFA and PCR-DGGE were utilized to analyze soil microbial quantity, fatty acids and microbial DNA segments of soils subjected to different site conditions in the Tarim Desert Highway forest land. The main results were as follows: the soil microbial amount, diversity indexes of fatty acid and DNA segment differed significantly among sites with different conditions (F 84%), followed by actinomycetes and then fungi (<0.05%). Vertical differences in the soil microbial diversity were insignificant at 0-35 cm. Correlation analysis indicated that the forest trees grew better as the soil microbial diversity index increased. Therefore, construction of the Tarim Desert Highway shelter-forest promoted soil biological development; however, for enhancing sand control efficiency and promoting sand development, we should consider the effects of site condition in the construction and regeneration of shelter-forest ecological projects. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Directory of Open Access Journals (Sweden)
Qiang Lv
2017-05-01
Full Text Available Boron is an essential mineral nutrient for higher plant growth and development. However, excessive amounts of boron can be toxic. Here, we report on the characterization of an Arabidopsis mutant, shb1 (sensitive to high-level of boron 1, which exhibits hypersensitivity to excessive boron in roots. Positional cloning demonstrated that the shb1 mutant bears a point mutation in a gene encoding a heme oxygenase 1 (HO1 corresponding to the HY1 gene involved in photomorphogenesis. The transcription level of the SHB1/HY1 gene in roots is up-regulated under excessive boron stimulation. Either overexpressing SHB1/HY1 or applying the HO1 inducer hematin reduces boron accumulation in roots and confers high boron tolerance. Furthermore, carbon monoxide and bilirubin, catalytic products of HO1, partially rescue the boron toxicity-induced inhibition of primary root growth in shb1. Additionally, the mRNA level of BOR4, a boron efflux transporter, is reduced in shb1 roots with high levels of boron supplementation, and hematin cannot relieve the boron toxicity-induced root inhibition in bor4 mutants. Taken together, our study reveals that HO1 acts via its catalytic by-products to promote tolerance of excessive boron by up-regulating the transcription of the BOR4 gene and therefore promoting the exclusion of excessive boron in root cells.
Monitoring air quality with lichens: A comparison between mapping in forest sites and in open areas
International Nuclear Information System (INIS)
Policnik, Helena; Simoncic, Primoz; Batic, Franc
2008-01-01
Four different methods of epiphytic lichen mapping were used for the assessment of air quality in the region under the influence of the Sostanj Thermal Power Plant (Salek Valley, Slovenia). Three methods were based on the presence of different lichen species (VDI, EU and ICP-Forest), the fourth on a frequency and coverage assessment of different growth forms of epiphytic lichens, e.g. crustose, foliose and fruticose (SI). A comparison of the results from the assessment of air quality between forest sites (ICP-Forest, SI) and open areas (VDI, EU and SI), obtained by the different methods of epiphytic lichen mapping, is presented in the contribution. Data showed that lichen species richness is worse in forest sites in comparison with open areas. From the data obtained it can be concluded that epiphytic lichen mapping in open areas is a better method for the assessment of air pollution in a given area than mapping in forest sites. The species-based methods in open areas are more powerful and useful for air quality assessment in polluted research areas than the SI and ICP-Forest methods. - The mapping of epiphytic lichens in open areas is more suitable for air quality assessment than mapping in forest sites in the Salek Valley, Slovenia
Directory of Open Access Journals (Sweden)
E. A. Gallo
2013-04-01
Full Text Available Aim of study: The effects and interactions of shelterwood forest harvesting and site qualities over understory plant species diversity and composition were compared among primary and harvested Nothofagus pumilio forests.Area of study: Tierra del Fuego (Argentina, on three pure conditions (one and six year-old harvested, and primary without previous harvesting forests and three site qualities (high, medium and low.Material and Methods: Understory richness and cover (% were registered in five replicates of 1 hectare each per treatment. Taxonomic species were classified in categories (groups, origin and life forms. Two-way ANOVAs and multivariate analyses were conducted.Main results: Shelterwood harvesting and site quality significantly influenced understory cover and richness, which allow the introduction of native and exotic species and increasing of dicot and monocot covers. In dicots, monocots, exotics and total groups, higher richness and covers were related to time. Meanwhile, cover reached similar high values in all site qualities on dicot, native and total groups. On the other hand, monocot and exotic richness and cover remain similar in primary and recently harvested forests, and greatly increased in old harvested forests. Mosses and ferns were among the most sensitive groups.Research highlights: Impacts of shelterwood cut depend on site quality of the stands and time since harvesting occurs. For this, different site quality stands should received differential attention in the development of conservation strategies, as well as variations in the shelterwood implementation (as irregularity and patchiness should be considered to better promote understory plant species conservation inside managed areas.Key words: plant species conservation; years after harvesting; forest management; Tierra del Fuego.
Directory of Open Access Journals (Sweden)
Arturo González-Zamora
Full Text Available Spider monkeys (Ateles geoffroyi use sites composed of one or more trees for sleeping (sleeping sites and sleeping trees, respectively. Beneath these sites/trees they deposit copious amounts of dung in latrines. This behavior results in a clumped deposition pattern of seeds and nutrients that directly impacts the regeneration of tropical forests. Therefore, information on the density and spatial distribution of sleeping sites and latrines, and the characteristics (i.e., composition and structure of sleeping trees are needed to improve our understanding of the ecological significance of spider monkeys in influencing forest composition. Moreover, since primate populations are increasingly forced to inhabit fragmented landscapes, it is important to assess if these characteristics differ between continuous and fragmented forests. We assessed this novel information from eight independent spider monkey communities in the Lacandona rainforest, Mexico: four continuous forest sites and four forest fragments. Both the density of sleeping sites and latrines did not differ between forest conditions. Latrines were uniformly distributed across sleeping sites, but the spatial distribution of sleeping sites within the areas was highly variable, being particularly clumped in forest fragments. In fact, the average inter-latrine distances were almost double in continuous forest than in fragments. Latrines were located beneath only a few tree species, and these trees were larger in diameter in continuous than fragmented forests. Because latrines may represent hotspots of seedling recruitment, our results have important ecological and conservation implications. The variation in the spatial distribution of sleeping sites across the forest indicates that spider monkeys likely create a complex seed deposition pattern in space and time. However, the use of a very few tree species for sleeping could contribute to the establishment of specific vegetation associations
González-Zamora, Arturo; Arroyo-Rodríguez, Víctor; Oyama, Ken; Sork, Victoria; Chapman, Colin A; Stoner, Kathryn E
2012-01-01
Spider monkeys (Ateles geoffroyi) use sites composed of one or more trees for sleeping (sleeping sites and sleeping trees, respectively). Beneath these sites/trees they deposit copious amounts of dung in latrines. This behavior results in a clumped deposition pattern of seeds and nutrients that directly impacts the regeneration of tropical forests. Therefore, information on the density and spatial distribution of sleeping sites and latrines, and the characteristics (i.e., composition and structure) of sleeping trees are needed to improve our understanding of the ecological significance of spider monkeys in influencing forest composition. Moreover, since primate populations are increasingly forced to inhabit fragmented landscapes, it is important to assess if these characteristics differ between continuous and fragmented forests. We assessed this novel information from eight independent spider monkey communities in the Lacandona rainforest, Mexico: four continuous forest sites and four forest fragments. Both the density of sleeping sites and latrines did not differ between forest conditions. Latrines were uniformly distributed across sleeping sites, but the spatial distribution of sleeping sites within the areas was highly variable, being particularly clumped in forest fragments. In fact, the average inter-latrine distances were almost double in continuous forest than in fragments. Latrines were located beneath only a few tree species, and these trees were larger in diameter in continuous than fragmented forests. Because latrines may represent hotspots of seedling recruitment, our results have important ecological and conservation implications. The variation in the spatial distribution of sleeping sites across the forest indicates that spider monkeys likely create a complex seed deposition pattern in space and time. However, the use of a very few tree species for sleeping could contribute to the establishment of specific vegetation associations typical of the
International Nuclear Information System (INIS)
Ledwidge, T.J.; Black, J.L.
1989-01-01
The present paper deals with investigations of acoustic signals from a boiling experiment performed on the BOR 60 reactor in the USSR. Signals have been analysed in frequency as well as in time domain. Signal characteristics successfully used to detect the boiling process have been found in time domain. A proposal for in-service boiling monitoring by acoustic means is described. (author). 3 refs, 16 figs
Đorđievski, Stefan; Ishiyama, Daizo; Ogawa, Yasumasa; Stevanović, Zoran
2018-06-22
Bor, Krivelj, and Bela Rivers belong to the watershed of Timok River, which is a tributary of transboundary Danube River. These rivers receive metal-rich acidic wastewater from metallurgical facilities and acid mine drainage (AMD) from mine wastes around Bor copper mines. The aim of this study was to determine the mobility and natural attenuation of metals and arsenic in rivers from Bor copper mines to Danube River during the year 2015. The results showed that metallurgical facilities had the largest impact on Bor River by discharging about 400 t of Cu per year through highly acidic wastewater (pH = 2.6). The highest measured concentrations of Cu in river water and sediments were 40 mg L -1 and 1.6%, respectively. Dissolution of calcite from limestone bedrock and a high concentration of bicarbonate ions in natural river water (about 250 mg L -1 ) enhanced the neutralization of acidic river water and subsequent chemical precipitation of metals and arsenic. Decreases in the concentrations of Al, Fe, Cu, As, and Pb in river water were mainly due to precipitation on the river bed. On the other hand, dilution played an important role in the decreases in concentrations of Mn, Ni, Zn, and Cd. Chemically precipitated materials and flotation tailings containing Fe-rich minerals (fayalite, magnetite, and pyrite) were transported toward Danube River during the periods of high discharge. This study showed that processes of natural attenuation in catchments with limestone bedrock play an important role in reducing concentrations of metals and arsenic in AMD-bearing river water.
Fidelity of bats to forest sites revealed from mist-netting recaptures
Roger W. Perry
2011-01-01
Although site fidelity to permanent roost structures by bats is generally known, long-term fidelity to areas such as foraging or drinking sites is unknown. Furthermore, mist-net recaptures of bats over multiple years are rarely reported. Extensive mist-net surveys were conducted over the course of 8 y in the Ouachita National Forest of central Arkansas, United States...
Directory of Open Access Journals (Sweden)
Agus Sukarno
2013-09-01
Full Text Available Pinus merkusii Jungh et de Vriese merupakan tanaman asli Indonesia, yang sebaran alaminya di Aceh, Tapanuli dan Kerinci. Penyadapan getah dengan metode bor pada kelas umur yang berbeda belum pernah dilakukan. Tujuan penelitian untuk mengetahui perbedaan produksi getah pinus di antara kelas umur. Penelitian dilakukan di RPH Oro-oro Ombo, BKPH Pujon, KPH Malang pada tanaman pinus kelas umur III, IV, V dan VI dengan ketinggian tempat antara 1.100 m –1.250 m dari permukaan air laut. Waktu penelitian bulan September sampai dengan Nopember 2010. Jumlah pohon yang disadap di setiap kelas umur sebanyak 150 - 160 pohon dengan dua lubang per pohon. Penyadapan getah menggunakan bor mesin, kantong plastik tahan minyak diikatkan pada ujung pipa untuk menampung getah. Pemungutan getah dilakukan sehari setelah penyadapan. Analisis data menggunakan one way anova, apabila terdapat perbedaan yang nyata, dilakukan uji lanjut dengan orthogonal polynomial. Produksi getah di antara kelas umur, menunjukkan perbedaan yang nyata. Produksi getah kelas umur III (36,5 g/ 2 lubang/1 hari meningkat pada kelas umur IV (62,9 g/2 lubang/1 hari dan menurun pada kelas umur V (24,61 g/2 lubang/1 hari. Produksi getah pada kelas umur VI (38,3 g/ 2 lubang/1 hari hampir sama dengan kelas umur III. Hasil uji lanjut orthogonal polynomial menunjukkan respons bersifat kuadratik (p=0,09 antara produksi getah dengan kelas umur. Kata Kunci: Pinus, kelas umur, getah, metode bor
LBA-ECO CD-04 Leaf Litter Data, km 83 Tower Site, Tapajos National Forest, Brazil
National Aeronautics and Space Administration — Above-ground litter productivity was measured in a 18 ha plot adjacent to the eddy flux tower at the logged forest tower site, km 83, Tapajos National Forest, Para,...
Evidence that soil aluminum enforces site fidelity of southern New England forest trees
S. W. Bigelow; C. D. Canham
2010-01-01
Tree species composition of hardwood forests of the northeastern United States corresponds with soil chemistry, and differential performance along soil calcium (Ca) gradients has been proposed as a mechanism for enforcing this fidelity of species to site. We conducted studies in a southern New England forest to test if surface-soil Ca is more important than other...
LBA-ECO CD-04 Leaf Area Index, km 83 Tower Site, Tapajos National Forest, Brazil
National Aeronautics and Space Administration — ABSTRACT: Leaf area index was estimated in an 18 ha plot at the logged forest tower site, km 83, Tapajos National Forest, Para, Brazil. The plot was adjacent to the...
LBA-ECO CD-10 Temperature Profiles at km 67 Tower Site, Tapajos National Forest
National Aeronautics and Space Administration — This data set contains a single text file which reports temperature measurements at the Para Western (Santarem) - km 67, Primary Forest Tower Site. This site is in...
International Nuclear Information System (INIS)
Small, Ch.J.; McCarthy, B.C.
2010-01-01
Seed bank composition was sampled in 192-2.5 m 2 quadrats, established in six regenerating clearcut (∼7 years) and six second-growth ((∼125 years) mixed-oak forest stands in southeastern Ohio. Seed bank and aboveground composition diverged markedly (Sorensen's coefficient <10%), emphasizing the importance of fast-growing, early-successional germinants to early ecosystem recovery. Seed richness was significantly (ρ<.01) higher in clearcut stands, suggesting declining richness with stand age. Richness estimations 28%-60% higher than observed values demonstrated high seed bank heterogeneity, emphasizing the need for intensive sampling to assess temperate forest seed bank variation. Site quality (topographic aspect) strongly influenced seed bank composition, with greater importance of early-successional trees, thicket-forming shrubs, and nonnative species on mesic sites. Thus, forest seed banks are likely to play an important, site-dependent role in shaping competitive environments for commercially important timber species after harvesting and soil disturbance and have the potential for marked influence on post harvest forest development.
LBA-ECO CD-04 Leaf Area Index, km 83 Tower Site, Tapajos National Forest, Brazil
National Aeronautics and Space Administration — Leaf area index was estimated in an 18 ha plot at the logged forest tower site, km 83, Tapajos National Forest, Para, Brazil. The plot was adjacent to the eddy flux...
Relationship Between Site Disturbance and Forest Harvesting Equipment Traffic
Tim McDonald; Emily Carter; Steve Taylor; John Tobert
1998-01-01
A study was done to evaluate the use of global positioning systems (GPS) to track the position of forest harvesting equipment and use the information to assess site impacts. GPS units were attached to tree-length harvesting machinery in two clearcuts (1 feller-buncher, 2 skidders). Position of the equipment was recorded at 2-second intervals throughout the harvest of...
Directory of Open Access Journals (Sweden)
Christine J. Small
2010-01-01
Full Text Available Seed bank composition was sampled in 192–2.5 m2 quadrats, established in six regenerating clearcut (∼7 years and six second-growth (∼125 years mixed-oak forest stands in southeastern Ohio. Seed bank and aboveground composition diverged markedly (Sørensen's coefficient <10%, emphasizing the importance of fast-growing, early-successional germinants to early ecosystem recovery. Seed richness was significantly (P<.01 higher in clearcut stands, suggesting declining richness with stand age. Richness estimations 28%–60% higher than observed values demonstrated high seed bank heterogeneity, emphasizing the need for intensive sampling to assess temperate forest seed bank variation. Site quality (topographic aspect strongly influenced seed bank composition, with greater importance of early-successional trees, thicket-forming shrubs, and nonnative species on mesic sites. Thus, forest seed banks are likely to play an important, site-dependent role in shaping competitive environments for commercially important timber species after harvesting and soil disturbance and have the potential for marked influence on postharvest forest development.
Directory of Open Access Journals (Sweden)
R. Zolfaghari
2013-03-01
Full Text Available Regarding high economic and conservative values of Zagros forests, and livelihood dependency of local people these recourses, determination of sites with higher conservation index can help us to maintain biodiversity of these forests more efficiently. Therefore, 49 plots with 450 m2 in area accompanied by 1, 10 and 45 m2 subplots were taken as systematic random design in research forests of Yasouj University. The number of species in each plot and subplot was recorded. The conservation values for different physiographic regions of forest were calculated using integrative parameters such as the number of species per plot, number of rare species per plot, number of tree species per plot, Jaccards similarity coefficient and slope of species-log(area. Comparing the conservation index in different physiographic sites revealed that the areas located in the north, hills and lower altitudes can be considered for in situ conservation due to higher number of trees, rare species and total plant species, species-log (area slope and lower amount of Jaccard similarity coefficient. But, vegetative sites located in lower slopes and south, because of lower conservation index, can be used for other multipurpose forestry activities. Using this index for different forest areas can be potentially conducted for better conservation and management of Zagros forests.
Directory of Open Access Journals (Sweden)
Đorđević Miodrag
2005-01-01
Full Text Available In the light of the findings presented in this paper, among the volcanic products of the Upper Cretaceous, referred to as "the first volcanic phase" (Drovenik, 1961, two lithostratigraphic units can be singled out within the Timok Magmatic Complex (TMC: - The lower one, consisting of volcanogenic, subaerial, dominantly hornblende andésite volcaniclastic, formed on land, and less abundant volcanic and sub-volcanic-hypoabyssal rocks. It is the main source of sulfide mineralization in Bor. It was formed before the Upper Turonian and consists of hornblende andésite and occasionally low biotite. Minor constituents are biotite-hornblende dacite and some andésite and dacite materials containing augite in addition to hornblende and biotite. - The upper one, from the Upper Turonian period when the volcanic activity of the region had ended, is marine deposited and epiclastic. Intercalated with Senonian marls, it is composed of land deposited Turonian volcanogenic material of all generations. Fresh material mostly consisting of hornblende andésite volcanoclastics prevails in it. Fresh epiclastics include ore mineral epiclasts. Epiclastics composed of epiclasts of hydro thermally altered rocks were observed which also include ore epiclasts. The ore epiclasts originate from copper ore. The boundary between the volcanogenic Turonian and the epiclastic deposits is a well-recognized unconformity. Table 1 in the text summarizes the main characteristics of the Turonian volcanogenic rocks, primarily those of volcaniclastics, as well as those of epiclastic deposits.
Karpati, Amy S; Handel, Steven N; Dighton, John; Horton, Thomas R
2011-08-01
The presence and quality of the belowground mycorrhizal fungal community could greatly influence plant community structure and host species response. This study tests whether mycorrhizal fungal communities in areas highly impacted by anthropogenic disturbance and urbanization are less species rich or exhibit lower host root colonization rates when compared to those of less disturbed systems. Using a soil bioassay, we sampled the ectomycorrhizal fungal (EMF) communities associating with Quercus rubra (northern red oak) seedlings in soil collected from seven sites: two mature forest reference sites and five urban sites of varying levels of disturbance. Morphological and polymerase chain reaction-restriction fragment length polymorphism analyses of fungi colonizing root tips revealed that colonization rates and fungal species richness were significantly lower on root systems of seedlings grown in disturbed site soils. Analysis of similarity showed that EMF community composition was not significantly different among several urban site soils but did differ significantly between mature forest sites and all but one urban site. We identified a suite of fungal species that occurred across several urban sites. Lack of a diverse community of belowground mutualists could be a constraint on urban plant community development, especially of late-successional woodlands. Analysis of urban EMF communities can add to our understanding of urban plant community structure and should be addressed during ecological assessment before pragmatic decisions to restore habitats are framed.
Seeing the forest through the trees: Considering roost-site selection at multiple spatial scales
Jachowski, David S.; Rota, Christopher T.; Dobony, Christopher A.; Ford, W. Mark; Edwards, John W.
2016-01-01
Conservation of bat species is one of the most daunting wildlife conservation challenges in North America, requiring detailed knowledge about their ecology to guide conservation efforts. Outside of the hibernating season, bats in temperate forest environments spend their diurnal time in day-roosts. In addition to simple shelter, summer roost availability is as critical as maternity sites and maintaining social group contact. To date, a major focus of bat conservation has concentrated on conserving individual roost sites, with comparatively less focus on the role that broader habitat conditions contribute towards roost-site selection. We evaluated roost-site selection by a northern population of federally-endangered Indiana bats (Myotis sodalis) at Fort Drum Military Installation in New York, USA at three different spatial scales: landscape, forest stand, and individual tree level. During 2007–2011, we radiotracked 33 Indiana bats (10 males, 23 females) and located 348 roosting events in 116 unique roost trees. At the landscape scale, bat roost-site selection was positively associated with northern mixed forest, increased slope, and greater distance from human development. At the stand scale, we observed subtle differences in roost site selection based on sex and season, but roost selection was generally positively associated with larger stands with a higher basal area, larger tree diameter, and a greater sugar maple (Acer saccharum) component. We observed no distinct trends of roosts being near high-quality foraging areas of water and forest edges. At the tree scale, roosts were typically in American elm (Ulmus americana) or sugar maple of large diameter (>30 cm) of moderate decay with loose bark. Collectively, our results highlight the importance of considering day roost needs simultaneously across multiple spatial scales. Size and decay class of individual roosts are key ecological attributes for the Indiana bat, however, larger-scale stand structural
International Nuclear Information System (INIS)
Kizin, V.D.; Konyashov, V.V.; Lisitsyn, E.S.; Polyakov, V.I.; Chechetkin, Yu.V.
1976-04-01
The results of measurements of the radioactivity of the coolant and the deposits in the primary circuit of the BOR-60 reactor during its five years of operation are discussed. The values calculated for the exposure dose rate from the piping system and the contribution of the γ-radiation from the corrosion and fission product nuclides are given. The efficiency of coolant draining from the pipes in reducing the dose rate is estimated. (orig.) [de
Identification of a novel EYA1 splice-site mutation in a Danish branchio-oto-renal syndrome family
DEFF Research Database (Denmark)
Henriksen, Ann Marie; Tümer, Zeynep; Tommerup, Niels
2004-01-01
Branchio-oto-renal (BOR) syndrome is an autosomal dominant disorder characterized by variable clinical manifestations including branchial fistulae, preauricular pits, ear malformations, hearing impairment, and renal anomalies. BOR is caused by mutations in the genes EYA1 and SIX1. A Danish BOR...
Sugar maple: abundance and site relationships in the pre- and post- settlement forest
Gordon G. Whitney
1999-01-01
A review of the available historical evidence provides a picture of sugar maple's site relationstiips in the presettlement forest and its changing statis over the last 300 years. Sugar maple was widely distributed throughout the Northeast during the presettlerment period. it was particularly abundant on the richer, better drained, silt-rich sites. A comparison of...
Summer droughts limit tree growth across 10 temperate species on a productive forest site
Weemstra, M.; Eilmann, B.; Sass-Klaassen, U.; Sterck, F.J.
2013-01-01
Studies on climate impacts on tree annual growth are mainly restricted to marginal sites. To date, the climate effects on annual growth of trees in favorable environments remain therefore unclear despite the importance of these sites in terms of forest productivity. Because species respond
77 FR 4559 - Ecusta Mill Site, Pisgah Forest, Transylvania County, NC; Notice of Amended Settlement
2012-01-30
... ENVIRONMENTAL PROTECTION AGENCY [EPA-R4-SFUND 2012-; FRL-9624-1] Ecusta Mill Site, Pisgah Forest... settlement for resolution of past response and future costs concerning the Ecusta Mill Superfund Site located... settlement are available from Ms. Paula V. Painter. Submit your comments by Site name Ecusta Mill Superfund...
Aaron R. Weiskittel; Nicholas L. Crookston; Philip J. Radtke
2011-01-01
Assessing forest productivity is important for developing effective management regimes and predicting future growth. Despite some important limitations, the most common means for quantifying forest stand-level potential productivity is site index (SI). Another measure of productivity is gross primary production (GPP). In this paper, SI is compared with GPP estimates...
Use of Municipal Sewage Sludge for Improvement of Forest Sites in the Southeast
Energy Technology Data Exchange (ETDEWEB)
Charles R. Berry
1987-09-01
In eight field experiments dried municipal sewage sludge was applied to forest sites before planting of seedlings. In all cases, tree growth was faster on sludge-amended plots than on plots that received fertilizer and lime or no amendment. In all studies, concentrations of total nitrogen in the soil were higher on sludge plots than on control or fertilizer plots, even on good forest sites. In seven of the eight studies, concentrations of phosphorus also were higher on sludge plots than on control or fertilizer plots. Nitrogen and phosphorus tended to be higher in foliage from trees growing on sludge plots. Deep subsoiling was beneficial regardless of soil amendment. Where weeds were plentiful at the outset, they became serious competitors on plots receiving sludge.
Directory of Open Access Journals (Sweden)
Marcus Schmidt
2016-03-01
Full Text Available Background An examination of the distribution of ancient charcoal kiln sites in the forest landscape seems to be worthwhile, since general trends in the selection of suitable kiln site locations in the past might become obvious. In this way forest landscape elements with a more intense usage by charcoal burning can be identified. By doing this, we can expect to gain information on the former condition and tree species composition of woodland. Investigations on the spatial distribution of charcoal kiln sites in relation to landscape attributes are sparse, however, probably due to the high on-site mapping effort. The outstanding suitability of LiDAR-derived digital terrain models (DTMs for the detection of charcoal kiln sites has been recently proved. Hence, DTM-based surveys of charcoal kiln sites represent a promising attempt to fill this research gap. Methods Based on DTM-based surveys, we analyzed the spatial distribution of charcoal kiln sites in two forest landscapes in the German federal state of Hesse: Reinhardswald and Kellerwald-Edersee National Park. In doing so, we considered the landscape attibutes "tree species composition", “water supply status”, “nutrient supply status”, “soil complex classes”, “altitude”, “exposition”, and “inclination”. Results We found that charcoal kiln sites were established preferably on hillside locations that provided optimal growing and regeneration conditions for European beech (Fagus sylvatica due to their acidic brown soils and sufficient water supply. These results are in line with instructions for the selection of appropriate kiln site locations, found in literature from the 18th to the 19th century. Conclusions We conclude that there were well-stocked, beech-dominated deciduous forest stands in northern Hesse before 1800, particularly at poorly accessible hillside locations. These large stocks of beech wood were utilized by the governments of the different Hessian territories
We used a combination of data from USDA Forest Service inventories, intensivechronosequences, extensive sites, and satellite remote sensing, to estimate biomassand net primary production (NPP) for the forested region of western Oregon. Thestudy area was divided int...
Directory of Open Access Journals (Sweden)
Ginger M. Thurston
2013-03-01
Full Text Available Active restoration is one strategy to reverse tropical forest loss. Given the dynamic nature of climates, human populations, and other ecosystem components, the past practice of using historical reference sites as restoration targets is unlikely to result in self-sustaining ecosystems. Restoring sustainable ecological processes like pollination is a more feasible goal. We investigated how flower cover, planting design, and landscape forest cover influenced bird pollinator visits to Inga edulis trees in young restoration sites in Costa Rica. I. edulis trees were located in island plantings, where seedlings had been planted in patches, or in plantation plantings, where seedlings were planted to cover the restoration area. Sites were located in landscapes with scant (10–21% or moderate (35–76% forest cover. Trees with greater flower cover received more visits from pollinating birds; neither planting design nor landscape forest cover influenced the number of pollinator visits. Resident hummingbirds and a migratory bird species were the most frequent bird pollinators. Pollination in the early years following planting may not be as affected by details of restoration design as other ecological processes like seed dispersal. Future work to assess the quality of various pollinator species will be important in assessing this idea.
International Nuclear Information System (INIS)
Brown, C.J.; Hughes, G.; Overton, R.S.; Wey, B.O.
1989-01-01
The present paper deals with the second stage of investigations of acoustic signals from a boiling experiment performed on the KNS I loop at KfK Karlsruhe and first results of analysis of data from a series of boiling experiments carried out in the BOR 60 reactor in the USSR. Signals have been analysed in frequency as well as in time domain. Signal characteristics successfully used to detect the boiling process have been found in time domain. A proposal for in-service boiling monitoring by acoustic means is briefly described. (author). 5 refs, 23 figs
The Wahluke (North) Slope of the Hanford Site: History and present challenges
International Nuclear Information System (INIS)
Gerber, M.S.
1996-01-01
The Hanford Site was founded in early 1943 for the top secret government mission of producing plutonium for the world's first atomic weapons. A great deal of land was needed, both to separate various Site facilities from each other, and to provide buffer zones for safety and security purposes. In total, 640 square miles were occupied by the original Hanford Site and its buffer zones. Much of this land had been earmarked for inclusion in the Columbia Basin Irrigation Project (CBP). After World War II ended, a series of national decisions led to a long-term mission for the Hanford Site, and area residents learned that the Site lands they had hoped to farm would be withheld from agricultural production for the foreseeable future. A long set of negotiations commenced between the federal management agency responsible for Hanford (the Atomic Energy Commission -- AEC), and the Bureau of Reclamation (BOR), Department of the Interior that managed the CBP. Some lands were turned back to agriculture, and other compromises made, in the Site's far northern buffer lands known as the Wahluke Slope, during the 1950s. In the mid-1960s, further negotiations were about to allow farming on lands just north of the Columbia River, opposite Hanford's reactors, when studies conducted by the BOR found drainage barriers to irrigation. As a result of these findings, two wildlife refuges were created on that land in 1971. Today, after the Hanford Site plutonium production mission has ended and as Site cleanup goes forward, the possibility of total release of Wahluke Slope lands from the control of the Department of Energy (DOE -- a successor agency to the AEC) is under discussion. Such discussion encompasses not just objective and clearly visible criteria, but it resurrects historical debates about the roles of farming and government presence in the Columbia Basin
Estimating actual evapotranspiration for forested sites: modifications to the Thornthwaite Model
Randall K. Kolka; Ann T. Wolf
1998-01-01
A previously coded version of the Thornthwaite water balance model was used to estimate annual actual evapotranspiration (AET) for 29 forested sites between 1900 and 1993 in the Upper Great Lakes area. Approximately 8 percent of the data sets calculated AET in error. Errors were detected in months when estimated AET was greater than potential evapotranspiration. Annual...
Koch, Nadine; Thiele-Bruhn, Sören
2010-05-01
The quantity and quality of soil organic matter (SOM) and SOM pools and thus the soil properties related to carbon sequestration and water retention are not constant but exhibit considerable variation through changing climate. In total changes in soil fertility and an increase in plant stress are expected. This is relevant for northwest Europe as well and may have economic and social impacts since functions of forests for wood production, groundwater recharge, soil protection and recreation might be affected. The study is done by comparative investigation of selected sites at four watersheds that represent typical forest stands in the region of Luxembourg and South West Germany. The aim is to identify SOM storage and stability in forest soils and its dependence on site properties and interaction with tree stand conditions. According to state of the art fractionation schemes functional C pools in forest soils and their stabilization mechanisms are investigated. In particular, distribution patterns are determined depending on location, tree stand and climatic conditions. Aim is to identify characteristics of SOM stability through fractionation of SOM according to density, particle size and chemical extractability and their subsequent analytical characterization. So far, reasons about the origin, composition and stabilization mechanisms underlying the different SOM pools are not fully understood. Presented are different patterns of distribution of SOM in relation to land use and site conditions, as well as similarities and differences between the different forest soils and results in addition to passive OM pool, which is mainly responsible for long-term stabilization of carbon in soils. These are aligned with selected general' soil properties such as pH, CEC and texture.
Directory of Open Access Journals (Sweden)
Dragana Ivšić-Bajčeta
2013-09-01
Full Text Available The previous inadequate treatment of off-gas in RTB Bor in Serbia has resulted in serious pollution of the environment and the possibly high losses of copper through the effluent flows. The project of New Copper Smelter RTB Bor, besides the new flash smelting furnace (FSF and the reconstruction of Pierce-Smith converter (PSC, includes more effective effluent treatment. Paper presents an analysis of the new FSF and PSC off-gas treatment, determination of copper losses throughout generated wastewaters and discussion of its possible valorization. Assumptions about the solubility of metals phases present in the FSF and PSC off-gas, obtained by the treatment process simulation, were compared with the leaching results of flue dusts. Determined wastewaters characteristics indicate that the PSC flow is significantly richer in copper, mostly present in insoluble metallic/sulfide form, while the FSF flow has low concentration of copper in the form of completely soluble oxide/sulfate. The possible scenario for the copper valorization, considering arsenic and lead as limiting factors, is the separation of the FSF and PSC flows, return of the metallic/sulfide solid phase to the smelting process and recovery from the sulfate/oxide liquid phase.
Atmospheric deposition of nitrogen at five subtropical forested sites in South China
International Nuclear Information System (INIS)
Chen, Xi Yun; Mulder, Jan
2007-01-01
Elevated concentrations of reactive nitrogen (N) in precipitation have been reported for many cities in China. Due to increased use of fossil fuels and expansion in agriculture, further increases in deposition of ammonia (NH x ) and reactive N oxides (NO y ) are predicted. Increased deposition of reactive N is likely to affect N dynamics and N runoff in forest ecosystems. Yet, in China little work has been done to quantify the levels of atmospheric N deposition in such systems. Here, we assess the deposition of inorganic N (ammonium, NH 4 + and nitrate, NO 3 - ) for five subtropical forest ecosystems in remote and urban areas of South China. Annual volume-weighted concentrations in bulk precipitation range from 0.18 to 1.55 mg NH 4 + -N L - 1 and from 0.12 to 0.74 mg NO 3 - -N L - 1 . These values are large and several times greater than those reported for remote sites of the world. The fluxes of total inorganic N (TIN) in wet-only deposition range from 0.8 to 2.3 g N m - 2 yr - 1 , with NH 4 + -N contributing 54% to 77%. Both the tree canopy and the ground vegetation layer are important in determining the net N flux reaching the forest floor, but the net effect varies from site to site. At TieShanPing (TSP), close to Chongqing city, and at CaiJiaTang (CJT), near Shaoshan (Hunan province), the canopy represents a net source of N, probably due to dry deposition. At the other three sites (LiuChongGuan (LCG), LeiGongShan (LGS), both in Guizhou province, and LiuXiHe (LXH) in Guangdong), a net loss of reactive N from precipitation water occurs in the canopy, probably due to uptake processes. The total annual atmospheric TIN load is estimated to range from at least 0.8 g N m - 2 yr - 1 to 4.0 g N m - 2 yr - 1 , with a considerable contribution from dry deposition. Concentrations and fluxes of inorganic N in tree canopy throughfall are greater than those in North America. Also the contribution of NH 4 + -N to TIN fluxes in throughfall (40% to 70%) is greater than in North
Reinikainen, Michael; D’Amato, Anthony W.; Bradford, John B.; Fraver, Shawn
2014-01-01
Low-severity canopy disturbance presumably influences forest carbon dynamics during the course of stand development, yet the topic has received relatively little attention. This is surprising because of the frequent occurrence of such events and the potential for both the severity and frequency of disturbances to increase as a result of climate change. We investigated the impacts of low-severity canopy disturbance and average insect defoliation on forest carbon stocks and rates of carbon sequestration in mature aspen mixedwood forests of varying stand age (ranging from 61 to 85 years), overstory composition, stocking level, and site quality. Stocking level and site quality positively affected the average annual aboveground tree carbon increment (CAAI), while stocking level, site quality, and stand age positively affected tree carbon stocks (CTREE) and total ecosystem carbon stocks (CTOTAL). Cumulative canopy disturbance (DIST) was reconstructed using dendroecological methods over a 29-year period. DIST was negatively and significantly related to soil carbon (CSOIL), and it was negatively, albeit marginally, related to CTOTAL. Minima in the annual aboveground carbon increment of trees (CAI) occurred at sites during defoliation of aspen (Populus tremuloides Michx.) by forest tent caterpillar (Malacosoma disstria Hubner), and minima were more extreme at sites dominated by trembling aspen than sites mixed with conifers. At sites defoliated by forest tent caterpillar in the early 2000s, increased sequestration by the softwood component (Abies balsamea (L.) Mill. and Picea glauca (Moench) Voss) compensated for overall decreases in CAI by 17% on average. These results underscore the importance of accounting for low-severity canopy disturbance events when developing regional forest carbon models and argue for the restoration and maintenance of historically important conifer species within aspen mixedwoods to enhance stand-level resilience to disturbance agents and maintain
LBA-ECO CD-10 Temperature Profiles at km 67 Tower Site, Tapajos National Forest
National Aeronautics and Space Administration — ABSTRACT: This data set contains a single text file which reports temperature measurements at the Para Western (Santarem) - km 67, Primary Forest Tower Site. This...
Directory of Open Access Journals (Sweden)
Helge Walentowski
2018-02-01
Full Text Available The Andes of northern Peru are still widely covered with forests, but increasingly suffer from habitat fragmentation. Subsequent soil degradation often leads to the abandonment of overused forests and pastures. Ecological knowledge on the restoration potential, e.g., on dependencies of soil conditions and altitude, is scarce. Therefore, we compared soil and vegetation patterns along nine transects within the upper Pomacochas Basin, which is an important biodiversity corridor along the Andes, between remaining forests, succession sites and pastures. Anthropogenic successional and disturbance levels, geological substrate, and altitude have the most important ecological impacts on vegetation and tree species composition. Species responded to sandstone versus calcareous substrates, but also to depths of the organic soil layer, and light conditions. The absence of organic layers under pastures contrasted with the accumulation of thick organic layers under forest cover. Vegetation composition at succession sites revealed certain starting points (herbal stage, bush stage, or secondary forest for restoration that will determine the length of regeneration paths. Pre-forest patches of Alchornea sp. and Parathesis sp. may act as habitat stepping stones for expeditiously restoring biocorridors for wildlife. The key findings can contribute to the sustainable use and conservation of biodiversity in a fragile ecoregion.
Directory of Open Access Journals (Sweden)
Hugo Gabriel Sánchez Villacis
2017-08-01
Full Text Available The Ecuadorian Amazon is recognized worldwide for its extraordinary megadiversity and multiplicity of forest goods and services. However, the inadequate practices of extractive use of non-timber forest products, the clearing of extensive areas of forests for the development of oil activity and the unsustainable use of timber as economic sustenance of communities have led to structural and functional changes In ecosystems. The study was carried out in three sites of a degraded evergreen forest of the eastern Amazon (Mera, Shell and Puyo in order to evaluate the effect of the degree of intervention on the forest structure. A floristic inventory was carried out with 60 plots of 25 x 25 m2 and tree species ≥ 2.5 cm d1.30 and species in natural regeneration phase with h <2 m were measured. We found 35 families, 65 genera, 101 species and 2 298 individuals, with Arecaceae, Fabaceae and Moraceae being the most representative botanical families. The degree of anthropization was highly modified where Mera was the best state of conservation. It was evidenced a low floristic diversity with patterns of alteration in the vertical and horizontal structure, distinguished phytosociologically by two strata in the sites of Shell and Puyo and by three in Mera, indicator of structural changes.
Directory of Open Access Journals (Sweden)
Philipp Werner Hopp
2011-06-01
Full Text Available Evaluating leaf litter beetle data sampled by Winkler extraction from Atlantic forest sites in southern Brazil. To evaluate the reliability of data obtained by Winkler extraction in Atlantic forest sites in southern Brazil, we studied litter beetle assemblages in secondary forests (5 to 55 years after abandonment and old-growth forests at two seasonally different points in time. For all regeneration stages, species density and abundance were lower in April compared to August; but, assemblage composition of the corresponding forest stages was similar in both months. We suggest that sampling of small litter inhabiting beetles at different points in time using the Winkler technique reveals identical ecological patterns, which are more likely to be influenced by sample incompleteness than by differences in their assemblage composition. A strong relationship between litter quantity and beetle occurrences indicates the importance of this variable for the temporal species density pattern. Additionally, the sampled beetle material was compared with beetle data obtained with pitfall traps in one old-growth forest. Over 60% of the focal species captured with pitfall traps were also sampled by Winkler extraction in different forest stages. Few beetles with a body size too large to be sampled by Winkler extraction were only sampled with pitfall traps. This indicates that the local litter beetle fauna is dominated by small species. Hence, being aware of the exclusion of large beetles and beetle species occurring during the wet season, the Winkler method reveals a reliable picture of the local leaf litter beetle community.
Energy Technology Data Exchange (ETDEWEB)
Rowcliffe, A.F. [Oak Ridge National Laboratory, TN (United States); Tsai, H.C.; Smith, D.L. [Argonne National Lab., IL (United States)] [and others
1997-08-01
The FUSION-1 irradiation capsule was inserted in Row 5 of the BOR-60 fast reactor in June 1995. The capsule contains a collaborative RF/U.S. experiment to investigate the irradiation performance of V-Cr-Ti alloys in the temperature range 310 to 350{degrees}C. This report describes the capsule layout, specimen fabrication history, and the detailed test matrix for the U.S. specimens. A description of the operating history and neutronics will be presented in the next semiannual report.
The Evaluation of Alkali Grass (Puccinellia ciliata Bor Populations in Aydin Province of Turkey
Directory of Open Access Journals (Sweden)
İlkay Yavaş
2017-08-01
Full Text Available Alkali grass grows in waterlogged, saline and alaline soils. The main problem in these soils is minerals at toxic level. The toxic ions are chloride, sodium and boron. A number of techniques have been investigated for removing toxic metals from the soil. Today, the cost-effective and environmentally technique is phytoremediation, using hyperaccumulator plants. Alkali grass (Puccinellia ciliata Bor is suggested as a hyperaccumulator plant by the combination of more favourable characteristics with salt and waterlogging tolerance, high biomass value and convincing nutritive value for adverse environmental conditions. For this reason, we collected alkali grass and soil samples from five different locations in Aydın-Muğla highway, Turanlar and Sınırteke villages in Germencik-Aydın. In the soil analysis, we observed that K accumulation varies between root, shoot and panicle at least whereas Na and B shows more variation on whole plant portions among locations. Intense aerenchyma development on the root tips of Puccinellia plant was observed and it is determined as radial lysogenic aerenchyma formation. Average plant height and dry matter values were between 47.2-74.4 cm and 15.61-80.85 g/plant according to locations. The highest plant height value was obtained from the first location whereas the highest dry matter yield was detected in the fifth location. In conclusion, plants from fifth location can be regarded as fodder plants in these areas. Our results indicated that alkali grass can be effective for phytoextraction of sodium and boron from contaminated sites.
1x2M steel performance in the BOR-60 steam generator
International Nuclear Information System (INIS)
Golovanov, V.N.; Shamardin, V.K.; Kondratiev, V.I.; Kryukov, F.N.; Chernobrovkin, Yu.V.; Bulanova, T.M.; Bai, V.F.
The results from studies of 1x2M steel characteristics are presented. This steel was used as the material for the BOR-60 steam generator that had been in operation under the steam generating mode for 18,000 hs (35,000 hs in sodium). It was revealed that the pit corrosion depth on the water/steam side evaporative tube surfaces was about 0.25 μm and less and the total corrosion rate was less than 0.06 mm/y. The mechanical properties of the material were essentially similar both in the evaporator and superheater and met all the requirements imposed on. Based on the analysis of data on the decarbonizaton depth in sodium and on the corrosion damage in water and steam it was concluded that 1x2M steel can be successfully used as the steam generator material at the operating temperatures up to 470 deg. C and had sufficiently longer service-life as compared to 18,000 hs. (author)
The Novo Okno copper deposit of olistostrome origin (Bor, Eastern Serbia
Directory of Open Access Journals (Sweden)
Antonijević Ivan
2011-01-01
Full Text Available The copper deposit Novo Okno, uncovered at present, with non-ore and ore clasts of massive sulphides (from 0.5 to 50 m3 in size, has many distinctive features that indicate its olistostrome origin. The deposit is chaotic in structure, unstratified, with the lower surface unconformable over the underlying parent rock of the basin. It is a lens-like body, with the longer axis directed east and west, variable in thickness from 15 to 28 metres, about 335 metres long and less than 140 metres wide. These and other characteristics of the body indicate a unified, reworked, olistostrome copper deposit formed from primary ore bodies of the Bor mineral deposit and vulcanite, destroyed by volcanic explosion into blocks and rocks of Turonian age and extrusion and concurrent deposition on the land surface. Gravitational massive sliding of the consolidated rocks down the slopes of the volcanic relief and chaotic accumulation of ore and non-ore clasts (olistoliths in a marine basin evolved in the Upper Turonian and the Lower Senonian.
Observation and Analysis of Particle Nucleation at a Forest Site in Southeastern US
This study examines the characteristics of new particle formation at a forest site in the Southeast U.S. Particle size distributions above a Loblolly pine plantation were measured between November, 2005 and September, 2007 and analyzed by event type and frequency as well as relat...
Organic Matter Decomposition following Harvesting and Site Preparation of a Forested Wetland
Carl C. Trettin; M. Davidian; M.F. Jurgensen; R. Lea
1996-01-01
Organic matter accumulation is an important process that affects ecosystem function in many northern wetlands. The cotton strip assay (CSA)was used to measure the effect of harvesting and two different site preparation treatments, bedding and trenching, on organic matter decomposition in a forested wetland. A Latin square experimental design was used to determine the...
IUFRO Symposium on forest site and continuous productivity: Seattle, Washington, August 22-28, 1982.
Russell Ballard; Stanley P. Gessel
1983-01-01
This Symposium was planned by members of the IUFRO Site Group (S1.02) as part of their on-going activities to facilitate the worldwide exchange of ideas among individual research workers and to promote the dissemination of research results in the area of forest site productivity. The Symposium consisted of three days of indoor sessions followed by a 2-1/2-day field...
Ozone concentrations at a selected high-elevation forest site downwind Mexico City
Torres-JArdon, R.
2013-05-01
Torres-Jardón, R.*, Rosas-Pérez, I., Granada-Macías, L. M., Ruiz-Suárez, L. G. Centro de Ciencias de la Atmósfera, UNAM, México D. F. México * rtorres@unam.mx For many years, the vegetation of forest species such as Abies religiosa in natural parks located in the southwest mountains of Mexico City has attracted much attention since these parks have been experiencing a severe decline of unclear etiology. The high ozone levels in the area and the observed naked eye macroscopic, histological and cytological injuries on these species, strongly suggest an important contribution of tropospheric ozone to this deterioration process. Apart of historical short monitoring campaigns for measuring ozone levels in these mountains, it is known just a little is known about the present exposure levels at which the local vegetation is exposed. A continuous ozone analyzer has been in operation since 2011 at a high-elevation forest site (Parque Nacional Miguel Hidalgo, PNMH; 3110 m above mean sea level) located downwind of Mexico City Metropolitan Area (MCMA), in order to characterize the local ozone diel amplitude and its seasonal trend, as well as the influence of MCMA on the local O3 concentrations. Hourly average ozone data in PNMH shows that in general, the diel of ozone concentrations in the forest site has a statistical significant correlation with the pattern of ozone levels observed in several monitoring sites (smog receptor sites) within the MCMA, although the high elevation O3 levels are relatively lower than those in the urban area (around 2200 m above mean sea level). It is possible that a part of the oxidants in the air masses are removed by sink deposition processes during the air mass transport across the hills. The diel amplitude of ozone concentrations is small in the cold season, increasing as the seasons advance to June. As in the city, the highest ozone concentrations occur in April or May and the lowest levels during the rainy season, which extends from
LBA-ECO CD-04 Meteorological and Flux Data, km 83 Tower Site, Tapajos National Forest
National Aeronautics and Space Administration — Tower flux measurements of carbon dioxide,water vapor, heat, and meteorological variables were obtained at the Tapajos National Forest, km 83 site, Santarem, Para,...
Pinto, Sheila Isabel do C; Martins, Sebastião V; de Barros, Nairam F; Dias, Herly Carlos T; Kunz, Sustanis H
2008-09-01
The floristic variations of shrub and tree components were studied in two sites of Semideciduous Forest, initial forest and mature forest, located in the Mata do Paraíso Forest Reserve, in Viçosa, State of Minas Gerais, Southeastern Brazil, in order to analyze the floristic similarity and the correlations between environmental variables and the distribution of tree species in these forests. Individual trees with a diameter at breast height (DBH) > or = 4.8 cm were sampled in twenty 10 x 30 m plots (10 plots in each site). The plots were distributed systematically at 10 m intervals. The environmental variables analyzed were: the canopy openness and soil chemical and texture characteristics. The two forest sites showed clear differences in the levels of canopy openness and soil fertility, factors that reflect the floristic and successional differences of the shrub and tree component, revealed by the low similarity between these forests by cluster analysis. The canonical correspondence analysis (CCA) of environmental variables and species abundance indicated that the species in these forests studied are distributed under strong influence of canopy openness, moisture and soil fertility.
International Nuclear Information System (INIS)
Ross, M.S.; Sah, J.P.; Ruiz, P.L.; Ross, M.S.; Ogurcak, D.E.
2010-01-01
In south Florida, tropical hardwood forests (hammocks) occur in Everglades tree islands and as more extensive forests in coastal settings in the nearby Florida Keys. Keys hammocks have been less disturbed by humans, and many qualify as old-growth, while Everglades hammocks have received much heavier use. With improvement of tree island condition an important element in Everglades restoration efforts, we examined stand structure in 23 Keys hammocks and 69 Everglades tree islands. Based on Stand Density Index and tree diameter distributions, many Everglades hammocks were characterized by low stocking and under-representation in the smaller size classes. In contrast, most Keys forests had the dense canopies and open under stories usually associated with old-growth hardwood hammocks. Subject to the same caveats that apply to off-site references elsewhere, structural information from mature Keys hammocks can be helpful in planning and implementing forest restoration in Everglades tree islands. In many of these islands, such restoration might involve supplementing tree stocking by planting native trees to produce more complete site utilization and a more open under story.
Directory of Open Access Journals (Sweden)
Tae-Sung Kwon
2014-09-01
Full Text Available This study examined the effects of forest disturbance and climate change on the ant fauna at the Long Term Ecological Research site in Gwangneung Forest, Korea in 2003 and 2012. After forest disturbance, the occurrence and abundance of ants belonging to the functional groups of forest ground forager and soil and litter dweller are predicted to decrease, while the occurrence and abundance of ants belonging to the open land forager and forest vegetation forager functional groups are predicted to increase. In terms of the effects of climate change, if the optimum temperature of the ants is lower than the annual average temperature in the survey area, the occurrence and abundance of the ants are predicted to decrease and vice versa. Ant surveys were carried out using pitfall traps. Changes in the dominant species, occurrence, and abundance mostly corresponded to the predictions for forest disturbance, but did not match the prediction for an increase in temperature.
Forest meteorology research within the Oak Ridge site, eastern deciduous forest biome, USIBP
International Nuclear Information System (INIS)
Hutchison, B.A.; Matt, D.R.
1977-01-01
The data presented here indicate that the diurnal trends in forest microclimate are dominated by the diurnal trend in incident solar radiation amounts and the diurnal changes in solar elevations. Absolute values of these microclimatic variables, on the other hand, reflect strongly, the synoptic climatic conditions present and, to a lesser degree, the interactions among synoptic climatic parameters, forest structure, forest physiology, and soil moisture conditions. The seasonal changes in forest microclimate are the result of changes in incident radiation amounts, earth-sun geometry, and phenological change in forest structure along with seasonal changes in synoptic climatic parameters. The temporal and spatial variations of solar radiation within and above a deciduous forest composed predominately of tulip poplar (biriodendron tulipifera) were documented and on attempt was made to relate the variations to forest structure
Directory of Open Access Journals (Sweden)
Rogério Ribeiro de Oliveira
Full Text Available Slash-and-burn agriculture has been practiced for a very long time by the traditional populations (caiçaras on Ilha Grande, Rio de Janeiro State, Brazil. After a few years of use the plots are abandoned to fallow. We examined the processes of litter production and decomposition and the relationships between forest lands used by caiçara populations and landscape functionality. Five and 25-year-old forests growing on areas once used for subsistence agriculture were compared to a near-climax forest site. No significant differences between the three areas were noted in terms of litter production over a 2-yr period; the average litter productions were 9,927, 8,707 and 10,031 kg/ha/yr for the 5-year, 25-year and climax forests respectively. N and K nutrient input through litter was greatest in the climax forest; P and Mg input was greatest in the 5-yr forest; and Na greatest in the 25-yr forest. Ground litter accumulation (3,040-3,730 kg/ha/yr was not significantly different in the three areas. Litter turnover times (1/K were 0.33, 0.42 and 0.38 for the 5-yr, 25-yr and climax forests respectively. These secondary forests cover almost all of Ilha Grande and demonstrate low species diversity, but they have production and decomposition systems similar to those of mature forests.
Directory of Open Access Journals (Sweden)
K. Schwärzel
2007-05-01
Full Text Available For a sustainable forest management, a site-specific knowledge on the water balance is a prerequisite. A simple and popular field method for assessing the water balance of forest sites is based on overlaying relief and soil information. Furthermore, climatic influence on the water balance is often restricted to longtime average values of precipitation and air temperature (whole year and/or growing season. However, the impacts of climate change and climatic extremes, as well as silvicultural changes, are inadequately considered. To overcome these short-comings, we integrated the 1D-SVAT model BROOK90 and a radiation model in a GIS to simulate the spatially distributed components of water balance of forest sites. In this paper, we present the model concept and show an approach to describe the influence of a complex terrain on parameters controlling the spatial distribution of energy and water fluxes.
Foliar and soil chemistry at red spruce sites in the Monongahela National Forest
Stephanie J. Connolly
2010-01-01
In 2005, soil and foliar chemistry were sampled from 10 sites in the Monongahela National Forest which support red spruce. Soils were sampled from hand-dug pits, by horizon, from the O-horizon to bedrock or 152 cm, and each pit was described fully. Replicate, archived samples also were collected.
LBA-ECO CD-04 Leaf Litter Data, km 83 Tower Site, Tapajos National Forest, Brazil
National Aeronautics and Space Administration — ABSTRACT: Above-ground litter productivity was measured in a 18 ha plot adjacent to the eddy flux tower at the logged forest tower site, km 83, Tapajos National...
DEFF Research Database (Denmark)
Ra, Koy; Pichdara, Lonn; Dararath, Yem
There is growing international interest in the role of forests in poverty prevention and reduction. In consequence, this broad area of investigation has been subject to increased research; one major international research project is that facilitated by the Poverty Environment Network (PEN). This ......). This project covers a large number of sites in 26 countries throughout the tropics. The present report contains contextual details, methodological information and preliminary findings for the PEN sites in Cambodia....
Scott, Neal A; Binkley, Dan
1997-07-01
The feedback between plant litterfall and nutrient cycling processes plays a major role in the regulation of nutrient availability and net primary production in terrestrial ecosystems. While several studies have examined site-specific feedbacks between litter chemistry and nitrogen (N) availability, little is known about the interaction between climate, litter chemistry, and N availability across different ecosystems. We assembled data from several studies spanning a wide range of vegetation, soils, and climatic regimes to examine the relationship between aboveground litter chemistry and annual net N mineralization. Net N mineralization declined strongly and non-linearly as the litter lignin:N ratio increased in forest ecosystems (r 2 = 0.74, P mineralization decreased linearly as litter lignin concentration increased, but the relationship was significant (r 2 = 0.63, P mineralization across this range of sites (r 2 litter lignin:N ratio and net N mineralization from forest floor and mineral soil was similar. The litter lignin:N ratio explained more of the variation in net N mineralization than climatic factors over a wide range of forest age classes, suggesting that litter quality (lignin:N ratio) may exert more than a proximal control over net N mineralization by influencing soil organic matter quality throughout the soil profile independent of climate.
New approach to the reclamation of the old flotation tailings in Bor
Directory of Open Access Journals (Sweden)
Dožić Stevan
2010-01-01
Full Text Available The old flotation tailings of the Bor copper mine have not been reclaimed for several decades, although it is a serious threat to the environment, especially to some parts of the town. To date, there have been no efficacious attempts of solving the problem by indirect rehabilitation, only several cases of direct reclamation. This paper presents some results of the experiment established on a part of the tailings in the vicinity of the town, where various variants of meliorated and sterile substrates were applied in the biological reclamation with several tree and grass species. The analysis shows that, in the rehabilitation of sterile substrate of the copper mine, it is possible to grow several woody species. The best results were achieved by the species that were planted in the fertile soil layer on the sterile copper mine substrate, and on the mixture of soil and waste. Among the woody species, Robinia pseudoaccacia, Fraxinus excelsior and Acer pseudoplatanus showed the best survival percent, growth, and physiological vitality and the poorest were spruce and common oak.
Čerevková, A; Renčo, M; Cagáň, L
2013-09-01
The nematode communities in spruce forests were compared with the short-term effects of forest damage, caused by windstorm, wildfire and management practices of forest soils. Soil samples were collected in June and October from 2006 to 2008 in four different sites: (1) forest unaffected by the wind (REF); (2) storm-felled forest with salvaged timber (EXT); (3) modified forest affected by timber salvage (wood removal) and forest fire (FIR); and (4) storm-felled forest where timber had been left unsalvaged (NEX). Nematode analysis showed that the dominant species in all four investigated sites were Acrobeloides nanus and Eudorylaimus silvaticus. An increase of A. nanus (35% of the total nematode abundance) in the first year in the FIR site led to the highest total abundance of nematodes compared with other sites, where nematode abundance reached the same level in the third year. In the FIR site bacterial feeders appeared to be the most representative trophic group, although in the second and third year, after disturbance, the abundance of this trophic group gradually decreased. In the NEX site, the number of nematode species, population densities and Maturity Index were similar to that recorded for the FIR site. In EXT and NEX sites, the other dominant species was the plant parasitic nematode Paratylenchus microdorus. Analyses of nematodes extracted from different forest soil samples showed that the highest number of species and diversity index for species (H'spp) were in the REF site. Differences between the nematode fauna in REF and other localities were clearly depicted by cluster analysis. The greatest Structure Index and Enrichment Index values were also in REF. In the EXT site, the number of nematode species, their abundance, H'spp and Maturity Index were not significantly different from those recorded in the reference site.
International Nuclear Information System (INIS)
1979-09-01
This engineering evaluation report (EER) addresses one of these MED/AEC sites known as Site A/Plot M, located in Palos Park, Illinois. The EER describes in technical detail a number of options for remedial action that could be taken with respect to the contamination at Site A/Plot M and presents estimates of the costs associated with these options. A companion document, Environmental Analysis Report on a Formerly Utilized MED/AEC Site, Site A and Plot M, Palos Forest Preserve, Palos Park, Illinois (ANL/ES-79), has also been prepared. It describes in detail the existing site environment and evaluates the environmental impacts of the various remedial options discussed in this report. This EER contributes to a better understanding of the mitigation or resolution of environmental problems posed by the subject MED/AEC site and serves as a basis for determining whether or not remedial actions are warranted. The knowledge derived from the evaluation of a number of remedial options should be helpful in the final disposition of other MED/AEC sites located elsewhere
Use of Municipal Sewage Sludge for Improvement of Forest Sites in the Southeast
Charles R. Berry
1987-01-01
In eight field experiments dried municipal sewage sludge was applied to forest sites before planting of seedlings. In all cases, tree growth was faster on sludge-amended plots than on plots that received fertilizer and lime or no amendment. Deep subsoiling was beneficial regardless of Soil amendment. Where weeds were plentiful at the outset, they became serious...
Distance to screening site and non-participation in screening for breast cancer
DEFF Research Database (Denmark)
Jensen, L F; Pedersen, A F; Andersen, B
2013-01-01
Dette studie undersøger, om der er en sammenhæng mellem afstand til screeningsenhederne og deltagelse i screening for brystkræft. Resultaterne viser, at kvinder, som bor tæt på screeningsenheden, og kvinder, som bor længere væk, er mere tilbøjelige til ikke at deltage i første screeningsrunde. Ved...
A multi-sites analysis on the ozone effects on Gross Primary Production of European forests
Energy Technology Data Exchange (ETDEWEB)
Proietti, C. [Department of Environmental Biology, Sapienza University of Rome, Piazzale Aldo Moro, 5, 00185 Rome (Italy); Anav, A. [Italian National Agency for New Technologies, Energy and the Environment (ENEA), C.R. Casaccia, Via Anguillarese 301, 00123 S. Maria di Galeria, Rome (Italy); University of Exeter, College of Engineering, Mathematics and Physical Sciences, Exeter (United Kingdom); De Marco, A. [Italian National Agency for New Technologies, Energy and the Environment (ENEA), C.R. Casaccia, Via Anguillarese 301, 00123 S. Maria di Galeria, Rome (Italy); Sicard, P. [ACRI-HE, 260 route du Pin Montard BP234, 06904 Sophia Antipolis-cedex (France); Vitale, M., E-mail: marcello.vitale@uniroma1.it [Department of Environmental Biology, Sapienza University of Rome, Piazzale Aldo Moro, 5, 00185 Rome (Italy)
2016-06-15
Ozone (O{sub 3}) is both a greenhouse gas and a secondary air pollutant causing adverse impacts on forests ecosystems at different scales, from cellular to ecosystem level. Specifically, the phytotoxic nature of O{sub 3} can impair CO{sub 2} assimilation that, in turn affects forest productivity. This study aims to evaluate the effects of tropospheric O{sub 3} on Gross Primary Production (GPP) at 37 European forest sites during the time period 2000–2010. Due to the lack of carbon assimilation data at O{sub 3} monitoring stations (and vice-versa) this study makes a first attempt to combine high resolution MODIS Gross Primary Production (GPP) estimates and O{sub 3} measurement data. Partial Correlations, Anomalies Analysis and the Random Forests Analysis (RFA) were used to quantify the effects of tropospheric O{sub 3} concentration and its uptake on GPP and to evaluate the most important factors affecting inter-annual GPP changes. Our results showed, along a North-West/South-East European transect, a negative impact of O{sub 3} on GPP ranging from 0.4% to 30%, although a key role of meteorological parameters respect to pollutant variables in affecting GPP was found. In particular, meteorological parameters, namely air temperature (T), soil water content (SWC) and relative humidity (RH) are the most important predictors at 81% of test sites. Moreover, it is interesting to highlight a key role of SWC in the Mediterranean areas (Spanish, Italian and French test sites) confirming that, soil moisture and soil water availability affect vegetation growth and photosynthesis especially in arid or semi-arid ecosystems such as the Mediterranean climate regions. Considering the pivotal role of GPP in the global carbon balance and the O{sub 3} ability to reduce primary productivity of the forests, this study can help in assessing the O{sub 3} impacts on ecosystem services, including wood production and carbon sequestration. - Highlights: • Assessment of the surface O{sub 3
Forest - added Turbulence: A parametric study on Turbulence intensity in and around forests
International Nuclear Information System (INIS)
Pedersen, Henrik Sundgaard; Langreder, Wiebke
2007-01-01
The scope of the investigation is to take on-site measured wind data from a number of sites inside and close to forests. From the collected on-site data the ambient turbulence intensity is calculated and analysed depending on the distance to the forest and height above the forest. From this forest turbulence intensity database it is possible to get an overview of the general behaviour of the turbulence above and down stream from the forest. The database currently consists of 65 measurements points from around the globe, and it will be continually updated as relevant sites are made available. Using the database a number of questions can be answered. How does the ambient turbulence intensity decay with height? What does the turbulence profile look like according to wind speed? Is it the general situation that high wind speeds are creating movement in the canopy tops, resulting in higher turbulence? How does the ambient turbulence intensity decay at different height as a function of distance to the forest? From the forest turbulence database it can be seen that in general, the majority of the turbulence intensity created by the forest is visible within a radius of 5 times the forest height in vertical and 500 meters downstream from the forest edge in horizontal direction. Outside these boundaries the ambient turbulence intensity is rapidly approaching normal values
Directory of Open Access Journals (Sweden)
Tahir Bilirli
2016-06-01
Full Text Available İmar Meclisi Raporlarında Borçlanma ve Selem Uygulaması (1845-1846 Öz Bu makale, Osmanlı Devleti'nde 1845 yılında ilan edilen Tensikât-ı mülkiye kararı çerçevesinde geçici olarak olarak kurulan İmar Meclisleri'nin görevlerini incelemektedir. Makalede, bu meclislerin özellikle halkın borç para alma durumları ile selem usulü denilen mahsulün hasattan önce satılması konusundaki faaliyetleri incelenmektedir. Hasat zamanından önce alınan vergi, ahaliyi borçlanmaya yöneltmekte, bu da halkın fahiş faiz oranlarıyla tefecilerden borç almalarına ve ürünün hasat edilmeden önce daha düşük fiyatlara satılmasına sebep olmaktaydı. Bu durum gelir kaybı nedeniyle hem tebaya hem de devlete zarar vermekteydi. İmar Meclisi memurları yaşanan bu sıkıntının giderilmesi noktasında yerinde durum tespiti yapmışlardır. Makalenin birinci bölümünde İmar Meclisleri'nin kuruluşu ve görevleri hakkında bilgi verilmektedir. İkinci bölümde makalenin ana konusu olan borçlanma ve selem usulünün uygulanmasının meclis raporlarına nasıl yansıdığı arşiv belgelerine göre ele alınmıştır. Makalenin sonuç bölümünde arşiv belgelerinde elde edilen veriler doğrultusunda değerlendirme yapılmıştır. Borrowing and Selem Practices in Ottoman Era According to "Macalis Imariyya (Development Counsils" Reports Abstract This article examines the mission of Macalis Imariyya (Develepment Counsils which were founded by the decree of Tankisat al-Mulkiyye declared in 1845. In the article, the activity of these Counsils about the indebtedness status of the people and the selling of products before the harvest -called “selem”- particularly examined. The tax collection before harvest period was impelling the people borrowing from usurers with excessive interest rates and to sell the product at nearly half price. This case was damaging both the state and the citizens because of income loss. Development Council
Directory of Open Access Journals (Sweden)
Swetha Stotrabhashyam
2015-01-01
Full Text Available The Long-billed Vulture Gyps indicus is, Critically Endangered with few known breeding sites in peninsular India. We present a previously undocumented Long-billed Vulture breeding site in Bejjur Reserve Forest, Adilabad District, northern Telangana.
Directory of Open Access Journals (Sweden)
Agus Budhie Wijatna
2013-11-01
Full Text Available ABSTRAK Untuk memenuhi kebutuhan air bersih bagi penduduk di daerah bekas bencana letusan Gunung Merapi, Kabupaten Sleman, DIY, telah dibuat 5 sumur bor di Dusun Srunen (BH1, Pagerjurang (BH2, Ngepring (BH3, Kuweron (BH4, dan di Dusun Bubur (BH5. Pembuatan sumur bor pada elevasi antara 544 sampai 846 m.dpl, dengan kedalaman antara 98-146 m dan debit pengambilan airtanah rerata 9-10 liter per detik tersebut dikawatirkan akan mempengaruhi kondisi muka airtanah sumur gali di Dusun Pendowoharjo (W7, Ngaglik (W8, Gebang (W9, Condong Catur (W10, sumur UGM (W11 dan mempengaruhi debit umbul (mataair Ngepas (S8, Umbul Jogopaten (S9, Umbul Pajangan (S10, Umbul Londo (S11, Umbul Permai (S12, dan Umbul Seturan (S13, yang berada pada elevasi 148-329 m.dpl. Secara teoritis, pengambilan airtanah di sumur bor akan berpengaruh jika terdapat interkoneksi hidraulik antara sumur bor dengan sumur gali dan mataair. Pada penelitian ini, interkoneksi hidraulik antara sumur bor dengan sumur gali dan mataair dilakukan menggunakan isotop lingkungan (D, 3H dan 18O. Penelitian diawali dengan menentukan lokasi pengambilan sampel airtanah berdasarkan peta topografi dan kondisi hidrologi; sampel airtanah diambil dari sumur bor, sumur gali dan mataair sebanyak 30 ml dan 1.000 ml; rasio isotop δD dan δ18O pada sampel airtanah diukur dengan liquid-water stable isotope analyzer LGR DLT-100, sedangkan kadar tritium diukur dengan Liquid Scientillation Counter (LSC Tri Carb 1900 TR. Genesis sampel airtanah ditentukan berdasarkan komposisi isotop (δ18O, δD dengan mengacu pada persamaan Merapi Meteoric Water Line (MMWL; sedangkan untuk memastikan adanya interkoneksi hidraulik, maka hasil pengukuran kadar tritium dianalisis dengan tritium dating method. Hasil penelitian menunjukkan bahwa genesis airtanah di BH1, BH2, BH3, dan BH4 berbeda dengan genesis airtanah sumur gali dan mataair di bawahnya. Sehingga dapat disimpulkan airtanah sumur bor di BH1, BH2, BH3, dan BH4 tidak memiliki
D. Max Smith; Deborah M. Finch; David L. Hawksworth
2009-01-01
Despite widespread efforts to avert wildfire by reducing the density of flammable vegetation, little is known about the effects of this practice on the reproductive biology of forest birds. We examined nest-site selection and nest survival of the Black-chinned Hummingbird (Archilochus alexandri) in New Mexico riparian forests treated or not for fuel...
DEFF Research Database (Denmark)
Dellwik, Ebba; Landberg, Lars; Jensen, Niels Otto
2005-01-01
This article compares mean wind estimates from a WAsP analysis for three forest sites and one site near a forest with measurements taken at the sites. By standard WAsP settings for forest, the mean wind speed at the sites was overestimated. Agreement between the estimates and the measurements...... improved significantly if displacement height and roughness length as calculated from the forest mast data were used or if a simple model estimate of roughness length and displacement height based on stand density (frontal area index) was used. The two estimates of displacement height and roughness length...... (mast data and simple model) did not agree well with each other. One reason for this may be that all evaluated sites are windy and that both d and z0 depend on the wind speed. All analysed forest sites are dense, in which case the influence from the roughness sublayer is limited and the effect on mean...
CTFS-ForestGEO: a worldwide network monitoring forests in an era of global change
Energy Technology Data Exchange (ETDEWEB)
Anderson-Teixeira, Kristina J. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Smithsonian Conservation Biology Inst. (SCBI), Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Davies, Stuart J. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; National Museum of Natural History, Washington, DC (United States). Dept. of Botany; Bennett, Amy C. [Smithsonian Conservation Biology Inst. (SCBI), Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Gonzalez-Akre, Erika B. [Smithsonian Conservation Biology Inst. (SCBI), Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Muller-Landau, Helene C. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Joseph Wright, S. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Abu Salim, Kamariah [Univ. of Brunei Darussalam, Bandar Seri Begawan (Brunei). Faculty of Science. Environmental and Life Sciences; Almeyda Zambrano, Angélica M. [Smithsonian Conservation Biology Inst. (SCBI), Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Stanford Univ., CA (United States). Stanford Woods Inst. for the Environment; Univ. of Alabama, Tuscaloosa, AL (United States). Dept. of Geography; Alonso, Alfonso [Smithsonian Conservation Biology Inst., Washington, DC (United States). National Zoological Park. Center for Conservation Education and Sustainability; Baltzer, Jennifer L. [Wilfrid Laurier Univ., Waterloo, ON (Canada). Dept. of Biology; Basset, Yves [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Bourg, Norman A. [Smithsonian Conservation Biology Inst. (SCBI), Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Broadbent, Eben N. [Smithsonian Conservation Biology Inst. (SCBI), Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Stanford Univ., CA (United States). Stanford Woods Inst. for the Environment; Univ. of Alabama, Tuscaloosa, AL (United States). Dept. of Geography; Brockelman, Warren Y. [Mahidol Univ., Bangkok (Thailand). Dept. of Biology; Bunyavejchewin, Sarayudh [Dept. of National Parks, Wildlife and Plant Conservation, Bangkok (Thailand). Research Office; Burslem, David F. R. P. [Univ. of Aberdeen (United Kingdom). School of Biological Sciences; Butt, Nathalie [Univ. of Queensland, St. Lucia (Australia). School of Biological Sciences; Univ. of Oxford (United Kingdom). School of Geography and the Environment. Environmental Change Inst.; Cao, Min [Chinese Academy of Sciences (CAS), Kunming (China). Xishuangbanna Tropical Botanical Garden. Key Lab. of Tropical Forest Ecology; Cardenas, Dairon [Sinchi Amazonic Inst. of Scientific Research, Bogota (Colombia); Chuyong, George B. [Univ. of Buea (Cameroon). Dept. of Botany and Plant Physiology; Clay, Keith [Indiana Univ., Bloomington, IN (United States). Dept. of Biology; Cordell, Susan [USDA Forest Service, Hilo, HI (United States). Inst. of Pacific Islands Forestry; Dattaraja, Handanakere S. [Indian Inst. of Science, Bangalore (India). Centre for Ecological Sciences; Deng, Xiaobao [Chinese Academy of Sciences (CAS), Kunming (China). Xishuangbanna Tropical Botanical Garden. Key Lab. of Tropical Forest Ecology; Detto, Matteo [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Du, Xiaojun [Chinese Academy of Sciences (CAS), Beijing (China). Inst. of Botany; Duque, Alvaro [Univ. Nacional de Colombia, Medellin (Colombia). Dept. de Ciencias Forestales; Erikson, David L. [National Museum of Natural History, Washington, DC (United States). Dept. of Botany; Ewango, Corneille E. N. [Okapi Wildlife Reserve, Epulu (Democratic Republic of the Congo). Centre de Formation et de Recherche en Conservation Forestiere (CEFRECOF); Fischer, Gunter A. [Kadoorie Farm and Botanic Garden, Tai Po, Hong Kong (China); Fletcher, Christine [Forest Research Inst. Malaysia (FRIM), Selangor (Malaysia); Foster, Robin B. [The Field Museum, Chicago, IL (United States). Botany Dept.; Giardina, Christian P. [USDA Forest Service, Hilo, HI (United States). Inst. of Pacific Islands Forestry; Gilbert, Gregory S. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Univ. of California, Santa Cruz, CA (United States). Environmental Studies Dept.; Gunatilleke, Nimal [Univ. of Peradeniya (Sri Lanka). Faculty of Science. Dept. of Botany; Gunatilleke, Savitri [Univ. of Peradeniya (Sri Lanka). Faculty of Science. Dept. of Botany; Hao, Zhanqing [Chinese Academy of Sciences (CAS), Shenyang (China). State Key Lab. of Forest and Soil Ecology. Inst. of Applied Ecology; Hargrove, William W. [USDA-Forest Service Station Headquarters, Asheville, NC (United States). Eastern Forest Environmental Threat Assessment Center; Hart, Terese B. [Lukuru Wildlife Research Foundation, Kinshasa (Democratic Republic of the Congo). Tshuapa-Lomami-Lualaba Project; Hau, Billy C. H. [Univ. of Hong Kong (China). School of Biological Sciences. Kadoorie Inst.; He, Fangliang [Univ. of Alberta, Edmonton, AB (Canada). Dept. of Renewable Resources; Hoffman, Forrest M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Computational Earth Sciences Group; Howe, Robert W. [Univ. of Wisconsin, Green Bay, WI (United States). Dept. of Natural and Applied Sciences; Hubbell, Stephen P. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Univ. of California, Los Angeles, CA (United States). Dept. of Ecology and Evolutionary Biology; Inman-Narahari, Faith M. [Univ. of Hawaii, Honolulu, HI (United States). College of Tropical Agriculture and Human Resources; Jansen, Patrick A. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Wageningen Univ. (Netherlands). Resource Ecology Group; Jiang, Mingxi [Chinese Academy of Sciences (CAS), Wuhan (China). Wuhan Botanical Garden; Johnson, Daniel J. [Indiana Univ., Bloomington, IN (United States). Dept. of Biology; Kanzaki, Mamoru [Kyoto Univ. (Japan). Graduate School of Agriculture; Kassim, Abdul Rahman [Forest Research Inst. Malaysia (FRIM), Selangor (Malaysia); Kenfack, David [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; National Museum of Natural History, Washington, DC (United States). Dept. of Botany; Kibet, Staline [National Museums of Kenya, Nairobi (Kenya); Univ. of Nairobi (Kenya). Land Resource Management and Agricultural Technology Dept.; Kinnaird, Margaret F. [Mpala Research Centre, Nanyuki (Kenya); Wildlife Conservation Society, New York, NY (United States). Global Conservation Programs; Korte, Lisa [Smithsonian Conservation Biology Inst., Washington, DC (United States). National Zoological Park. Center for Conservation Education and Sustainability; Kral, Kamil [Silva Tarouca Research Inst., Brno (Czech Republic). Dept. of Forest Ecology; Kumar, Jitendra [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Computational Earth Sciences Group; Larson, Andrew J. [Univ. of Montana, Missoula, MT (United States). College of Forestry and Conservation. Dept. of Forest Management; Li, Yide [Chinese Academy of Forestry, Guangzhou (China). Research Inst. of Tropical Forestry; Li, Xiankun [Chinese Academy of Sciences (CAS), Guilin (China). Guangxi Inst. of Botany; Liu, Shirong [Chinese Academy of Forestry, Beijing (China). Research Inst. of Forest Ecology, Environment and Protection; Lum, Shawn K. Y. [Nanyang Technological Univ. (Singapore). National Inst. of Education. Natural Sciences and Science Education Academic Group; Lutz, James A. [Utah State Univ., Logan, UT (United States). Wildland Resources Dept.; Ma, Keping [Chinese Academy of Sciences (CAS), Beijing (China). Inst. of Botany; Maddalena, Damian M. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States). Computational Earth Sciences Group; Makana, Jean-Remy [Wildlife Conservation Society, Brazzaville (Democratic Republic of the Congo); Malhi, Yadvinder [Univ. of Oxford (United Kingdom). School of Geography and the Environment. Environmental Change Inst.; Marthews, Toby [Univ. of Oxford (United Kingdom). School of Geography and the Environment. Environmental Change Inst.; Mat Serudin, Rafizah [Univ. of Brunei Darussalam, Bandar Seri Begawan (Brunei). Faculty of Science. Environmental and Life Sciences; McMahon, Sean M. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Smithsonian Environmental Research Center, Edgewater, MD (United States). Forest Ecology Group; McShea, William J. [Smithsonian Conservation Biology Inst., Front Royal, VA (United States). National Zoological Park. Conservation Ecology Center; Memiaghe, Hervé R. [Inst. de Recherche en Ecologie Tropicale, Libreville (Gabon). Centre National de la Recherche Scientifique et Technologique; Mi, Xiangcheng [Chinese Academy of Sciences (CAS), Beijing (China). Inst. of Botany; Mizuno, Takashi [Kyoto Univ. (Japan). Graduate School of Agriculture; Morecroft, Michael [Natural England, Sheffield (United Kingdom); Myers, Jonathan A. [Washington Univ., St. Louis, MO (United States). Dept. of Biology; Novotny, Vojtech [New Guinea Binatang Research Centre, Madang (Papua New Guinea); Univ. of South Bohemia, Ceske Budejovice (Czech Republic). Academy of Sciences of the Czech Republic. Faculty of Science. Biology Centre; de Oliveira, Alexandre A. [Univ. of Sao Paulo (Brazil). Inst. of Biosciences. Ecology Dept.; Ong, Perry S. [Univ. of the Philippines Diliman, Quezon City (Philippines). Inst. of Biology; Orwig, David A. [Harvard Univ., Petersham, MA (United States). Harvard Forest; Ostertag, Rebecca [Univ. of Hawaii, Hilo, HI (United States). Dept. of Biology; den Ouden, Jan [Wageningen Univ. (Netherlands). Forest Ecology and Forest Management Group; Parker, Geoffrey G. [Smithsonian Environmental Research Center, Edgewater, MD (United States). Forest Ecology Group; Phillips, Richard P. [Indiana Univ., Bloomington, IN (United States). Dept. of Biology; Sack, Lawren [Univ. of California, Los Angeles, CA (United States). Dept. of Ecology and Evolutionary Biology; Sainge, Moses N. [Tropical Plant Exploration Group (TroPEG), Mundemba (Cameroon); Sang, Weiguo [Chinese Academy of Sciences (CAS), Beijing (China). Inst. of Botany; Sri-ngernyuang, Kriangsak [Maejo Univ., Chiang Mai (Thailand). Faculty of Architecture and Environmental Design; Sukumar, Raman [Indian Inst. of Science, Bangalore (India). Centre for Ecological Sciences; Sun, I-Fang [National Dong Hwa Univ., Hualian (Taiwan). Dept. of Natural Resources and Environmental Studies; Sungpalee, Witchaphart [Maejo Univ., Chiang Mai (Thailand). Faculty of Architecture and Environmental Design; Suresh, Hebbalalu Sathyanarayana [Indian Inst. of Science, Bangalore (India). Centre for Ecological Sciences; Tan, Sylvester [Sarawak Forest Dept., Kuching (Malaysia); Thomas, Sean C. [Univ. of Toronto, ON (Canada). Faculty of Forestry; Thomas, Duncan W. [Washington State Univ., Vancouver, WA (United States). School of Biological Sciences; Thompson, Jill [Centre for Ecology and Hydrology, Penicuik, Scotland (United Kingdom); Univ. of Puerto Rico Rio Pedras, San Juan (Puerto Rico). Dept. of Environmental Science. Inst. for Tropical Ecosystem Studies; Turner, Benjamin L. [Smithsonian Tropical Research Inst. (STRI), Panama (Panama). Center for Tropical Forest Science. Forest Global Earth Observatory; Uriarte, Maria [Columbia Univ., New York, NY (United States). Dept. of Ecology, Evolution and Environmental Biology; Valencia, Renato [Pontifical Catholic Univ. of Ecuador, Quito (Ecuador). Dept. of Biological Sciences; Vallejo, Marta I. [Inst. Alexander von Humboldt, Bogota (Colombia); Vicentini, Alberto [National Inst. of Amazonian Research (INPA), Manaus (Brazil); Vrška, Tomáš [Silva Tarouca Research Inst., Brno (Czech Republic). Dept. of Forest Ecology; Wang, Xihua [East China Normal Univ. (ECNU), Shanghai (China). School of Ecological and Environmental Sciences; Wang, Xugao [Lukuru Wildlife Research Foundation, Kinshasa (Democratic Republic of the Congo). Tshuapa-Lomami-Lualaba Project; Weiblen, George [Univ. of Minnesota, St. Paul, MN (United States). Dept. of Plant Biology; Wolf, Amy [Univ. of Wisconsin, Green Bay, WI (United States). Dept. of Biology. Dept. of Natural and Applied Sciences; Xu, Han [Chinese Academy of Forestry, Guangzhou (China). Research Inst. of Tropical Forestry; Yap, Sandra [Univ. of the Philippines Diliman, Quezon City (Philippines). Inst. of Biology; Zimmerman, Jess [Univ. of Puerto Rico Rio Piedras, San Juan (Puerto Rico). Dept. of Environmental Science. Inst. for Tropical Ecosystem Studies
2014-09-25
Global change is impacting forests worldwide, threatening biodiversity and ecosystem services, including climate regulation. Understanding how forests respond is critical to forest conservation and climate protection. This review describes an international network of 59 long-term forest dynamic research sites useful for characterizing forest responses to global change. The broad suite of measurements made at the CTFS-ForestGEO sites make it possible to investigate the complex ways in which global change is impacting forest dynamics. ongoing research across the network is yielding insights into how and why the forests are changing, and continued monitoring will provide vital contributions to understanding worldwide forest diversity and dynamics in a era of global change
Nathan J. Poage; Peter J. Weisberg; Peter C. Impara; John C. Tappeiner; Thomas S. Sensenig
2009-01-01
Knowledge of forest development is basic to understanding the ecology, dynamics, and management of forest ecosystems. We hypothesized that the age structure patterns of Douglas-fir at 205 old forest sites in western Oregon are extremely variable with long and (or) multiple establishment periods common, and that these patterns reflect variation in regional-scale climate...
Energy Technology Data Exchange (ETDEWEB)
Mahia, J.; Perez-Ventura, L.; Cabaneiro, A.; Diaz-Ravina, M.
2006-07-01
The effects of stand age, site index and parent material on soil biochemical properties related to biomass (extractable C, microbial C and metabolic quotient) were examined in the 0-15 cm mineral soil layers of Pinus pinaster and Pinus sylvestris stand from NW Spain. Two productivity levels (low and high site index), two ages (young and old) and two parent soil materials (granite and acid schists) were considered. The data indicated that there were differences in microbial parameters in soils under different species. In general in P. pinaster forest higher values of biochemical parameters expressed on organic C basis, were observed in the stands of high site index as compared with the low ones; in contrast, in P. sylvestris no differences among stand site index were detected. In both species different results were also observed depending on parent material and a significant effect of stand age was detected for extractable C and microbial C in P. pinaster forest developed over granite. The data seem to indicate that measured parameters may have the potential to be used as indicators of the effect of forest management on soil organic matter quality. (Author) 25 refs.
Bulgarian Rila mountain forest ecosystems study site: site description and SO42-, NO3- deposition
Karl Zeller; Christo Bojinov; Evgeny Donev; Nedialko Nikolov
1998-01-01
Bulgaria's forest ecosystems (31 percent of the country's area) are considered vulnerable to dry and wet pollution deposition. Coniferous forests that cover one-third of the total forest land are particularly sensitive to pollution loads. The USDA Forest Service, Sofia University, and the Bulgarian Forest Research Institute (FRI) established a cooperative...
Directory of Open Access Journals (Sweden)
Danaë M A Rozendaal
Full Text Available In closed-canopy forests, gap formation and closure are thought to be major drivers of forest dynamics. Crown defoliation by insects, however, may also influence understory resource levels and thus forest dynamics. We evaluate the effect of a forest tent caterpillar outbreak on understory light availability, soil nutrient levels and tree seedling height growth in six sites with contrasting levels of canopy defoliation in a hardwood forest in northern lower Michigan. We compared resource levels and seedling growth of six hardwood species before, during and in the three years after the outbreak (2008-2012. Canopy openness increased strongly during the forest tent caterpillar outbreak in the four moderately and severely defoliated sites, but not in lightly defoliated sites. Total inorganic soil nitrogen concentrations increased in response to the outbreak in moderately and severely defoliated sites. The increase in total inorganic soil nitrogen was driven by a strong increase in soil nitrate, and tended to become stronger with increasing site defoliation. Seedling height growth increased for all species in the moderately and severely defoliated sites, but not in lightly defoliated sites, either during the outbreak year or in the year after the outbreak. Growth increases did not become stronger with increasing site defoliation, but were strongest in a moderately defoliated site with high soil nutrient levels. Growth increases tended to be strongest for the shade intolerant species Fraxinus americana and Prunus serotina, and the shade tolerant species Ostrya virginiana. The strong growth response of F. americana and P. serotina suggests that recurring forest tent caterpillar outbreaks may facilitate the persistence of shade intolerant species in the understory in the absence of canopy gaps. Overall, our results suggest that recurrent canopy defoliation resulting from cyclical forest insect outbreaks may be an additional driver of dynamics in
Rozendaal, Danaë M A; Kobe, Richard K
2016-01-01
In closed-canopy forests, gap formation and closure are thought to be major drivers of forest dynamics. Crown defoliation by insects, however, may also influence understory resource levels and thus forest dynamics. We evaluate the effect of a forest tent caterpillar outbreak on understory light availability, soil nutrient levels and tree seedling height growth in six sites with contrasting levels of canopy defoliation in a hardwood forest in northern lower Michigan. We compared resource levels and seedling growth of six hardwood species before, during and in the three years after the outbreak (2008-2012). Canopy openness increased strongly during the forest tent caterpillar outbreak in the four moderately and severely defoliated sites, but not in lightly defoliated sites. Total inorganic soil nitrogen concentrations increased in response to the outbreak in moderately and severely defoliated sites. The increase in total inorganic soil nitrogen was driven by a strong increase in soil nitrate, and tended to become stronger with increasing site defoliation. Seedling height growth increased for all species in the moderately and severely defoliated sites, but not in lightly defoliated sites, either during the outbreak year or in the year after the outbreak. Growth increases did not become stronger with increasing site defoliation, but were strongest in a moderately defoliated site with high soil nutrient levels. Growth increases tended to be strongest for the shade intolerant species Fraxinus americana and Prunus serotina, and the shade tolerant species Ostrya virginiana. The strong growth response of F. americana and P. serotina suggests that recurring forest tent caterpillar outbreaks may facilitate the persistence of shade intolerant species in the understory in the absence of canopy gaps. Overall, our results suggest that recurrent canopy defoliation resulting from cyclical forest insect outbreaks may be an additional driver of dynamics in temperate closed
Liu, Chao; Chen, Fang-Yuan; Tian, Hong-Rui; Ai, Jing; Yang, Weiting; Pan, Qing-Jiang; Sun, Zhong-Ming
2017-11-20
Two novel three-dimensional interpenetrated uranyl-organic frameworks, (NH 4 ) 4 [(UO 2 ) 4 (L 1 ) 3 ]·6H 2 O (1) and [(UO 2 ) 2 (H 2 O) 2 L 2 ]·2H 2 O (2), where L 1 = tetrakis(3-carboxyphenyl)silicon and L 2 = tetrakis(4-carboxyphenyl)silicon, were synthesized by a combination of two isomeric tetrahedral silicon-centered ligands with 3-connected triangular [(UO 2 )(COO) 3 ] - and 4-connected dinuclear [(UO 2 ) 2 (COO) 4 ] units, respectively. Structural analyses indicate that 1 possesses a 2-fold interpenetrating anion bor network, while 2 exhibits a 3-fold interpenetrated 4,4-connected neutral network with pts topology. Both compounds were characterized by thermogravimetric analysis and IR, UV-vis, and photoluminescence spectroscopy. A relativistic density functional theory (DFT) investigation on 10 model compounds of 1 and 2 shows good agreement of the structural parameters, stretching vibrational frequencies, and absorption with experimental results; the time-dependent DFT calculations unravel that low-energy absorption bands originate from ligand-to-uranium charge transfer.
Radiation risk in Finland due to the nuclear power plant at Sosnovyj Bor
International Nuclear Information System (INIS)
Ilvonen, M.; Rossi, J.; Salonoja, M.
1994-06-01
The present study is an application of the long range transport and dose model TRADOS developed jointly by the Finnish Meteorological Institute and Technical Research Centre of Finland. The aim of the study is to assess the radiation risk in Finland due to the nuclear power plant at Sosnovyj Bor near St. Petersburg in Russia. Probabilities of reaching different parts of the country, transport time and time spent over Finland by the trajectories are presented. Also breadth of the radioactive cloud and incidence of rain are estimated. The calculated radiation doses are based on one single hypothetical release, in which all noble gases are released, together with 10 % of easily vaporizing elements and 1 % of others. All results are based on the assumption that the probability of the release is 100 %. The dose pathways calculated are cloud gamma, fallout gamma, inhalation, and ingestion of milk, meat, green vegetables, grain and roots. External dose rates have been calculated. The necessity of countermeasures and the ratio of the avertable dose to the costs are also assessed. (13 refs., 156 figs., 12 tabs.)
Forest Soil Productivity on the Southern Long-Term Soil Productivity Sites at Age 5
D. Andrew Scott; Allan E. Tiarks; Felipe G. Sanchez; Michael Elliott-Smith; Rick Stagg
2004-01-01
Forest management operations have the potential to reduce soil productivity through organic matter and nutrient removal and soil compaction. We measured pine volume, bulk density, and soil and foliar nitrogen and phosphorus at age 5 on the 13 southern Long-Term Soil Productivity study sites. The treatments were organic matter removal [bole only (BO), whole tree (WT),...
International Nuclear Information System (INIS)
Rowley, R.; Waites, C.; Macleod, I.D.
1989-01-01
Data from boiling experiments in the BOR 60 reactor in USSR has been supplied by IAEA to enable analysis techniques to be compared. The signals have been analysed at RNL using two basic techniques, High Frequency RMS analysis and Pulse Counting analysis and two more sophisticated methods, Pattern Recognition and Pulse Timing Analysis. All methods indicated boiling successfully, pulse counting proved more sensitive than RMS for the detection of the onset of boiling. Pattern Recognition shows promise of a very reliable detector provided the background can be defined. Data from an Ionisation chamber was also supplied and there was good correlation between the neutronic and acoustic signals. (author). 25 figs, 4 tabs
Directory of Open Access Journals (Sweden)
José Carlos Morante-Filho
Full Text Available Habitat loss is the dominant threat to biodiversity and ecosystem functioning in terrestrial environments. In this study, we used an a priori classification of bird species based on their dependence on native forest habitats (forest-specialist and habitat generalists and specific food resources (frugivores and insectivores to evaluate their responses to forest cover reduction in landscapes in the Brazilian Atlantic Forest. From the patch-landscapes approach, we delimited 40 forest sites, and quantified the percentage of native forest within a 2 km radius around the center of each site (from 6 - 85%. At each site, we sampled birds using the point-count method. We used a null model, a generalized linear model and a four-parameter logistic model to evaluate the relationship between richness and abundance of the bird groups and the native forest amount. A piecewise model was then used to determine the threshold value for bird groups that showed nonlinear responses. The richness and abundance of the bird community as a whole were not affected by changes in forest cover in this region. However, a decrease in forest cover had a negative effect on diversity of forest-specialist, frugivorous and insectivorous birds, and a positive effect on generalist birds. The species richness and abundance of all ecological groups were nonlinearly related to forest reduction and showed similar threshold values, i.e., there were abrupt changes in individuals and species numbers when forest amount was less than approximately 50%. Forest sites within landscapes with forest cover that was less than 50% contained a different bird species composition than more extensively forested sites and had fewer forest-specialist species and higher beta-diversity. Our study demonstrated the pervasive effect of forest reduction on bird communities in one of the most important hotspots for bird conservation and shows that many vulnerable species require extensive forest cover to persist.
Morante-Filho, José Carlos; Faria, Deborah; Mariano-Neto, Eduardo; Rhodes, Jonathan
2015-01-01
Habitat loss is the dominant threat to biodiversity and ecosystem functioning in terrestrial environments. In this study, we used an a priori classification of bird species based on their dependence on native forest habitats (forest-specialist and habitat generalists) and specific food resources (frugivores and insectivores) to evaluate their responses to forest cover reduction in landscapes in the Brazilian Atlantic Forest. From the patch-landscapes approach, we delimited 40 forest sites, and quantified the percentage of native forest within a 2 km radius around the center of each site (from 6 - 85%). At each site, we sampled birds using the point-count method. We used a null model, a generalized linear model and a four-parameter logistic model to evaluate the relationship between richness and abundance of the bird groups and the native forest amount. A piecewise model was then used to determine the threshold value for bird groups that showed nonlinear responses. The richness and abundance of the bird community as a whole were not affected by changes in forest cover in this region. However, a decrease in forest cover had a negative effect on diversity of forest-specialist, frugivorous and insectivorous birds, and a positive effect on generalist birds. The species richness and abundance of all ecological groups were nonlinearly related to forest reduction and showed similar threshold values, i.e., there were abrupt changes in individuals and species numbers when forest amount was less than approximately 50%. Forest sites within landscapes with forest cover that was less than 50% contained a different bird species composition than more extensively forested sites and had fewer forest-specialist species and higher beta-diversity. Our study demonstrated the pervasive effect of forest reduction on bird communities in one of the most important hotspots for bird conservation and shows that many vulnerable species require extensive forest cover to persist.
Keith, Heather; Mackey, Brendan G; Lindenmayer, David B
2009-07-14
From analysis of published global site biomass data (n = 136) from primary forests, we discovered (i) the world's highest known total biomass carbon density (living plus dead) of 1,867 tonnes carbon per ha (average value from 13 sites) occurs in Australian temperate moist Eucalyptus regnans forests, and (ii) average values of the global site biomass data were higher for sampled temperate moist forests (n = 44) than for sampled tropical (n = 36) and boreal (n = 52) forests (n is number of sites per forest biome). Spatially averaged Intergovernmental Panel on Climate Change biome default values are lower than our average site values for temperate moist forests, because the temperate biome contains a diversity of forest ecosystem types that support a range of mature carbon stocks or have a long land-use history with reduced carbon stocks. We describe a framework for identifying forests important for carbon storage based on the factors that account for high biomass carbon densities, including (i) relatively cool temperatures and moderately high precipitation producing rates of fast growth but slow decomposition, and (ii) older forests that are often multiaged and multilayered and have experienced minimal human disturbance. Our results are relevant to negotiations under the United Nations Framework Convention on Climate Change regarding forest conservation, management, and restoration. Conserving forests with large stocks of biomass from deforestation and degradation avoids significant carbon emissions to the atmosphere, irrespective of the source country, and should be among allowable mitigation activities. Similarly, management that allows restoration of a forest's carbon sequestration potential also should be recognized.
Re-evaluation of forest biomass carbon stocks and lessons from the world's most carbon-dense forests
Keith, Heather; Mackey, Brendan G.; Lindenmayer, David B.
2009-01-01
From analysis of published global site biomass data (n = 136) from primary forests, we discovered (i) the world's highest known total biomass carbon density (living plus dead) of 1,867 tonnes carbon per ha (average value from 13 sites) occurs in Australian temperate moist Eucalyptus regnans forests, and (ii) average values of the global site biomass data were higher for sampled temperate moist forests (n = 44) than for sampled tropical (n = 36) and boreal (n = 52) forests (n is number of sites per forest biome). Spatially averaged Intergovernmental Panel on Climate Change biome default values are lower than our average site values for temperate moist forests, because the temperate biome contains a diversity of forest ecosystem types that support a range of mature carbon stocks or have a long land-use history with reduced carbon stocks. We describe a framework for identifying forests important for carbon storage based on the factors that account for high biomass carbon densities, including (i) relatively cool temperatures and moderately high precipitation producing rates of fast growth but slow decomposition, and (ii) older forests that are often multiaged and multilayered and have experienced minimal human disturbance. Our results are relevant to negotiations under the United Nations Framework Convention on Climate Change regarding forest conservation, management, and restoration. Conserving forests with large stocks of biomass from deforestation and degradation avoids significant carbon emissions to the atmosphere, irrespective of the source country, and should be among allowable mitigation activities. Similarly, management that allows restoration of a forest's carbon sequestration potential also should be recognized. PMID:19553199
Directory of Open Access Journals (Sweden)
Kezia eGoldmann
2015-11-01
Full Text Available Fungal communities have been shown to be highly sensitive towards shifts in plant diversity and species composition in forest ecosystems. However, little is known about the impact of forest management on fungal diversity and community composition of geographically separated sites. This study examined the effects of four different forest management types on soil fungal communities. These forest management types include age class forests of young managed beech (Fagus sylvatica L., with beech stands age of approximately 30 years, age class beech stands with an age of approximately 70 years, unmanaged beech stands, and coniferous stands dominated by either pine (Pinus sylvestris L. or spruce (Picea abies Karst. which are located in three study sites across Germany. Soil were sampled from 48 study plots and we employed fungal ITS rDNA pyrotag sequencing to assess the soil fungal diversity and community structure.We found that forest management type significantly affects the Shannon diversity of soil fungi and a significant interaction effect of study site and forest management on the fungal OTU richness. Consequently distinct fungal communities were detected in the three study sites and within the four forest management types, which were mainly related to the main tree species. Further analysis of the contribution of soil properties revealed that C/N ratio being the most important factor in all the three study sites whereas soil pH was significantly related to the fungal community in two study sites. Functional assignment of the fungal communities indicated that 38% of the observed communities were Ectomycorrhizal fungi (ECM and their distribution is significantly influenced by the forest management. Soil pH and C/N ratio were found to be the main drivers of the ECM fungal community composition. Additional fungal community similarity analysis revealed the presence of study site and management type specific ECM genera.This study extends our knowledge
Goldmann, Kezia; Schöning, Ingo; Buscot, François; Wubet, Tesfaye
2015-01-01
Fungal communities have been shown to be highly sensitive toward shifts in plant diversity and species composition in forest ecosystems. However, little is known about the impact of forest management on fungal diversity and community composition of geographically separated sites. This study examined the effects of four different forest management types on soil fungal communities. These forest management types include age class forests of young managed beech (Fagus sylvatica L.), with beech stands age of approximately 30 years, age class beech stands with an age of approximately 70 years, unmanaged beech stands, and coniferous stands dominated by either pine (Pinus sylvestris L.) or spruce (Picea abies Karst.) which are located in three study sites across Germany. Soil were sampled from 48 study plots and we employed fungal ITS rDNA pyrotag sequencing to assess the soil fungal diversity and community structure. We found that forest management type significantly affects the Shannon diversity of soil fungi and a significant interaction effect of study site and forest management on the fungal operational taxonomic units richness. Consequently distinct fungal communities were detected in the three study sites and within the four forest management types, which were mainly related to the main tree species. Further analysis of the contribution of soil properties revealed that C/N ratio being the most important factor in all the three study sites whereas soil pH was significantly related to the fungal community in two study sites. Functional assignment of the fungal communities indicated that 38% of the observed communities were Ectomycorrhizal fungi (ECM) and their distribution is significantly influenced by the forest management. Soil pH and C/N ratio were found to be the main drivers of the ECM fungal community composition. Additional fungal community similarity analysis revealed the presence of study site and management type specific ECM genera. This study extends our
Chelsea M. Curtis; W. Michael Aust; John R. Seiler; Brian D. Strahm
2015-01-01
Forest mitigation sites may have poor survival and growth of planted trees due to poor drainage, compacted soils, and lack of microtopography. The effects of five replications of five forestry mechanical site preparation techniques (Flat, Rip, Bed, Pit, and Mound), four regeneration sources (Direct seed, Bare root, Tubelings, and Gallon), and three planting aids (None...
Directory of Open Access Journals (Sweden)
Christine Padoch
2008-12-01
Full Text Available In much of the Amazon Basin, approximately 70% of the population lives in urban areas and urbanward migration continues. Based on data collected over more than a decade in two long-settled regions of Amazonia, we find that rural-urban migration in the region is an extended and complex process. Like recent rural-urban migrants worldwide, Amazonian migrants, although they may be counted as urban residents, are often not absent from rural areas but remain members of multi-sited households and continue to participate in rural-urban networks and in rural land-use decisions. Our research indicates that, despite their general poverty, these migrants have affected urban markets for both food and construction materials. We present two cases: that of açaí palm fruit in the estuary of the Amazon and of cheap construction timbers in the Peruvian Amazon. We find that many new Amazonian rural-urban migrants have maintained some important rural patterns of both consumption and knowledge. Through their consumer behavior, they are affecting the areal extent of forests; in the two floodplain regions discussed, tree cover is increasing. We also find changes in forest composition, reflecting the persistence of rural consumption patterns in cities resulting in increased demand for and production of açaí and cheap timber species.
CHOI, S.; Shi, Y.; Ni, X.; Simard, M.; Myneni, R. B.
2013-12-01
Sparseness in in-situ observations has precluded the spatially explicit and accurate mapping of forest biomass. The need for large-scale maps has raised various approaches implementing conjugations between forest biomass and geospatial predictors such as climate, forest type, soil property, and topography. Despite the improved modeling techniques (e.g., machine learning and spatial statistics), a common limitation is that biophysical mechanisms governing tree growth are neglected in these black-box type models. The absence of a priori knowledge may lead to false interpretation of modeled results or unexplainable shifts in outputs due to the inconsistent training samples or study sites. Here, we present a gray-box approach combining known biophysical processes and geospatial predictors through parametric optimizations (inversion of reference measures). Total aboveground biomass in forest stands is estimated by incorporating the Forest Inventory and Analysis (FIA) and Parameter-elevation Regressions on Independent Slopes Model (PRISM). Two main premises of this research are: (a) The Allometric Scaling and Resource Limitations (ASRL) theory can provide a relationship between tree geometry and local resource availability constrained by environmental conditions; and (b) The zeroth order theory (size-frequency distribution) can expand individual tree allometry into total aboveground biomass at the forest stand level. In addition to the FIA estimates, two reference maps from the National Biomass and Carbon Dataset (NBCD) and U.S. Forest Service (USFS) were produced to evaluate the model. This research focuses on a site-scale test of the biomass model to explore the robustness of predictors, and to potentially improve models using additional geospatial predictors such as climatic variables, vegetation indices, soil properties, and lidar-/radar-derived altimetry products (or existing forest canopy height maps). As results, the optimized ASRL estimates satisfactorily
Nizami, Syed Moazzam; Yiping, Zhang; Zheng, Zheng; Zhiyun, Lu; Guoping, Yang; Liqing, Sha
2017-03-01
Very old natural forests comprising the species of Fagaceae (Lithocarpus xylocarpus, Castanopsis wattii, Lithocarpus hancei) have been prevailing since years in the Ailaoshan Mountain Nature Reserve (AMNR) SW China. Within these forest trees, density is quite variable. We studied the forest structure, stand dynamics and carbon density at two different sites to know the main factors which drives carbon sequestration process in old forests by considering the following questions: How much is the carbon density in these forest trees of different DBH (diameter at breast height)? How much carbon potential possessed by dominant species of these forests? How vegetation carbon is distributed in these forests? Which species shows high carbon sequestration? What are the physiochemical properties of soil in these forests? Five-year (2005-2010) tree growth data from permanently established plots in the AMNR was analysed for species composition, density, stem diameter (DBH), height and carbon (C) density both in aboveground and belowground vegetation biomass. Our study indicated that among two comparative sites, overall 54 species of 16 different families were present. The stem density, height, C density and soil properties varied significantly with time among the sites showing uneven distribution across the forests. Among the dominant species, L. xylocarpus represents 30% of the total carbon on site 1 while C. wattii represents 50% of the total carbon on site 2. The average C density ranged from 176.35 to 243.97 t C ha -1 . The study emphasized that there is generous degree to expand the carbon stocking in this AMNR through scientific management gearing towards conservation of old trees and planting of potentially high carbon sequestering species on good site quality areas.
Observation and Analysis of Particle Nucleation at a Forest Site in Southeastern US
Pillai, Priya; Khlystov, Andrey; Walker, John; Aneja, Viney
2013-01-01
This study examines the characteristics of new particle formation at a forest site in southeastern US. Particle size distributions above a Loblolly pine plantation were measured between November 2005 and September 2007 and analyzed by event type and frequency, as well as in relation to meteorological and atmospheric chemical conditions. Nucleation events occurred on 69% of classifiable observation days. Nucleation frequency was highest in spring. The highest daily nucleation (class A and B ev...
Sources of long-lived atmospheric VOCs at the rural boreal forest site, SMEAR II
Patokoski, J.; Ruuskanen, T. M.; Kajos, M. K.; Taipale, R.; Rantala, P.; Aalto, J.; Ryyppö, T.; Nieminen, T.; Hakola, H.; Rinne, J.
2015-12-01
In this study a long-term volatile organic compound (VOCs) concentration data set, measured at the SMEAR II (Station for Measuring Ecosystem-Atmosphere Relations) boreal forest site in Hyytiälä, Finland during the years 2006-2011, was analyzed in order to identify source areas and profiles of the observed VOCs. VOC mixing ratios were measured using proton transfer reaction mass spectrometry. Four-day HYSPLIT 4 (Hybrid Single Particle Lagrangian Integrated Trajectory) backward trajectories and the Unmix 6.0 receptor model were used for source area and source composition analysis. Two major forest fire events in Russia took place during the measurement period. The effect of these fires was clearly visible in the trajectory analysis, lending confidence to the method employed with this data set. Elevated volume mixing ratios (VMRs) of non-biogenic VOCs related to forest fires, e.g. acetonitrile and aromatic VOCs, were observed. Ten major source areas for long-lived VOCs (methanol, acetonitrile, acetaldehyde, acetone, benzene, and toluene) observed at the SMEAR II site were identified. The main source areas for all the targeted VOCs were western Russia, northern Poland, Kaliningrad, and the Baltic countries. Industrial areas in northern continental Europe were also found to be source areas for certain VOCs. Both trajectory and receptor analysis showed that air masses from northern Fennoscandia were less polluted with respect to both the VOCs studied and other trace gases (CO, SO2 and NOx), compared to areas of eastern and western continental Europe, western Russia, and southern Fennoscandia.
CTFS-ForestGEO: a worldwide network monitoring forests in an era of global change
Kristina J. Anderson-Teixeira; Stuart J. Davies; Amy C. Bennett; Erika B. Gonzalez-Akre; Helene C. Muller-Landau; S. Joseph Wright; Kamariah Abu Salim; Angélica M. Almeyda Zambrano; Alfonso Alonso; Jennifer L. Baltzer; Yves Basset; Norman A. Bourg; Eben N. Broadbent; Warren Y. Brockelman; Sarayudh Bunyavejchewin; David F. R. P. Burslem; Nathalie Butt; Min Cao; Dairon Cardenas; George B. Chuyong; Keith Clay; Susan Cordell; Handanakere S. Dattaraja; Xiaobao Deng; Matteo Detto; Xiaojun Du; Alvaro Duque; David L. Erikson; Corneille E.N. Ewango; Gunter A. Fischer; Christine Fletcher; Robin B. Foster; Christian P. Giardina; Gregory S. Gilbert; Nimal Gunatilleke; Savitri Gunatilleke; Zhanqing Hao; William W. Hargrove; Terese B. Hart; Billy C.H. Hau; Fangliang He; Forrest M. Hoffman; Robert W. Howe; Stephen P. Hubbell; Faith M. Inman-Narahari; Patrick A. Jansen; Mingxi Jiang; Daniel J. Johnson; Mamoru Kanzaki; Abdul Rahman Kassim; David Kenfack; Staline Kibet; Margaret F. Kinnaird; Lisa Korte; Kamil Kral; Jitendra Kumar; Andrew J. Larson; Yide Li; Xiankun Li; Shirong Liu; Shawn K.Y. Lum; James A. Lutz; Keping Ma; Damian M. Maddalena; Jean-Remy Makana; Yadvinder Malhi; Toby Marthews; Rafizah Mat Serudin; Sean M. McMahon; William J. McShea; Hervé R. Memiaghe; Xiangcheng Mi; Takashi Mizuno; Michael Morecroft; Jonathan A. Myers; Vojtech Novotny; Alexandre A. de Oliveira; Perry S. Ong; David A. Orwig; Rebecca Ostertag; Jan den Ouden; Geoffrey G. Parker; Richard P. Phillips; Lawren Sack; Moses N. Sainge; Weiguo Sang; Kriangsak Sri-ngernyuang; Raman Sukumar; I-Fang Sun; Witchaphart Sungpalee; Hebbalalu Sathyanarayana Suresh; Sylvester Tan; Sean C. Thomas; Duncan W. Thomas; Jill Thompson; Benjamin L. Turner; Maria Uriarte; Renato Valencia; Marta I. Vallejo; Alberto Vicentini; Tomáš Vrška; Xihua Wang; Xugao Wang; George Weiblen; Amy Wolf; Han Xu; Sandra Yap; Jess Zimmerman
2014-01-01
Global change is impacting forests worldwide, threatening biodiversity and ecosystem services including climate regulation. Understanding how forests respond is critical to forest conservation and climate protection. This review describes an international network of 59 long-term forest dynamics research sites (CTFS-ForestGEO) useful for characterizing forest responses...
Directory of Open Access Journals (Sweden)
G. Blöschl
2012-07-01
Full Text Available Numerous global and regional validation studies have examined MODIS snow mapping accuracy by using measurements at climate stations, which are mainly at open sites. MODIS accuracy in alpine and forested regions is, however, still not well understood. The main objective of this study is to evaluate MODIS (MOD10A1 and MYD10A1 snow cover products in a small experimental catchment by using extensive snow course measurements at open and forest sites. The MODIS accuracy is tested in the Jalovecky creek catchment (northern Slovakia in the period 2000–2011. The results show that the combined Terra and Aqua images enable snow mapping at an overall accuracy of 91.5%. The accuracies at forested, open and mixed land uses at the Červenec sites are 92.7%, 98.3% and 81.8%, respectively. The use of a 2-day temporal filter enables a significant reduction in the number of days with cloud coverage and an increase in overall snow mapping accuracy. In total, the 2-day temporal filter decreases the number of cloudy days from 61% to 26% and increases the snow mapping accuracy to 94%. The results indicate three possible factors leading to misclassification of snow as land: patchy snow cover, limited MODIS geolocation accuracy and mapping algorithm errors. Out of a total of 27 misclassification cases, patchy snow cover, geolocation issues and mapping errors occur in 12, 12 and 3 cases, respectively.
Roth, T. R.; Nolin, A. W.
2016-12-01
Temperate forests modify snow evolution patterns both spatially and temporally relative to open areas. Dense, warm forests both impede snow accumulation through increased canopy snow interception and increase sub-canopy longwave energy inputs onto the snow surface. These process modifications vary in magnitude and duration depending on climatic, topographic and forest characteristics. Here we present results from a four year study of paired forested and open sites at three elevations, Low - 1150 m, Mid - 1325 m and High - 1465 m. Snowpacks are deeper and last up to 3-4 weeks longer at the Low and Mid elevation Open sites relative to the adjacent Forest sites. Conversely, at the High Forest site, snow is retained 2-4 weeks longer than the Open site. This change in snowpack depth and persistence is attributed to deposition patterns at higher elevations and forest structure differences that alter the canopy interception efficiency and the sub-canopy energy balance. Canopy interception efficiency (CIE) in the Low and Mid Forest sites, over the duration of the study were 79% and 76% of the total event snowfall, whereas CIE was 31% at the High Forest site. Longwave radiation in forested environments is the primary energy component across each elevation band due to the warm winter environment and forest presence, accounting for 82%, 88%, and 59% of the energy balance at the Low, Mid, and High Forest sites, respectively. High wind speeds in the High elevation Open site significantly increases the turbulent energy and creates preferential snowfall deposition in the nearby Forest site. These results show the importance of understanding the effects of forest cover on sub-canopy snowpack evolution and highlight the need for improved forest cover model representation to accurately predict water resources in maritime forests.
Peter J. Daugherty; Jeremy S. Fried
2007-01-01
Landscape-scale fuel treatments for forest fire hazard reduction potentially produce large quantities of material suitable for biomass energy production. The analytic framework FIA BioSum addresses this situation by developing detailed data on forest conditions and production under alternative fuel treatment prescriptions, and computes haul costs to alternative sites...
Bioleaching of copper from old flotation tailings samples (Copper Mine Bor, Serbia
Directory of Open Access Journals (Sweden)
Stanković Srđan
2015-01-01
Full Text Available Bioleaching of samples taken from depths of 10, 15, and 20 meters from old flotation tailings of the Copper Mine Bor was conducted in shaken flasks using extremely acidic water of Lake Robuleas lixiviant. Yield of copper after five weeks of the bioleaching experiment was 68.34±1.21% for 15 m sample, 72.57±0.57% for 20 m sample and 97.78±5.50% for 10 m sample. The obtained results were compared to the results of acid leaching of the same samples and it was concluded that bioleaching was generally more efficient for the treatment of samples taken from depths of 10 m and 20 m. The content of pyrite in the 20 m sample, which contained the highest amount of this mineral, was reduced after bioleaching. Benefits of this approach are: recovery of substantial amounts of copper, reducing the environmental impact of flotation tailings and the application of abundant and free water from the Robule acidic lake as lixiviant. Results of the experiment showed that bioleaching can be more efficient than acid leaching for copper extraction from flotation tailings with higher sulfide contents. [Projekat Ministarstva nauke Republike Srbije, br. 176016 i br. 173048
Higher stability in forest-atmosphere exchange observed in a structurally diverse forest.
Tamrakar, R.; Rayment, M.; Moyano, F.; Herbst, M.; Mund, M.; Knohl, A.
2016-12-01
We tested the hypothesis that structurally diverse forests have greater stability on exchange processes with the atmosphere compared to forests with less diverse structure. In a case study, we assessed how net ecosystem exchange (NEE) and normalized maximum assimilation (Amax) varied over time in two forests in Germany based on 11 years of continuous eddy flux measurements. The two sites differ in structure as well as in species composition: one (Hainich) is an unmanaged, uneven-aged and heterogeneous mixed beech forest (65% beech), the other (Leinefelde) is a managed, even-aged and homogeneous pure beech stand. The two selected forests are of similar mean ages (about 130 years old) and exposed to similar air temperatures and vapour pressure deficits. Even though Hainich (the unmanaged forest) received higher rainfall (720 ± 134 mm vs 599±166 mm), the soil water availability showed no significant difference between both sites. Based on detailed biomass inventory, trees in Hainich are well distributed in all diameter at breast height (dbh) classes (10 to 90cm dbh) whereas in Leinefelde (the managed forest) trees are mostly confined to dbh classes of 40 to 55 cm. Our results showed a strong difference in inter-annual variability of NEE, which was lower in the unmanaged than in the managed site (coefficient of variation (CV) of 0.13 and 0.27, respectively). The lowest NEE was observed in both sites in 2004, a mast year and a year after the strong summer drought of 2003. The variation in the inter-annual normalized maximum assimilation (Amax) was lower in Hainich (standard deviation of 2.5 compared to 3.9 µmol m-2 s-1). Also, the seasonal course of Amax differed between the two forests which could explain why the mixed forest was more affected by the late summer drought of 2003, despite showing a more conservative carbon budget than the pure stand in the long term. The interannual anomaly in Amax was correlated with fruit production, the latter being larger in
Ecological modeling for forest management in the Shawnee National Forest
Richard G. Thurau; J.F. Fralish; S. Hupe; B. Fitch; A.D. Carver
2008-01-01
Land managers of the Shawnee National Forest in southern Illinois are challenged to meet the needs of a diverse populace of stakeholders. By classifying National Forest holdings into management units, U.S. Forest Service personnel can spatially allocate resources and services to meet local management objectives. Ecological Classification Systems predict ecological site...
Kim Ludovici; Robert Eaton; Stanley Zarnoch
2018-01-01
Removal of forest floor litter by pine needle raking and prescribed burning is a common practice in longleaf pine (Pinus palustris Mill.) stands on Coastal Plain sites in the Southeastern United States. Repeated removal of litter by raking and the loss of surface organic matter from controlled burns can affect the...
A Study of the Optimal Model of the Flotation Kinetics of Copper Slag from Copper Mine BOR
Stanojlović, Rodoljub D.; Sokolović, Jovica M.
2014-10-01
In this study the effect of mixtures of copper slag and flotation tailings from copper mine Bor, Serbia on the flotation results of copper recovery and flotation kinetics parameters in a batch flotation cell has been investigated. By simultaneous adding old flotation tailings in the ball mill at the rate of 9%, it is possible to increase copper recovery for about 20%. These results are compared with obtained copper recovery of pure copper slag. The results of batch flotation test were fitted by MatLab software for modeling the first-order flotation kinetics in order to determine kinetics parameters and define an optimal model of the flotation kinetics. Six kinetic models are tested on the batch flotation copper recovery against flotation time. All models showed good correlation, however the modified Kelsall model provided the best fit.
Forest report 2013; Waldzustandsbericht 2013
Energy Technology Data Exchange (ETDEWEB)
NONE
2013-07-01
This forest report of Lower Saxony (Germany) contains the following topics: weather and climate, forest protection, crown defoliation, infiltrated substances, environmental monitoring, insects and fungi, forest soil survey and forest site mapping, and nutritional status of beech on loess.
International Nuclear Information System (INIS)
Littek, T.
1993-06-01
It was the goal of this study to investigate the influence of different upper soil conditions on the germination and establishment, as well as the growth, of young plants of various tree species. For this purpose, four test plots in the region of the Black Forest were laid out, in which, by various means of site preparation and fertilization, the upper soils were changed. Natural seeding of common spruce, European silver-fir, beech, sycamore maple, European mountainash, and grey alder was simulated by means of controlled sowing. For comparison, a greenhouse experiment was carried out, examining the germination and development of the same tree species in various soil substrata, using different fertilizers, and under the influence of artificial acid rain. The most important results - with a high level of variation depending on the tree species examined - can be summarized as follows: Based on the results of field and greenhouse experiments, as well as on the investigations of other authors, it can be concluded that natural regeneration of forest stands is considerably impeded under conditions of increasing soil acidity and by high acid depositions. This is seen directly as the result of unfavorable chemical conditions in the upper soil, as well as indirectly due to deteriorating competitiveness against other vegetation. Site preparation and lime or dolomite fertilization can be important measures in the practice of forestry, to encourage natural regeneration in highly acidic sites with an unfavourable humus layer and a high presence of competing vegetation. (orig./UWA). 2 figs., 85 tabs., 269 refs [de
Forest production dynamics along a wood density spectrum in eastern US forests
C.W. Woodall; M.B. Russell; B.F. Walters; A.W. D' Amato; K. Zhu; S.S. Saatchi
2015-01-01
Emerging plant economics spectrum theories were confirmed across temperate forest systems of the eastern US where the use of a forest stand's mean wood density elucidated forest volume and biomass production dynamics integrating aspects of climate, tree mortality/growth, and rates of site occupancy.
Atmospheric particulate mercury at the urban and forest sites in central Poland.
Siudek, Patrycja; Frankowski, Marcin; Siepak, Jerzy
2016-02-01
Particulate mercury concentrations were investigated during intensive field campaigns at the urban and forest sites in central Poland, between April 2013 and October 2014. For the first time, quantitative determination of total particulate mercury in coarse (PHg2.2) and fine (PHg0.7) aerosol samples was conducted in Poznań and Jeziory. The concentrations in urban fine and coarse aerosol fractions amounted to mercury concentrations. A strong impact of meteorological conditions (wind velocity, air mass direction, air temperature, and precipitation amount) on particulate mercury concentrations was also observed. In particular, higher variation and concentration range of PHg0.7 and PHg2.2 was reported for wintertime measurements. An increase in atmospheric particulate mercury during the cold season in the study region indicated that coal combustion, i.e., residential and industrial heating, is the main contribution factor for the selected particle size modes. Coarse particulate Hg at the urban site during summer was mainly attributed to anthropogenic sources, with significant contribution from resuspension processes and long-range transport. The highest values of PHg0.7 and PHg2.2 were found during westerly and southerly wind events, reflecting local emission from highly polluted areas. The period from late fall to spring showed that advection from the southern part of Poland was the main factor responsible for elevated Hg concentrations in fine and coarse particles in the investigated region. Moreover, September 2013 could be given as an example of the influence of additional urban activities which occurred approx. 10 m from the sampling site-construction works connected with replacement of the road surface, asphalting, etc. The concentrations of particulate Hg (>600.0 pg m(-3)) were much higher than during the following months when any similar situation did not occur. Our investigations confirmed that Hg in urban aerosol samples was predominantly related to local
Morante-Filho, José Carlos; Arroyo-Rodríguez, Víctor; Faria, Deborah
2016-01-01
Biodiversity maintenance in human-altered landscapes (HALs) depends on the species turnover among localities, but the patterns and determinants of β-diversity in HALs are poorly known. In fact, declines, increases and neutral shifts in β-diversity have all been documented, depending on the landscape, ecological group and spatial scale of analysis. We shed some light on this controversy by assessing the patterns and predictors of bird β-diversity across multiple spatial scales considering forest specialist and habitat generalist bird assemblages. We surveyed birds from 144 point counts in 36 different forest sites across two landscapes with different amount of forest cover in the Brazilian Atlantic forest. We analysed β-diversity among points, among sites and between landscapes with multiplicative diversity partitioning of Hill numbers. We tested whether β-diversity among points was related to within-site variations in vegetation structure, and whether β-diversity among sites was related to site location and/or to differences among sites in vegetation structure and landscape composition (i.e. per cent forest and pasture cover surrounding each site). β-diversity between landscapes was lower than among sites and among points in both bird assemblages. In forest specialist birds, the landscape with less forest cover showed the highest β-diversity among sites (bird differentiation among sites), but generalist birds showed the opposite pattern. At the local scale, however, the less forested landscape showed the lowest β-diversity among points (bird homogenization within sites), independently of the bird assemblage. β-diversity among points was weakly related to vegetation structure, but higher β-diversity values were recorded among sites that were more isolated from each other, and among sites with higher differences in landscape composition, particularly in the less forested landscape. Our findings indicate that patterns of bird β-diversity vary across scales
Directory of Open Access Journals (Sweden)
D. Obrist
2009-05-01
Full Text Available This study presents data on mercury (Hg concentrations, stochiometric relations to carbon (C and nitrogen (N, and Hg pool sizes in four Sierra Nevada forest sites of similar exposure and precipitation regimes, and hence similar atmospheric deposition, to evaluate how ecosystem parameters control Hg retention in ecosystems. In all four sites, the largest amounts of Hg reside in soils which account for 94–98% of ecosystem pools. Hg concentrations and Hg/C ratios increase in the following order: Green Needles/Leaves
Mineral soil layers show strong positive correlations of Hg to C across all sites and soil horizons (r2=0.83, but Hg concentrations are even more closely related to N with a similar slope to that observed in litter (r2=0.92. Soil N levels alone explain over 90% of Hg pool sizes across the four Sierra Nevada forest sites. This suggests that soil organic N and C groups provide sorption sites for Hg to retain atmospheric deposition. However, the patterns could be due to indirect relationships where high soil N and C levels reflect high ecosystem productivity which leads to corresponding high atmospheric Hg deposition inputs via leaf litterfall and plant senescence. Our results also show that two of the sites previously affected by
On the re-emergence of motion and innovations in the Gábor Bódy's intermedia experiments
Directory of Open Access Journals (Sweden)
Kamil Lipiński
2015-06-01
Full Text Available The article explores the main cases of Hungarian neo-avant-garde cinema in terms of re-emergence of visual material and the introduction of electronic innovations resulting in the transformation of reality. Among the research conducted in Béla Balázs Studio based on reframing the perception limits in the 1960s and the 1970s, the most innovative were Gábor Bódy's intermedia experiments. Along with launching K/3 subgroup within BBS, Bódy directed its objectives to reduce the material derived from reality and to visually intervene into media image electronically transforming the landscape of his films. Innovatively adapting the Sándor Weöres's verse, the film Narcissus and Psyche (1983 aimed at using hyper-real aesthetics to reframe the film reality. Starting from 1980, Bódy founded an international magazine Infermental to disseminate the advent of the video and electronics by creating a community drew on sharing news about emerging media image.
Mechanical properties and TEM examination of RAFM steels irradiated up to 70 dpa in BOR-60
Energy Technology Data Exchange (ETDEWEB)
Gaganidze, E., E-mail: Ermile.Gaganidze@kit.edu [Karlsruher Institut fuer Technologie, Institut fuer Angewandte Materialien, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Petersen, C.; Materna-Morris, E.; Dethloff, C.; Weiss, O.J.; Aktaa, J. [Karlsruher Institut fuer Technologie, Institut fuer Angewandte Materialien, Hermann-von-Helmholtz-Platz 1, 76344 Eggenstein-Leopoldshafen (Germany); Povstyanko, A.; Fedoseev, A.; Makarov, O.; Prokhorov, V. [Joint Stock Company ' State Scientific Centre Research Institute of Atomic Reactors' , 433510 Dimitrovgrad-10, Ulyanovsk Region (Russian Federation)
2011-10-01
Mechanical properties of Reduced Activation Ferritic/Martensitic (RAFM) steels were studied after irradiation in BOR-60 reactor to a neutron displacement damage of 70 dpa at 330-340 deg. C. Yield stress and Ductile-to-Brittle-Transition-Temperature of EUROFER97 indicate saturation of hardening and embrittlement. The phenomenological models for description of microstructure evolution and resulting irradiation hardening and embrittlement are discussed. The evolution of yield stress with dose is qualitatively understood within a Whapham and Makin model. Dislocation loops examined in TEM are considered a main source for low-temperature irradiation hardening. The analysis of the fatigue data in terms of the inelastic strain reveals comparable fatigue behaviour both for unirradiated and irradiated conditions, which can be described by a common Manson-Coffin relation. The study of helium effects in B-doped model steels indicated progressive material embrittlement with helium content. Post-irradiation annealing of RAFM steels yielded substantial recovery of mechanical properties.
Masalaite, A.; Holzinger, R.; Remeikis, V.; Röckmann, T.; Dusek, U.
2017-01-01
The chemical and isotopic composition of organic aerosol (OA) samples collected on PM1 filters was determined as a function of desorption temperature to investigate the main sources of organic carbon and the effects of photochemical processing on atmospheric aerosol. The filter samples were collected at an urban (54°38‧ N, 25°18‧ E), coastal (55°55‧ N, 21°00‧ E) and forest (55°27‧ N, 26°00' E) site in Lithuania in March 2013. They can be interpreted as winter-time samples because the monthly averaged temperature was -4 °C. The detailed chemical composition of organic compounds was analysed with a thermal desorption PTR-MS. The mass concentration of organic aerosol at the forest site was roughly by a factor of 30 lower than at the urban and coastal site. This fact could be an indication that in this cold month the biogenic secondary organic aerosol (SOA) formation was very low. Moreover, the organic aerosol collected at the forest site was more refractory and contained a larger fraction of heavy molecules with m/z > 200. The isotopic composition of the aerosol was used to differentiate the two main sources of organic aerosol in winter, i.e. biomass burning (BB) and fossil fuel (FF) combustion. Organic aerosol from biomass burning is enriched in 13C compared to OA from fossil fuel emissions. δ13COC values of the OA samples showed a positive correlation with the mass fraction of several individual organic compounds. Most of these organic compounds contained nitrogen indicating that organic nitrogen compounds formed during the combustion of biomass may be indicative of BB. Other compounds that showed negative correlations with δ13COC were possibly indicative of FF. These compounds included heavy hydrocarbons and were on the average less oxidized than the bulk organic carbon. The correlation of δ13COC and the O/C ratio was positive at low but negative at high desorption temperatures at the forest site. We propose that this might be due to
International Nuclear Information System (INIS)
Hasmadi, I.M.; Pakhriazad, H.Z.; Norlida, K.
2011-01-01
The Sungai Pulai Mangrove Forest Reserve (SPMFR) is the largest reverin mangrove system in Johore. In 2003 about 9,126 ha of the Sungai Pulai mangrove was designated as a RAMSAR site. RAMSAR sites are wetland areas that are deemed to have international importance and are included in the List of Wetlands of International Importance. The SPMFR plays a significant socio-economic role to the adjacent 38 villages. Satellite remote sensing is a useful source of information where it provides timely and complete coverage for vegetation mapping especially in mangroves where the accessibility is difficult. This study was carried out to identify and map land cover types using SPOT-4 imagery at the Sungai Pulai-RAMSAR site and its surrounding areas. Through unsupervised classification technique a total of seven classes of land cover type were mapped, where about 90 % mapping accuracy was gained from the accuracy assessment. Later, vegetation densities were classified into five levels namely very high, high, medium, low and very low based on crown density scale using vegetation indices model such as NDVI, AVI and OSAVI. Results from NDVI and OSAVI model were almost similar but AVI model detected more on medium vegetation which did not show the real ground condition. The study concludes that SPOT-4 imagery was able to discriminate mangrove area clearly from other land covers type. Vegetation indices model can be used as a tool for mapping vegetation density level in the SPMFR and its surrounding area. Therefore VIs models from remote sensing are useful to monitor and manage the mangrove forest for sustainable management and preserve the SPMFR as a RAMSAR site in Peninsular Malaysia. (author)
Directory of Open Access Journals (Sweden)
Do Thi Ngoc Le
2016-01-01
Full Text Available The effects of disturbance regimes on the spatial patterns of the five most abundant species were investigated in three sites in a tropical forest at Xuan Nha Nature Reserve, Vietnam. Three permanent one-ha plots were established in undisturbed forest (UDF, lightly disturbed forest (LDF, and highly disturbed forest (HDF. All trees ≥5 cm DBH were measured in twenty-five 20 m × 20 m subplots. A total of 57 tree species belonging to 26 families were identified in the three forest types. The UDF had the highest basal area (30 m2 ha−1, followed by the LDF (17 m2 ha−1 and the HDF (13.0 m2 ha−1. The UDF also had the highest tree density (751 individuals ha−1 while the HDF held the lowest (478 individuals ha−1. Across all species, there were 417 “juveniles,” 267 “subadults,” and 67 “adults” in the UDF, while 274 “juveniles,” 230 “subadults,” and 36 “adults” were recorded in the LDF. 238 “juveniles,” 227 “subadults,” and 13 “adults” were obtained in the HDF. The univariate and bivariate data with pair- and mark-correlation functions of intra- and interspecific interactions of the five most abundant species changed in the three forest types. Most species indicated clumping or regular distributions at small scale, but a high ratio of negative interspecific small-scale associations was recorded in both the LDF and HDF sites. These were, however, rare in the UDF.
Siting wind farms in and around forests
Energy Technology Data Exchange (ETDEWEB)
Douglas, N. [Natural Power Consultants, Vancouver, BC (Canada)
2010-07-01
This PowerPoint presentation discussed methods of assessing the impact of trees on wind resources. Turbulence is generated and also absorbed by trees. Disturbances generated at tree level are then transported upwards and down-wind by the wind. The turbulence induced by trees can be felt kilometers downwind of forests at wind turbine hub heights. Wind speeds can be less than predicted, and significant over-estimations can occur with modelled results. The effects of high shear and high turbulence can also have an impact on power curve performance and lead to higher levels of mechanical stress. A SCADA analysis was used to demonstrate the impact of forests on power curves. Wind power predictions near forests can be optimized by using a full year of data capture at hub height, full rotor measurements, and a consideration of seasonal variations. Accurate tree maps are needed to determine the effects of trees on wind shear. Various forestry scenarios were modelled to demonstrate the effects of forestry management over time. tabs., figs.
Energy Technology Data Exchange (ETDEWEB)
Law, Beverly E. [Oregon State Univ., Corvallis, OR (United States)
2016-12-03
Investigate the effects of disturbance and climate variables on processes controlling carbon and water processes at AmeriFlux cluster sites in semi-arid and mesic forests in Oregon. The observations were made at three existing and productive AmeriFlux research sites that represent climate and disturbance gradients as a natural experiment of the influence of climatic and hydrologic variability on carbon sequestration and resulting atmospheric CO2 feedback that includes anomalies during the warm/ dry phase of the Pacific Decadal Oscillation.
Energy Technology Data Exchange (ETDEWEB)
Kandt, Alicen J. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Kiatreungwattana, Kosol [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2018-01-26
This report summarizes the results from an energy efficiency, water efficiency, and renewable energy site assessment of the Dolores Ranger District in the San Juan National Forest in Colorado. A team led by the U.S. Department of Energy's National Renewable Energy Laboratory (NREL) conducted the assessment with United States Forest Service (USFS) personnel on August 16-17, 2016, as part of ongoing efforts by USFS to reduce energy and water use and implement renewable energy technologies. The assessment is approximately an American Society of Heating, Refrigerating, and Air-Conditioning Engineers Level 2 audit and meets Energy Independence and Security Act requirements.
Ortega, J.; Turnipseed, A.; Guenther, A. B.; Karl, T. G.; Day, D. A.; Gochis, D.; Huffman, J. A.; Prenni, A. J.; Levin, E. J. T.; Kreidenweis, S. M.; DeMott, P. J.; Tobo, Y.; Patton, E. G.; Hodzic, A.; Cui, Y.; Harley, P. C.; Hornbrook, R. H.; Apel, E. C.; Monson, R. K.; Eller, A. S. D.; Greenberg, J. P.; Barth, M.; Campuzano-Jost, P.; Palm, B. B.; Jimenez, J. L.; Aiken, A. C.; Dubey, M. K.; Geron, C.; Offenberg, J.; Ryan, M. G.; Fornwalt, P. J.; Pryor, S. C.; Keutsch, F. N.; DiGangi, J. P.; Chan, A. W. H.; Goldstein, A. H.; Wolfe, G. M.; Kim, S.; Kaser, L.; Schnitzhofer, R.; Hansel, A.; Cantrell, C. A.; Mauldin, R. L., III; Smith, J. N.
2014-01-01
The Bio-hydro-atmosphere interactions of Energy, Aerosols, Carbon, H2O, Organics & Nitrogen (BEACHON) project seeks to understand the feedbacks and inter-relationships between hydrology, biogenic emissions, carbon assimilation, aerosol properties, clouds and associated feedbacks within water-limited ecosystems. The Manitou Experimental Forest Observatory (MEFO) was established in 2008 by the National Center for Atmospheric Research to address many of the BEACHON research objectives, and it now provides a fixed field site with significant infrastructure. MEFO is a mountainous, semi-arid ponderosa pine-dominated forest site that is normally dominated by clean continental air, but is periodically influenced by anthropogenic sources from Colorado Front Range cities. This article summarizes the past and ongoing research activities at the site, and highlights some of the significant findings that have resulted from these measurements. These activities include: - soil property measurements, - hydrological studies, - measurements of high-frequency turbulence parameters, - eddy covariance flux measurements of water, energy, aerosols and carbon dioxide through the canopy, - biogenic and anthropogenic volatile organic compound emissions and their influence on regional atmospheric chemistry, - aerosol number and mass distributions, - chemical speciation of aerosol particles, - characterization of ice and cloud condensation nuclei, - trace gas measurements, and - model simulations using coupled chemistry and meteorology. In addition to various long-term continuous measurement, three focused measurement campaigns with state-of-the-art instrumentation have taken place since the site was established, and two of these are the subjects of this special issue: BEACHON-ROCS (Rocky Mountain Organic Carbon Study, 2010) and BEACHON-RoMBAS (Rocky Mountain Biogenic Aerosol Study, 2011).
Yang, Yong; Chen, Yiren; Huang, Yina; Allen, Todd; Rao, Appajosula
Reactor internal components are subjected to neutron irradiation in light water reactors, and with the aging of nuclear power plants around the world, irradiation-induced material degradations are of concern for reactor internals. Irradiation-induced defects resulting from displacement damage are critical for understanding degradation in structural materials. In the present work, microstructural changes due to irradiation in austenitic stainless steels and cast steels were characterized using transmission electron microscopy. The specimens were irradiated in the BOR-60 reactor, a fast breeder reactor, up to 40 dpa at 320°C. The dose rate was approximately 9.4x10-7 dpa/s. Void swelling and irradiation defects were analyzed for these specimens. A high density of faulted loops dominated the irradiated-altered microstructures. Along with previous TEM results, a dose dependence of the defect structure was established at 320°C.
Usenko, S.; Sheesley, R. J.; Winfield, Z.; Yoon, S.; Erickson, M.; Flynn, J. H., III; Alvarez, S. L.; Wallace, H. W., IV; Griffin, R. J.
2017-12-01
The University of Houston Mobile Air Quality Laboratory (MAQL) was deployed to the University of Michigan Biological Station (UMBS) in July 2016 as part of the PROPHET-AMOS study and then was deployed to Jones Forest located north of Houston, TX from August 12 through September 23, 2016. Both sites are heavily forested, but UMBS is remote with no anthropogenic influence while Jones Forest sees frequent pollution transport from Houston. UMBS experienced periods of high isoprene:monoterpenes and periods of equivalent isoprene:monoterpenes, while Jones Forest had a consistently high isoprene:monoterpenes. This provided for a test bed to look at the interactions within two forested environments as well as the influence of anthropogenic sources. The MAQL was outfitted to measure O3 (2B Technology), NOy and SO2 (Thermo Scientific), NO/NOx (Air Quality Design), CO (Los Gatos), and select biogenic volatile organic carbon (BVOC) with their oxidation products (Ionicon PTR-MS). The instruments sampled from MAQL's 6 m tower at both sites. The UMBS site was below canopy and the Jones Forest site was in an open field surrounded by forest. The trends in isoprene and monoterpenes were explored in relation to time-of-day, temperature, and precipitation for both locations. In addition, the production of methyl vinyl ketone and methacrolein under these different conditions of meteorology, trace gas composition and BVOC composition was explored.
DEFF Research Database (Denmark)
Strandmark, Lisa Bjørnlund; Christensen, Søren
2005-01-01
The relative importance of litter quality and site heterogeneity on population dynamics of decomposer food webs was investigated in a semi-natural mixed deciduous forest in Denmark. Litterbags containing beech or ash leaves were placed in four plots. Plots were located within gaps and under closed...... at the end of the study period. At the first sampling, where bacterial activity prevailed, the relative abundance of the two dominant bacterial-feeders, Rhabditidae (fast growing) and Plectus spp. (slower growing), depended more on site than litter type. At the second sampling where fungal activity became...... in the decomposer food web, site effects were also detected and nematode functional groups responded more to site than to litter quality early on in the decomposition process....
Monitoring of Slovakian forests, Report of Forest Focus and CMS Forest, 2006
International Nuclear Information System (INIS)
Pavlenda, P.; Durkovicova, J.; Istona, J.; Leontovyc, R.; Longauerova, V.; Mindas, J.; Pajtik, J.; Priwitzer, T.; Rasi, R.; Stancikova, A.; Tothova, S.; Stancikova, A.; Tothova, S.; Vodalova, A.
2007-01-01
The report presents current information and results from monitoring of forest issues ecosystems. The results of a survey of defoliation and plant health status, crowns and pest factors on permanent observation areas are summarized. In addition to data from representative network of sites, data from areas of intensive monitoring are analyzed, related to air quality and atmospheric deposition, soil solution, gain, lose surveys, vegetation, phonologic observations and soil moisture regime in 2006 and 2005, respectively. In connection with other activities under the Forest Focus scheme also the basic information about Forest Fire in Slovakia and the demonstration project BioSoil are included.
Yang Yang; Ruth D. Yanai; Charles T. Driscoll; Mario Montesdeoca; Kevin T. Smith
2018-01-01
Mercury (Hg) is deposited from the atmosphere to remote areas such as forests, but the amount of Hg in trees is not well known. To determine the importance of Hg in trees, we analyzed foliage, bark and bole wood of eight tree species at four sites in the northeastern USA (Huntington Forest, NY; Sleepers River, VT; Hubbard Brook, NH; Bear Brook, ME). Foliar...
Daniel A. Yaussy
2000-01-01
Two individual-tree growth simulators are used to predict the growth and mortality on a 30-year-old forest site and an 80-year-old forest site in eastern Kentucky. The empirical growth and yield model (NE-TWIGS) was developed to simulate short-term (
James W. McLaughlin; Ivan J. Fernandez; Stewart M. Goltz; Lindsey E. Rustad; Larry Zibilske
1996-01-01
The biogeochemistry of C, N, and S was studied for six years at the Howland Integrated Forest Study (HIFS) site by measuring those constituents in major above- and below-ground pools and fluxes. Leaching losses of C from the solum were much less than CO2 efflux, with a mean annual leaching rate of 31.2 kg ha-1 yr
Forest structure and carbon dynamics in Amazonian tropical rain forests.
Vieira, Simone; de Camargo, Plinio Barbosa; Selhorst, Diogo; da Silva, Roseana; Hutyra, Lucy; Chambers, Jeffrey Q; Brown, I Foster; Higuchi, Niro; dos Santos, Joaquim; Wofsy, Steven C; Trumbore, Susan E; Martinelli, Luiz Antonio
2004-08-01
Living trees constitute one of the major stocks of carbon in tropical forests. A better understanding of variations in the dynamics and structure of tropical forests is necessary for predicting the potential for these ecosystems to lose or store carbon, and for understanding how they recover from disturbance. Amazonian tropical forests occur over a vast area that encompasses differences in topography, climate, and geologic substrate. We observed large differences in forest structure, biomass, and tree growth rates in permanent plots situated in the eastern (near Santarém, Pará), central (near Manaus, Amazonas) and southwestern (near Rio Branco, Acre) Amazon, which differed in dry season length, as well as other factors. Forests at the two sites experiencing longer dry seasons, near Rio Branco and Santarém, had lower stem frequencies (460 and 466 ha(-1) respectively), less biodiversity (Shannon-Wiener diversity index), and smaller aboveground C stocks (140.6 and 122.1 Mg C ha(-1)) than the Manaus site (626 trees ha(-1), 180.1 Mg C ha(-1)), which had less seasonal variation in rainfall. The forests experiencing longer dry seasons also stored a greater proportion of the total biomass in trees with >50 cm diameter (41-45 vs 30% in Manaus). Rates of annual addition of C to living trees calculated from monthly dendrometer band measurements were 1.9 (Manaus), 2.8 (Santarém), and 2.6 (Rio Branco) Mg C ha(-1) year(-1). At all sites, trees in the 10-30 cm diameter class accounted for the highest proportion of annual growth (38, 55 and 56% in Manaus, Rio Branco and Santarém, respectively). Growth showed marked seasonality, with largest stem diameter increment in the wet season and smallest in the dry season, though this may be confounded by seasonal variation in wood water content. Year-to-year variations in C allocated to stem growth ranged from nearly zero in Rio Branco, to 0.8 Mg C ha(-1) year(-1) in Manaus (40% of annual mean) and 0.9 Mg C ha(-1) year(-1) (33% of
LBA-ECO CD-10 Forest Litter Data for km 67 Tower Site, Tapajos National Forest
National Aeronautics and Space Administration — This data set contains a single text file which reports litter type and mass in the old-growth upland forest at the Para Western (Santarem) - km 67, Primary Forest...
Energy Technology Data Exchange (ETDEWEB)
Hollinger, David Y.; Davidson, Eric A.; Richardson, Andrew D.; Dail, D. B.; Scott, N.
2013-03-25
Summary of research carried out under Interagency Agreement DE-AI02-07ER64355 with the USDA Forest Service at the Howland Forest AmeriFlux site in central Maine. Includes a list of publications resulting in part or whole from this support.
Directory of Open Access Journals (Sweden)
Akasha M. Faist
2015-08-01
Full Text Available Mastication is a forest fuel thinning treatment that involves chipping or shredding small trees and shrubs and depositing the material across the forest floor. By decreasing forest density mastication has been shown to lessen crown fire hazard, yet other impacts have only recently started to be studied. Our study evaluates how mastication treatments alter the density and composition of soil seed banks in three Colorado conifer forest types. The three forest types were (1 lodgepole pine, (2 ponderosa pine and (3 pinyon pine-juniper. Results showed that masticated sites contained higher seed bank densities than untreated sites: a pattern primarily driven by treatment effects in ponderosa pine forests. The seed bank was dominated by forbs regardless of forest type or treatment. This pattern of forb dominance was not observed in the aboveground vegetation cover as it demonstrated more even proportions of the functional groups. Graminoids showed a higher seed density in treated sites than untreated and, similarly, the identified non-native species only occurred in the treated ponderosa pine sites suggesting a potential belowground invasion for this forest type. These results suggest that presence of masticated material might not be creating a physical barrier hindering the transfer of seeds as predicted.
Pappas, C.; Matheny, A. M.; Maillet, J.; Baltzer, J. L.; Stephens, J.; Barr, A.; Black, T. A.; Sonnentag, O.
2016-12-01
Boreal forests cover about one third of the world's forested area with a large part of the boreal zone located in Canada. These high-latitude ecosystems respond rapidly to environmental changes. Plant water stress and the resulting drought-induced mortality has been recently hypothesised as a major driver of forest changes in western Canada. Although boreal forests often exhibit low floristic complexity, local scale abiotic heterogeneities may lead to highly variable plant functional traits and thus to diverging plant responses to environmental changes. However, detailed measurements of plant hydraulic strategies and their inter- and intra-specific variability are still lacking for these ecosystems. Here, we quantify plant water use and hydraulic strategies of black spruce (Picea mariana) and larch (Larix laricina), that are widespread in the boreal zone, at a long-term monitoring site located in central Saskatchewan (53.99° N, 105.12° W; elevation 628.94 m a.s.l.). The site is characterized by a mature black spruce overstorey that dominates the landscape with few larch individuals. The ground cover consists mainly of mosses with some peat moss and lichens over a rich soil organic layer. Tree-level sap flux density, measured with Granier-style thermal dissipation probes (N=39), and concurrently recorded radial stem dynamics, measured with high frequency dendrometers (N=13), are used to quantify plant hydraulic functioning during the 2016 growing season. Hydrometeorological measurements, including soil moisture and micrometeorological data, are used to describe environmental constraints in plant water use. Tree-level dynamics are then integrated to the landscape and compared with ecosystem-level evapotranspiration measurements from an adjacent eddy-covariance flux tower. This experimental design allows us to quantify the main environmental drivers that shape plant hydraulic strategies in this southern boreal zone and to provide new insights into the inter- and
78 FR 53726 - Notice of New Fee Site
2013-08-30
... DEPARTMENT OF AGRICULTURE Forest Service Notice of New Fee Site AGENCY: Monongahela National Forest, USDA Forest Service. ACTION: Notice of New Fee Site. SUMMARY: The Monongahela National Forest is... amenities. Fees for overnight use will be used for the continued operation and maintenance of Island...
Xiaoqian Sun; Zhuoqiong He; John Kabrick
2008-01-01
This paper presents a Bayesian spatial method for analysing the site index data from the Missouri Ozark Forest Ecosystem Project (MOFEP). Based on ecological background and availability, we select three variables, the aspect class, the soil depth and the land type association as covariates for analysis. To allow great flexibility of the smoothness of the random field,...
J. A. Parrotta; O. H. Knowles; J.M. Wunderle Jr.
1997-01-01
Patterns of plant and animal diversity were studied in a 10-year-old native species reforestation area at a bauxite-mined site at porto Trombetas in western Para State, Brazil. Understorey and overstorey floristic composition and structure, understorey light conditions, forest floor development and soil properties were evaluated in a total of 38 78.5-m2
78 FR 14960 - Notice of New Fee Site
2013-03-08
... DEPARTMENT OF AGRICULTURE Forest Service Notice of New Fee Site AGENCY: Kaibab National Forest, USDA Forest Service, Arizona. ACTION: Notice of New Fee Sites. SUMMARY: The Kaibab National Forest is proposing to charge fees for the overnight rental of three historic facilities on the North Kaibab Ranger...
International Nuclear Information System (INIS)
Hayes, K.A.
1982-01-01
Two landfill sites containing low-level radioactive waste material, Site A and Plot M, are located 14 miles southwest of Chicago, Illinois in the Palos Forest Preserve. Site A is the former location of the Argonne National Laboratory. Buried at Site A in 1956 were the dismantled reactor shells, building walls, and cooling towers from three of the world's first nuclear reactors. Plot M was used from 1943 to 1949 for burial of low-level radioactive wastes derived from Site A operations and from the University of Chicago Metallurgical Laboratory. Tritiated water was detected in 1973 in some of the Forest Preserve picnic wells located 500 to 1000 yards north of Plot M. An extensive surveillance program was initiated in 1976 to: (1) study the elevated tritium content of some picnic wells and its observed seasonal fluctuations, (2) establish if other radionuclides buried in Plot M or remaining at Site A have migrated, (3) establish the rate of groundwater movement in the glacial till and underlying dolomite aquifer, (4) determine the tritium content of the till and aquifer, and (5) predict future tritium levels in the well water. Several test wells were installed in the soil and dolomite bedrock to monitor radioactivity in groundwater, measure water levels, and provide other geohydrological information. Tritium has migrated from the Plot M burial trenches into the surrounding drift. The tritium plume, the contaminated zone in the drift in which tritium concentrations exceed 10 nanocuries per liter of water (nCi/L), has migrated at least 165 feet horizontally northward and 130 feet vertically downward to the bedrock surface. Small amounts of other radionuclides - uranium, plutonium, and strontium-90 - have been found in boreholes beneath the concrete cap covering Plot M, but not in the subsoil outside of the Plot. The radionuclide concentrations found to date are too low to result in any measureable radiation exposure to the public
Stand age and climate drive forest carbon balance recovery
Besnard, Simon; Carvalhais, Nuno; Clevers, Jan; Herold, Martin; Jung, Martin; Reichstein, Markus
2016-04-01
Forests play an essential role in the terrestrial carbon (C) cycle, especially in the C exchanges between the terrestrial biosphere and the atmosphere. Ecological disturbances and forest management are drivers of forest dynamics and strongly impact the forest C budget. However, there is a lack of knowledge on the exogenous and endogenous factors driving forest C recovery. Our analysis includes 68 forest sites in different climate zones to determine the relative influence of stand age and climate conditions on the forest carbon balance recovery. In this study, we only included forest regrowth after clear-cut stand replacement (e.g. harvest, fire), and afforestation/reforestation processes. We synthesized net ecosystem production (NEP), gross primary production (GPP), ecosystem respiration (Re), the photosynthetic respiratory ratio (GPP to Re ratio), the ecosystem carbon use efficiency (CUE), that is NEP to GPP ratio, and CUEclimax, where GPP is derived from the climate conditions. We implemented a non-linear regression analysis in order to identify the best model representing the C flux patterns with stand age. Furthermore, we showed that each C flux have a non-linear relationship with stand age, annual precipitation (P) and mean annual temperature (MAT), therefore, we proposed to use non-linear transformations of the covariates for C fluxes'estimates. Non-linear stand age and climate models were, therefore, used to establish multiple linear regressions for C flux predictions and for determining the contribution of stand age and climate in forest carbon recovery. Our findings depicted that a coupled stand age-climate model explained 33% (44%, average site), 62% (76%, average site), 56% (71%, average site), 41% (59%, average site), 50% (65%, average site) and 36% (50%, average site) of the variance of annual NEP, GPP, Re, photosynthetic respiratory ratio, CUE and CUEclimax across sites, respectively. In addition, we showed that gross fluxes (e.g. GPP and Re) are
Razali, Nor Bazilah; Abdul-Rahim, Ahmad Rizal; Md-Nor, Shukor; Mohd-Taib, Farah Shafawati
2018-04-01
Exploitation of forest for commercial agriculture has taken toll on wildlife species worldwide. A forest farm project with the aim of compensating the forest loss has been implemented in Kemasul Forest Reserve, of Pahang State, Malaysia through plantation of fast growing and adaptable plant species. The objective of this study is to determine the impact of this practice on diversity. The study was conducted in a long strip of forest fragment, where two study sites with different landscape matrix types were chosen; oil palm plantation (JR) and Acacia mangium plantations (CM). A total of 75 individuals from 13 species and six families were collected at both sites. The result shows forest with A. mangium plantations matrix types yield higher species diversity. There are 10 shared species that can be found at both study sites including Callosciurus notatus, Hystrix brachyura, Macaca nemestrina, and Tupaia glis. However, some species only existed at selected sites such as Leopoldamys sabanus which can only be found at JR. On the other hand, Callosciurus nigrovittatus, Viverra tangalunga and Paradoxurus hermaphroditus were only recorded at CM. Out of all individuals collected, four of them are protected species as reported by IUCN. Callosciurus nigrovittatus is listed as Near Threatened while the other three species (Maxomys rajah, Maxomys whiteheadi, and Macaca nemestrina) are Vulnerable. If conservation efforts in Kemasul Forest Reserved are neglected, these four species would be exposed to critical threats that might cause them facing extinction in the future. Mann Whitney U test shows no significant difference of distribution and species richness of small to medium-sized mammals in both study sites (U=51.5, p=0.59). This study therefore reveals that although the compensatory forest plantation initiatives yield positive effect on diversity of mammal's species, it does not necessarily provide ample food resources to the wildlife, instead it serves as important buffer
System of ecological monitoring and assessment (EMA) for nuclear power plant site areas
International Nuclear Information System (INIS)
Vorob'ev, E.I.; Oleinikov, N.F.; Reznichenko, V.Yu.
1988-01-01
The goal of the EMA program is to improve the utilization of the natural and labor resources of the city of Sosnovyi Bor due to the opportune discovery of negative changes in the state of the surrounding environment and human health and to predict and assess the possible consequences of implementing technological and economic decisions and their optimization from the point of view of ecology with regard to reactor siting and sizing. The EMA system provides monitoring means and a data bank on the environment and health of workers and the population, a packet of programs for processing and analyzing data, and a set of models to describe and predict the condition of the object/environment/man system. The system monitors contamination sources, monitors and assesses aquatic and terrestrial ecosystems, and accounts for meteorological and biosolar factors which impact on reactor siting
Calidad de abonos orgánicos empleados en la depresión de Quíbor-Venezuela bajo ambientes protegidos
Directory of Open Access Journals (Sweden)
Duilio Torres Rodríguez
2017-01-01
Full Text Available La depresión de Quíbor es una de las zonas agrícolas más importante de Venezuela, donde en los últimos años se han introducido sistemas de producción bajo ambientes protegidos, los cuales están acompañados por el uso de abonos orgánicos, no certi cados. El objetivo de esta investigación fue evaluar la calidad de los abonos orgánicos empleados en sistemas de producción bajo ambientes protegidos en la depresión de Quíbor, Venezuela. Se realizó un diseño experimental completamente al azar y se evaluaron once (11 abonos orgánicos (cuatro sólidos y siete líquidos por triplicados. Los abonos sólidos fueron colectados en la parte superior, inferior y media de las pilas, mientras que los líquidos fueron tomados directamente de los tanques de almacenamiento. Para la caracterización de los abonos se empleó el protocolo TMECC, la materia orgánica se determinó por calcinación a 450°C, el nitrógeno por Kjeldahl y los macronutrientes (potasio y calcio y micronutrientes (cobre, manganeso, hierro y zinc en extracto acuoso 1/20 (v/v del material y cuantificación por absorción atómica. Los resultados obtenidos muestran que el vermicompost y compost de gallinaza presentaron los valores más altos de macronutrientes, mientras, para los abonos líquidos Macro®, fue quien presentó la mayor concentración de nitrógeno, humus1 los valores más altos de Ca y Mg y Micro® y humus2 los mayores contenidos de manganeso, hierro, cobre y zinc fueron encontrados, todos los abonos sólidos presentaron valores bajos de micronutrientes.
Surveying marbled murrelets at inland forested sites: a guide
Peter W.C. Paton; C. John Ralph; Harry R. Carter; S. Kim Nelson
1990-01-01
The marbled murrelet (Brachyramphus marmoratus), a seabird, nests in forested stands from southeast Alaska south to Santa Cruz, California. Because of this species' close association with old-growth forests, researchers and land managers need a method to assess murrelet distribution and use patterns throughout its range. This guide describes a...
Ages of tuff beds at East African early hominid sites and sediments in the Gulf of Aden
Sarna-Wojcicki, A. M.; Meyer, C.E.; Roth, P.H.; Brown, F.H.
1985-01-01
The early hominids of East Africa were dated by determining the ages of tuff beds at the sites. Despite much research using palaeomagnetic and K/Ar-dating techniques, some of those ages are still controversial 1,2. To obtain independent age estimates for these tephra layers, we have examined cores from DSDP Sites 231 and 232 in the Gulf of Aden (Fig. 1a) which consist mainly of calcareous nannofossil ooze, but also contain rare tephra horizons3 dated by interpolation from the established nannofossil stratigraphy (Fig. 1b). Chemical analysis confirms that the identity and sequence of these horizons is the same as that at the East African sites. We conclude that the age of the Tulu Bor Tuff is <3.4 Myr and hence that the Hadar hominid specimens are also ??3.4 Myr old. ?? 1985 Nature Publishing Group.
Environmental consequences of intensive forest harvesting for bioenergy
International Nuclear Information System (INIS)
Dyck, W.J.; Maclaren, J.P.
1994-01-01
This paper examines environmental concerns regarding intensive forest harvesting, and outlines current knowledge. Site productivity and nutrient removal, site productivity and soil disturbance, and site preparation impacts are discussed. Biodiversity, off-site impacts, positive environmental impacts of intensive biomass harvesting, acid rain, climate change, estimating the carbon stored by a forest, site productivity research needs and application of models are discussed. (UK)
Restoration of biogeochemical function in mangrove forests
McKee, K.L.; Faulkner, P.L.
2000-01-01
Forest structure of mangrove restoration sites (6 and 14 years old) at two locations (Henderson Creek [HC] and Windstar [WS]) in southwest Florida differed from that of mixed-basin forests (>50 years old) with which they were once contiguous. However, the younger site (HC) was typical of natural, developing forests, whereas the older site (WS) was less well developed with low structural complexity. More stressful physicochemical conditions resulting from incomplete tidal flushing (elevated salinity) and variable topography (waterlogging) apparently affected plant survival and growth at the WS restoration site. Lower leaf fall and root production rates at the WS restoration site, compared with that at HC were partly attributable to differences in hydroedaphic conditions and structural development. However, leaf and root inputs at each restoration site were not significantly different from that in reference forests within the same physiographic setting. Macrofaunal consumption of tethered leaves also did not differ with site history, but was dramatically higher at HC compared with WS, reflecting local variation in leaf litter processing rates, primarily by snails (Melampus coffeus). Degradation of leaves and roots in mesh bags was slow overall at restoration sites, however, particularly at WS where aerobic decomposition may have been more limited. These findings indicate that local or regional factors such as salinity regime act together with site history to control primary production and turnover rates of organic matter in restoration sites. Species differences in senescent leaf nitrogen content and degradation rates further suggest that restoration sites dominated by Laguncularia racemosa and Rhizophora mangle should exhibit slower recycling of nutrients compared with natural basin forests where Avicennia germinans is more abundant. Structural development and biogeochemical functioning of restored mangrove forests thus depend on a number of factors, but site
2011-04-05
... species that currently are not found on the Forest. Treatment could be anywhere on Forest Service system.... Electronic comments in acceptable plain text (.txt), rich text (.rtf), or Word (.doc) may be submitted to... wildlife habitat, out-compete native plants, impair water quality and watershed health, and adversely...
Ortega, J.; Turnipseed, A.; Guenther, A. B.; Karl, T. G.; Day, D. A.; Gochis, D.; Huffman, J. A.; Prenni, A. J.; Levin, E. J. T.; Kreidenweis, S. M.; DeMott, P. J.; Tobo, Y.; Patton, E. G.; Hodzic, A.; Cui, Y. Y.; Harley, P. C.; Hornbrook, R. S.; Apel, E. C.; Monson, R. K.; Eller, A. S. D.; Greenberg, J. P.; Barth, M. C.; Campuzano-Jost, P.; Palm, B. B.; Jimenez, J. L.; Aiken, A. C.; Dubey, M. K.; Geron, C.; Offenberg, J.; Ryan, M. G.; Fornwalt, P. J.; Pryor, S. C.; Keutsch, F. N.; DiGangi, J. P.; Chan, A. W. H.; Goldstein, A. H.; Wolfe, G. M.; Kim, S.; Kaser, L.; Schnitzhofer, R.; Hansel, A.; Cantrell, C. A.; Mauldin, R. L.; Smith, J. N.
2014-06-01
The Bio-hydro-atmosphere interactions of Energy, Aerosols, Carbon, H2O, Organics & Nitrogen (BEACHON) project seeks to understand the feedbacks and inter-relationships between hydrology, biogenic emissions, carbon assimilation, aerosol properties, clouds and associated feedbacks within water-limited ecosystems. The Manitou Experimental Forest Observatory (MEFO) was established in 2008 by the National Center for Atmospheric Research to address many of the BEACHON research objectives, and it now provides a fixed field site with significant infrastructure. MEFO is a mountainous, semi-arid ponderosa pine-dominated forest site that is normally dominated by clean continental air but is periodically influenced by anthropogenic sources from Colorado Front Range cities. This article summarizes the past and ongoing research activities at the site, and highlights some of the significant findings that have resulted from these measurements. These activities include - soil property measurements; - hydrological studies; - measurements of high-frequency turbulence parameters; - eddy covariance flux measurements of water, energy, aerosols and carbon dioxide through the canopy; - determination of biogenic and anthropogenic volatile organic compound emissions and their influence on regional atmospheric chemistry; - aerosol number and mass distributions; - chemical speciation of aerosol particles; - characterization of ice and cloud condensation nuclei; - trace gas measurements; and - model simulations using coupled chemistry and meteorology. In addition to various long-term continuous measurements, three focused measurement campaigns with state-of-the-art instrumentation have taken place since the site was established, and two of these studies are the subjects of this special issue: BEACHON-ROCS (Rocky Mountain Organic Carbon Study, 2010) and BEACHON-RoMBAS (Rocky Mountain Biogenic Aerosol Study, 2011).
Directory of Open Access Journals (Sweden)
I-Ling Lai
2006-12-01
Full Text Available To better understand the climatic characteristics in a subtropical mountainous cloud forest at the Yuanyang Lake long-term ecological research site, weather data collected from January 1994 to December 2004 were analyzed in the present study. The obvious seasonal changes in climatic factors were observed at this site. The annual mean air temperature was 12.7°C. The lowest temperature was recorded in February (monthly mean 5.9°C, and the highest one was taken in July (monthly mean 18.1°C. Winter featured light rain with a prolonged occurrence of fog, resulting in a large reduction of radiation. In summer, fog occurred once in the early morning and the other time from afternoon to evening. The latter one was associated with the wind direction changes and usually accompanied with short moderate to heavy convective rain. Consequently the photosynthetic photon flux density (PPFD was high in the morning but reduced drastically in the afternoon. Typhoons occurred in the summer had contributed to 37% of the annual rainfall, usually resulting in torrential rain events and sharp increases in the water level of this lake. As a matter of fact, perhumid environment of this site was attributed to abundant rainfall (mean annual precipitation 3396 mm and high frequency (up to 40% of foggy time. Such conditions would reduce the intensity of solar radiation and PPFD. The average annual solar radiation at the site was 2475 MJ m-2, and annual PPFD was 5713 mol m-2. The average degree of reduction of PPFD under foggy condition was up to 88%. Such climatic characteristics are suggested to constrain the growth of plants and play an important role in competition among plant species in this cloud forest. It is considered that the distinct seasonal fluctuation in environmental factors, perhumid and dim light conditions are the most distinguished characteristics of this subtropical mountainous cloud forest ecosystem.
Forest report 2017; Waldzustandsbericht 2017
Energy Technology Data Exchange (ETDEWEB)
NONE
2017-11-01
This forest condition report of Hesse (Germany) includes the following topics: forest condition survey for all tree species, forest in the in the Rhine-Main area, weather and climate, insects and fungi, forestry environment monitoring, site information for the Federal Forest Inventory in Hesse, infiltrated substances, development of soil acidification on intensive monitoring areas in northwestern Germany, and the substrate group basalt/diabase.
Salm,Rodolfo
2004-01-01
This study investigates patterns of forest structure and tree species diversity in an anthropogenic palm grove and undisturbed areas at the seasonally-dry Pinkaití research station, in the Kayapó Indigenous Area. This site, managed by the Conservation International do Brasil, is the most southeastern site floristically surveyed in the Amazon until now. The secondary and a nearby undisturbed forest were sampled in a group of 52 floristic plots of 0.0625-ha (25x25-m) where all trees with DBH > ...
Site-occupany of bats in relation to forested corridors
Chris D Hein; Steven B Castleberry; Karl V. Miller
2009-01-01
Although use of corridors by some wildlife species has been extensively examined, use by bats is poorly understood. From 1 June to 31 August (2004~200S), we used Anabat II detectors to examine bat activity and species occupancy relative to forested corridors on an intensively managed forest landscape in southern South Carolina, USA. We...
Trace Gas Emissions in Temperate Forests and Impact of Forest Conversion
Butterbach-Bahl, K.; Papen, H.
2003-12-01
Temperate forest ecosystems play a significant role as sources and sinks for primarily and secondarily active trace gases such as N2O, NO and CH4. In recent decades the magnitude of the biosphere-atmosphere exchange of these trace gases has been substantially altered due to direct and indirect anthropogenic activities. E.g. measurements at different forest sites across Europe exposed to different loads of atmospheric N-deposition clearly show, that N-oxides emissions are positively correlated to N-deposition, whereas CH4 uptake rates are negatively affected. Furthermore, stand properties such as tree species composition as well as stand age have also been demonstrated to strongly affect the exchange of these trace gases. Results of continuous measurements of N-oxide emissions at the Hoglwald Forest site, Germany, show that e.g. NO-emissions from a spruce site are approx. 6 fold higher (5-7 kg NO-N ha-1 yr-1) than N2O emissions (0.5-1 kg N2O-N ha-1 yr-1), whereas at an adjacent beech site -stocking on a comparable soil- N2O-emissions are 3-5 kg N2O-N ha-1 yr-1 and NO emissions are 2-2.5 kg NO-N ha-1 yr-1. These results are further supported by microbiological process studies, which show that the forest type can alter the magnitude of the key microbial processes mineralization and nitrification by its effect on soil moisture conditions and substrate quality. However, estimates of trace gas exchange between temperate forest soils and the atmosphere remain fragmentary if the effect of direct anthropogenic management activities such as clear cutting and reforestation are neglected. Therefore, in 1999 we started a multi-year experiment at the H”glwald Forest, Bavaria, in which we investigated the effect of the conversion of a spruce forest into a beech forest either by clear cutting or selected cutting on N2O, NO and CH4 emission/ deposition. The results of this study show, that clear cutting strongly enhanced N2O emissions from approx. 0.5 kg N2O-N ha-1 yr-1 to >5 kg
Forest structure and downed woody debris in boreal, temperate, and tropical forest fragments.
Gould, William A; González, Grizelle; Hudak, Andrew T; Hollingsworth, Teresa Nettleton; Hollingsworth, Jamie
2008-12-01
Forest fragmentation affects the heterogeneity of accumulated fuels by increasing the diversity of forest types and by increasing forest edges. This heterogeneity has implications in how we manage fuels, fire, and forests. Understanding the relative importance of fragmentation on woody biomass within a single climatic regime, and along climatic gradients, will improve our ability to manage forest fuels and predict fire behavior. In this study we assessed forest fuel characteristics in stands of differing moisture, i.e., dry and moist forests, structure, i.e., open canopy (typically younger) vs. closed canopy (typically older) stands, and size, i.e., small (10-14 ha), medium (33 to 60 ha), and large (100-240 ha) along a climatic gradient of boreal, temperate, and tropical forests. We measured duff, litter, fine and coarse woody debris, standing dead, and live biomass in a series of plots along a transect from outside the forest edge to the fragment interior. The goal was to determine how forest structure and fuel characteristics varied along this transect and whether this variation differed with temperature, moisture, structure, and fragment size. We found nonlinear relationships of coarse woody debris, fine woody debris, standing dead and live tree biomass with mean annual median temperature. Biomass for these variables was greatest in temperate sites. Forest floor fuels (duff and litter) had a linear relationship with temperature and biomass was greatest in boreal sites. In a five-way multivariate analysis of variance we found that temperature, moisture, and age/structure had significant effects on forest floor fuels, downed woody debris, and live tree biomass. Fragment size had an effect on forest floor fuels and live tree biomass. Distance from forest edge had significant effects for only a few subgroups sampled. With some exceptions edges were not distinguishable from interiors in terms of fuels.
Ram Deo; Matthew Russell; Grant Domke; Hans-Erik Andersen; Warren Cohen; Christopher Woodall
2017-01-01
Large-area assessment of aboveground tree biomass (AGB) to inform regional or national forest monitoring programs can be efficiently carried out by combining remotely sensed data and field sample measurements through a generic statistical model, in contrast to site-specific models. We integrated forest inventory plot data with spatial predictors from Landsat time-...
Impacts of forest age on water use in Mountain ash forests
Wood, Stephen A.; Beringer, Jason; Hutley, Lindsay B.; McGuire, A. David; Van Dijk, Albert; Kilinc, Musa
2008-01-01
Runoff from mountain ash (Eucalyptus regnans F.Muell.) forested catchments has been shown to decline significantly in the few decades following fire returning to pre-fire levels in the following centuries owing to changes in ecosystem water use with stand age in a relationship known as Kuczera's model. We examined this relationship between catchment runoff and stand age by measuring whole-ecosystem exchanges of water using an eddy covariance system measuring forest evapotranspiration (ET) combined with sap-flow measurements of tree water use, with measurements made across a chronosequence of three sites (24, 80 and 296 years since fire). At the 296-year old site eddy covariance systems were installed above the E. regnans overstorey and above the distinct rainforest understorey. Contrary to predictions from the Kuczera curve, we found that measurements of whole-forest ET decreased by far less across stand age between 24 and 296 years. Although the overstorey tree water use declined by 1.8mmday-1 with increasing forest age (an annual decrease of 657mm) the understorey ET contributed between 1.2 and 1.5mmday-1, 45% of the total ET (3mmday-1) at the old growth forest.
Site index determination techniques for southern bottomland hardwoods
Brian Roy Lockhart
2013-01-01
Site index is a species-specific indirect measure of forest productivity expressed as the average height of dominant and codominant trees in a stand of a specified base age. It is widely used by forest managers to make informed decisions regarding forest management practices. Unfortunately, forest managers have difficulty in determining site index for southern US...
Energy Technology Data Exchange (ETDEWEB)
Curtis, Peter [The Ohio State Univ., Columbus, OH (United States); Bohrer, Gil [The Ohio State Univ., Columbus, OH (United States); Gough, Christopher [Virginia Commonwealth Univ., Richmond, VA (United States); Nadelhoffer, Knute [Univ. of Michigan, Ann Arbor, MI (United States)
2015-03-12
At the University of Michigan Biological Station (UMBS) AmeriFlux sites (US-UMB and US-UMd), long-term C cycling measurements and a novel ecosystem-scale experiment are revealing physical, biological, and ecological mechanisms driving long-term trajectories of C cycling, providing new data for improving modeling forecasts of C storage in eastern forests. Our findings provide support for previously untested hypotheses that stand-level structural and biological properties constrain long-term trajectories of C storage, and that remotely sensed canopy structural parameters can substantially improve model forecasts of forest C storage. Through the Forest Accelerated Succession ExperimenT (FASET), we are directly testing the hypothesis that forest C storage will increase due to increasing structural and biological complexity of the emerging tree communities. Support from this project, 2011-2014, enabled us to incorporate novel physical and ecological mechanisms into ecological, meteorological, and hydrological models to improve forecasts of future forest C storage in response to disturbance, succession, and current and long-term climate variation
Forest succession at elevated CO2; TOPICAL
International Nuclear Information System (INIS)
Clark, James S.; Schlesinger, William H.
2002-01-01
We tested hypotheses concerning the response of forest succession to elevated CO2 in the FACTS-1 site at the Duke Forest. We quantified growth and survival of naturally recruited seedlings, tree saplings, vines, and shrubs under ambient and elevated CO2. We planted seeds and seedlings to augment sample sites. We augmented CO2 treatments with estimates of shade tolerance and nutrient limitation while controlling for soil and light effects to place CO2 treatments within the context of natural variability at the site. Results are now being analyzed and used to parameterize forest models of CO2 response
Proceedings, 15th central hardwood forest conference
David S. Buckley; Wayne K. Clatterbuck; [Editors
2007-01-01
Proceedings of the 15th central hardwood forest conference held February 27âMarch 1, 2006, in Knoxville, TN. Includes 86 papers and 30 posters pertaining to forest health and protection, ecology and forest dynamics, natural and artificial regeneration, forest products, wildlife, site classification, management and forest resources, mensuration and models, soil and...
Gilani, H.; Jain, A. K.
2016-12-01
This study assembles information from three sources - remote sensing, terrestrial photography and ground-based inventory data, to understand the dynamics of Nepal's tropical and sub-tropical forests and plantation sites for the period 1990-2015. Our study focuses on following three specific district areas, which have conserved forests through social and agroforestry management practices: 1. Dolakha district: This site has been selected to study the impact of community-based forest management on land cover change using repeat photography and satellite imagery, in combination with interviews with community members. The study time period is during the period 1990-2010. We determined that satellite data with ground photographs can provide transparency for long term monitoring. The initial results also suggests that community-based forest management program in the mid-hills of Nepal was successful. 2. Chitwan district: Here we use high resolution remote sensing data and optimized community field inventories to evaluate potential application and operational feasibility of community level REDD+ measuring, reporting and verification (MRV) systems. The study uses temporal dynamics of land cover transitions, tree canopy size classes and biomass over a Kayar khola watershed REDD+ study area with community forest to evaluate satellite Image segmentation for land cover, linear regression model for above ground biomass (AGB), and estimation and monitoring field data for tree crowns and AGB. We study three specific years 2002, 2009, 2012. Using integration of WorldView-2 and airborne LiDAR data for tree species level. 3. Nuwakot district: This district was selected to study the impact of establishment of tree plantation on total barren/fallow. Over the last 40 year, this area has went through a drastic changes, from barren land to forest area with tree species consisting of Dalbergia sissoo, Leucaena leucocephala, Michelia champaca, etc. In 1994, this district area was registered
Edge effects at an induced forest-grassland boundary: forest birds in ...
African Journals Online (AJOL)
Bird species diversity and guild composition between the edge (5-10 m from the margin) of primary forest abutting grassland and the deep interior (> 500 m from the margin) in the Dngoye Forest Reserve were compared. Edge and interior sites were chosen that were homogeneous with respect to habitat physiognomy i.e. ...
Directory of Open Access Journals (Sweden)
Ram Asheshwar MANDAL
2012-12-01
Full Text Available There are some key drivers that favor deforestation and forest degradation. Consequently, levels of carbon stock are affected in different parts of same forest types. But the problem lies in exploring the extent of the effects on level of carbon stocking. This paper highlights the variations in levels of carbon stocks in three different collaborative forests of same forest type i.e. tropical sal (Shorea robusta forest in Mahottari district of the central Terai in Nepal. Three collaborative forests namely Gadhanta-Bardibas Collaborative Forest (CFM, Tuteshwarnath CFM and Banke- Maraha CFM were selected for research site. Interview and workshops were organized with the key informants that include staffs, members and representatives of CFMs to collect the socio-economic data and stratified random sampling was applied to collect the bio-physical data to calculate the carbon stocks. Analysis was carried out using statistical tools. It was found five major drivers namely grazing, fire, logging, growth of invasive species and encroachment. It was found highest carbon 269.36 ton per ha in Gadhanta- Bardibash CFM. The findings showed that the levels of carbon stocks in the three studied CFMs are different depending on how the drivers of deforestation and forest degradation influence over them.
Directory of Open Access Journals (Sweden)
Helge Walentowski
2013-07-01
Full Text Available Biodiversity and forest management are analyzed for a 500 ha privately owned forest within the Natura 2000 area ROSCI0122 Muntii Fagaras. Habitat types and indicator species are identified to measure environmental quality. Working towards an integrated approach to conservation, a range of options that will result in sustainable forest management are then considered. For beech forests light heterogeneity emerges as a crucial management target to ensure tree species richness and structural diversity as a basis for saving indicator species such as Morimus funereus, Cucujus cinnaberinus, Bolitophagus reticulatus and Xestobium austriacum. For spruce forests thinning over a broad range of diameters and maintenance of veteran trees would provide habitats for indicator species such asOlisthaerus substriatus. The populations of a number of bird species would be increased by strip-harvesting slopes: species such as Tetrao urogallus, Bonasia bonasia and Ficedula parva prefer forest margins. Steep slopes, and the areas around springs and watercourses, as well as rock faces, should remain unmanaged. Future management should start with a grid-based inventory to create an objective database of forest structure and life. An example is presented for high-elevation spruce forest. The inventory should quantify the variations in diameter, height and volume of trees per unit area. Such data would allow the advanced planning of forest operations. We discuss a wide range of administrative and organizational changes; changes that are needed for the sustainable forest management of the vast close-to-natural forests of the Muntii Fagaras, the maintenance of the Nardusgrasslands and the protection of wetland vegetation around springs and streams in this Natura 2000-area.
Prediction of protein-protein interaction sites in sequences and 3D structures by random forests.
Directory of Open Access Journals (Sweden)
Mile Sikić
2009-01-01
Full Text Available Identifying interaction sites in proteins provides important clues to the function of a protein and is becoming increasingly relevant in topics such as systems biology and drug discovery. Although there are numerous papers on the prediction of interaction sites using information derived from structure, there are only a few case reports on the prediction of interaction residues based solely on protein sequence. Here, a sliding window approach is combined with the Random Forests method to predict protein interaction sites using (i a combination of sequence- and structure-derived parameters and (ii sequence information alone. For sequence-based prediction we achieved a precision of 84% with a 26% recall and an F-measure of 40%. When combined with structural information, the prediction performance increases to a precision of 76% and a recall of 38% with an F-measure of 51%. We also present an attempt to rationalize the sliding window size and demonstrate that a nine-residue window is the most suitable for predictor construction. Finally, we demonstrate the applicability of our prediction methods by modeling the Ras-Raf complex using predicted interaction sites as target binding interfaces. Our results suggest that it is possible to predict protein interaction sites with quite a high accuracy using only sequence information.
Mark Nelson; Greg Liknes; Charles H. Perry
2009-01-01
Analysis and display of forest composition, structure, and pattern provides information for a variety of assessments and management decision support. The objective of this study was to produce geospatial datasets and maps of conterminous United States forest land ownership, forest site productivity, timberland, and reserved forest land. Satellite image-based maps of...
Energy Technology Data Exchange (ETDEWEB)
Carleton, T.J.; Gordon, A.M.
1992-01-01
In summer 1991, a variety of forest stands dominated by old specimens of white pine and red pine were sampled across a representative portion of the species' range in northcentral Ontario. Plots were established in 40 stands of those surveyed to identify the salient structural components of old-growth, to survey the floristic composition (vascular plants and autotrophic non- vascular plants), to survey site characteristics, and to estimate the links in understorey alpha diversity with site conditions and stand structure. Long-term objectives include a definition of old- growth pine forest, recognition criteria, and prospective management options. Forest stand structure was enumerated through mapping, mensurational, and age estimation techniques. Forest vegetation, including over and understorey species, was non- destructively sampled and a range of data on stand and soil-site variables was also collected in conjunction with information on stand variables peculiar to old growth forests.
Roth, Travis R.; Nolin, Anne W.
2017-11-01
Forest cover modifies snow accumulation and ablation rates via canopy interception and changes in sub-canopy energy balance processes. However, the ways in which snowpacks are affected by forest canopy processes vary depending on climatic, topographic and forest characteristics. Here we present results from a 4-year study of snow-forest interactions in the Oregon Cascades. We continuously monitored snow and meteorological variables at paired forested and open sites at three elevations representing the Low, Mid, and High seasonal snow zones in the study region. On a monthly to bi-weekly basis, we surveyed snow depth and snow water equivalent across 900 m transects connecting the forested and open pairs of sites. Our results show that relative to nearby open areas, the dense, relatively warm forests at Low and Mid sites impede snow accumulation via canopy snow interception and increase sub-canopy snowpack energy inputs via longwave radiation. Compared with the Forest sites, snowpacks are deeper and last longer in the Open site at the Low and Mid sites (4-26 and 11-33 days, respectively). However, we see the opposite relationship at the relatively colder High sites, with the Forest site maintaining snow longer into the spring by 15-29 days relative to the nearby Open site. Canopy interception efficiency (CIE) values at the Low and Mid Forest sites averaged 79 and 76 % of the total event snowfall, whereas CIE was 31 % at the lower density High Forest site. At all elevations, longwave radiation in forested environments appears to be the primary energy component due to the maritime climate and forest presence, accounting for 93, 92, and 47 % of total energy inputs to the snowpack at the Low, Mid, and High Forest sites, respectively. Higher wind speeds in the High Open site significantly increase turbulent energy exchanges and snow sublimation. Lower wind speeds in the High Forest site create preferential snowfall deposition. These results show the importance of
Variation in indigenous forest resource use in central Guyana.
Directory of Open Access Journals (Sweden)
Claire M P Ozanne
Full Text Available Sustainable forest conservation strategies should be based on local as well as landscape-scale forest resource use data. Using ecological and sociological techniques, we test the hypotheses that (1 forest resource use differs between ethnic and socioeconomic indigenous groups and (2 that this difference results in differing spatial patterns of resource use, with implications for forest diversity and for conservation planning. In the North Rupununi Guyana, three adjacent indigenous communities (differing in their indigenous/immigrant balance were recorded using 73 animal and 164 plant species (plus several unidentified ethno-species. Farm sites formed important foci for most forest based activities and ex-farm sites supported similar floristic diversity to surrounding forest. Resource usage differences between communities could be attributed to socio-cultural drivers, e.g. mammal meat consumption and the use of the fruits from the palm tree A. maripa were higher in more traditional households. When extracting household construction timber, lower income groups created small scattered felling sites akin to tree fall gaps whereas higher income groups created larger gaps. Lower income (indigenous households tended to clear larger but more contained sites for farming while mixed or non-Amerindian household tended to clear smaller but more widely dispersed farm sites. These variations resulted in different patterns of forest disturbance originating from agriculture and timber extraction.
Directory of Open Access Journals (Sweden)
François Feer
2013-06-01
Full Text Available The structure of dung beetle communities inhabiting tropical forests are known to be sensitive to many kinds of environmental changes such as microclimate related to vegetation structure. I examined Scarabaeinae assemblages in two sites of undisturbed high forest and two sites of low forest forming a transitional zone with the open habitat of an inselberg in French Guiana. Sampling was made with pitfall and flight interception traps during 2003 and 2004. The driest and warmest conditions characterized the low forest sites. Across two years we obtained 2 927 individuals from 61 species with pitfall traps and 1 431 individuals from 85 species with flight interception traps. Greater species richness and abundance characterized all sites sampled with pitfall traps during 2003 more than 2004. In 2003 no differences were detected among sites by rarefaction analyses. In 2004 the species richest high forest site was significantly different from one of the low forest sites. For both years Clench model asymptotes for species richness were greater in high forest than in low forest sites. For both years, mean per-trap species richness, abundance and biomass among high forest sites were similar and higher than in low forest sites, especially where the lowest humidity and the highest temperature were recorded. Within the two low forest sites, species richness and abundance recorded during the second year, decreased with distance to edge. Different dominant roller species characterized the pitfall samples in one site of low forest and in other sites. Small variations in microclimatic conditions correlated to canopy height and openness likely affected dung beetle assemblages but soil depth and the presence of large mammals providing dung resource may also play a significant role.
Directory of Open Access Journals (Sweden)
Bila-Isia Inogwabini
2015-10-01
Full Text Available The description and differentiation of habitat types is a major concern in ecology. This study examined relationships between Bonobo Pan paniscus nesting patterns and forest structure in the Lake Tumba Swampy Forests. Data on presence of fresh Bonobo nests, canopy cover, canopy structure, tree densities and tree basal areas were collected systematically along 134 transects at 400m and 800m intervals, and the leaf-covered area (LCA was calculated for each of seven forest types. I observed a significant correlation between bonobo nests and mixed mature forest/closed understory forest type (r=-0.730, df = 21, p <0.05, but not mixed mature forest/open understory, old secondary forest and young secondary forest. Basal areas of non-nesting trees along transects did not differ significantly from those in sites where bonobos nested. Higher LCA (55% and 55% occurred in nesting sites when compared with non-nesting sites (39% and 42% at elevations 4–8 m and 8–16 m above the soil. There was greater leaf cover in the understorey at sites where bonobos did not nest, while there was greater leaf cover in the mid-storey at sites where bonobos did nest.
Directory of Open Access Journals (Sweden)
H. Walentowski
2013-05-01
Full Text Available Biodiversity and forest management are analyzed for a 500 haprivately owned forest within the Natura 2000 area “ROSCI0122 MunţiiFăgăraş”. Habitat types and indicator species are identified to measure environmental quality. Working towards an integrated approach to conservation, a range of options that will result in sustainable forest management are then considered. For beech forests light heterogeneity emerges as a crucial management target to ensure tree species richness and structural diversity as a basis for saving indicator species such as Morimus funereus, Cucujus cinnaberinus,Bolitophagus reticulatus and Xestobium austriacum. For spruceforests thinning over a broad range of diameters and maintenance of veteran trees would provide habitats for indicator species such as Olisthaerus substriatus. The populations of a number of bird species would be increased by strip-harvesting slopes: species such as Tetrao urogallus, Bonasia bonasia and Ficedula parva prefer forest margins. Steep slopes, and the areas around springs and watercourses, as well as rock faces, should remain unmanaged. Future management should start with a grid-based inventory to create an objective database of forest structure and life. An example is presented for high-elevation spruce forest. The inventory should quantify the variations in diameter, height and volume of trees per unit area. Such data would allowthe advanced planning of forest operations. We discuss a wide range ofadministrative and organizational changes; changes that are needed for the sustainable forest management of the vast close-to-natural forests of the Munţii Făgăraş, the maintenance of the Nardus grasslands and the protection of wetland vegetation around springs and streams in this Natura 2000-area.
Acoustic noises of the BOR-60 reactor steam generators when simulating leaks with argon and steam
International Nuclear Information System (INIS)
Sokolov, V.M.; Golushko, V.V.; Afanas'ev, V.A.; Grebenkin, Yu.P.; Muralev, A.B.
1985-01-01
Background acoustic noises of stea generators in different operational regimes and noises of argon and steam small leads (about 0.1 g/s) are studied to determine the possibility of designing the acoustic system for leak detection in sodium-water steamgenerators. Investigations are carried out at the 30 MW micromodule steam generator being in operation at the BOR-60 reactor as well as at the 20 MW tank type steam generator. Immersed ransduceres made of lithium niobate 6 mm in-diameter and waveguide transducers made of a stainless steel in the form of rods 10 mm in-diameter and 500 mm long are used as acoustic monitors. It is shown that the leak noise is more wide-band than the background noise of the steam generator and both high and low frequencies appear in the spectrum. The use of monitors of different types results in similar conslusions inrelation to the character of background noises and leak signals (spectral density, signal to-noise ratio) in the ase of similar bandroidths of the transduceres. A conclusion is made that the change of operational regimes leads to changes of background noise level, which can be close to the reaction of
Dispersal of radioactivity by wildlife from contaminated sites in a forested landscape
International Nuclear Information System (INIS)
Garten, C.T. Jr.
1992-01-01
Oak Ridge National Laboratory (ORNL) is located within the Ridge and Valley physiographic province of eastern Tennessee (USA). This area is characterized by deciduous forests dominated by hardwood and mixed mesophytic tree species. Wildlife populations have access to some radioactively contaminated sites at ORNL, and contaminated animals or animal nests within the Laboratory's boundaries have been found to contain on the order of 10 -12 to 10 -6 Ci/g of 90 Sr or 137 Cs, and trace amounts of other radionuclides (including transuranic elements). Theoretical calculations indicate that nanocurie levels of 90 Sr in bone can arise from relatively small amounts (1%) of contaminated browse vegetation in a deer's diet. Measures that have been undertaken at ORNL to curtail the dispersal of radioactivity by animals are briefly reviewed
Creation of forest edges has a global impact on forest vertebrates
Peres, CA; Banks-Leite, C; Wearn, OR; Marsh, CJ; Butchart, SHM; Arroyo-Rodríguez, V; Barlow, J; Cerezo, A; Cisneros, L; D’Cruze, N; Faria, D; Hadley, A; Harris, S; Klingbeil, BT; Kormann, U; Lens, L; Medina-Rangel, GF; Morante-Filho, JC; Olivier, P; Peters, SL; Pidgeon, A; Ribeiro, DB; Scherber, C; Schneider-Maunory, L; Struebig, M; Urbina-Cardona, N; Watling, JI; Willig, MR; Wood, EM; Ewers, RM
2017-01-01
Summary Forest edges influence more than half the world’s forests and contribute to worldwide declines in biodiversity and ecosystem functions. However, predicting these declines is challenging in heterogeneous fragmented landscapes. We assembled an unmatched global dataset on species responses to fragmentation and developed a new statistical approach for quantifying edge impacts in heterogeneous landscapes to quantify edge-determined changes in abundance of 1673 vertebrate species. We show that 85% of species’ abundances are affected, either positively or negatively, by forest edges. Forest core species, which were more likely to be listed as threatened by the IUCN, only reached peak abundances at sites farther than 200-400 m from sharp high-contrast forest edges. Smaller-bodied amphibians, larger reptiles and medium-sized non-volant mammals experienced a larger reduction in suitable habitat than other forest core species. Our results highlight the pervasive ability of forest edges to restructure ecological communities on a global scale. PMID:29088701
Yanai, Ruth D.; Driscoll, Charles T.; Montesdeoca, Mario; Smith, Kevin T.
2018-01-01
Mercury (Hg) is deposited from the atmosphere to remote areas such as forests, but the amount of Hg in trees is not well known. To determine the importance of Hg in trees, we analyzed foliage, bark and bole wood of eight tree species at four sites in the northeastern USA (Huntington Forest, NY; Sleepers River, VT; Hubbard Brook, NH; Bear Brook, ME). Foliar concentrations of Hg averaged 16.3 ng g-1 among the hardwood species, which was significantly lower than values in conifers, which averaged 28.6 ng g-1 (p < 0.001). Similarly, bark concentrations of Hg were lower (p < 0.001) in hardwoods (7.7 ng g-1) than conifers (22.5 ng g-1). For wood, concentrations of Hg were higher in yellow birch (2.1–2.8 ng g-1) and white pine (2.3 ng g-1) than in the other species, which averaged 1.4 ng g-1 (p < 0.0001). Sites differed significantly in Hg concentrations of foliage and bark (p = 0.02), which are directly exposed to the atmosphere, but the concentration of Hg in wood depended more on species (p < 0.001) than site (p = 0.60). The Hg contents of tree tissues in hardwood stands, estimated from modeled biomass and measured concentrations at each site, were higher in bark (mean of 0.10 g ha-1) and wood (0.16 g ha-1) than in foliage (0.06 g ha-1). In conifer stands, because foliar concentrations were higher, the foliar pool tended to be more important. Quantifying Hg in tree tissues is essential to understanding the pools and fluxes of Hg in forest ecosystems. PMID:29684081
Yang, Yang; Yanai, Ruth D; Driscoll, Charles T; Montesdeoca, Mario; Smith, Kevin T
2018-01-01
Mercury (Hg) is deposited from the atmosphere to remote areas such as forests, but the amount of Hg in trees is not well known. To determine the importance of Hg in trees, we analyzed foliage, bark and bole wood of eight tree species at four sites in the northeastern USA (Huntington Forest, NY; Sleepers River, VT; Hubbard Brook, NH; Bear Brook, ME). Foliar concentrations of Hg averaged 16.3 ng g-1 among the hardwood species, which was significantly lower than values in conifers, which averaged 28.6 ng g-1 (p < 0.001). Similarly, bark concentrations of Hg were lower (p < 0.001) in hardwoods (7.7 ng g-1) than conifers (22.5 ng g-1). For wood, concentrations of Hg were higher in yellow birch (2.1-2.8 ng g-1) and white pine (2.3 ng g-1) than in the other species, which averaged 1.4 ng g-1 (p < 0.0001). Sites differed significantly in Hg concentrations of foliage and bark (p = 0.02), which are directly exposed to the atmosphere, but the concentration of Hg in wood depended more on species (p < 0.001) than site (p = 0.60). The Hg contents of tree tissues in hardwood stands, estimated from modeled biomass and measured concentrations at each site, were higher in bark (mean of 0.10 g ha-1) and wood (0.16 g ha-1) than in foliage (0.06 g ha-1). In conifer stands, because foliar concentrations were higher, the foliar pool tended to be more important. Quantifying Hg in tree tissues is essential to understanding the pools and fluxes of Hg in forest ecosystems.
Directory of Open Access Journals (Sweden)
Huili Yuan
2015-06-01
Full Text Available The estimation of the Fraction of Absorbed Photosynthetically Active Radiation in forests (forest fAPAR from multi-spectral Landsat-8 data is investigated in this paper using a physically based radiative transfer model (Invertible Forest Reflectance Model, INFORM combined with an inversion strategy based on artificial neural nets (ANN. To derive the forest fAPAR for the Dabie mountain test site in China in 30 m spatial resolution (size approximately 3000 km2, a database of forest canopy spectral reflectances was simulated with INFORM taking into account structural variables such as leaf area index (LAI, crown coverage and stem density as well as leaf composition. To establish the relationship between forest fAPAR and the reflectance modeled by INFORM, a logarithmic relationship between LAI and fAPAR was used previously established using on-site field measurements. On this basis, predictive models between Landsat-8 reflectance and fAPAR were established using an artificial neural network. After calibrating INFORM for the test site, forty-two forest stands were used to validate the performance of the method. The results show that spectral signatures modeled by INFORM correspond reasonably well with the forest canopy reflectance spectra derived from Landsat data. Deviations increase with increasing angle between surface normal of the hilly terrain and sun incidence. The comparison of estimated and measured fAPAR (R2 = 0.47, RMSE = 0.11 demonstrates that INFORM can be inverted using neural nets to provide acceptable estimates of forest fAPAR. The accuracy of the predictions increased significantly when excluding pixels located in very steep terrain. This demonstrates that the applied topographic correction was not sufficiently accurate and should be improved for making optimum use of radiative transfer models such as INFORM.
Camarero, J Julio; Gazol, Antonio; Galván, Juan Diego; Sangüesa-Barreda, Gabriel; Gutiérrez, Emilia
2015-02-01
Theory predicts that the postindustrial rise in the concentration of CO2 in the atmosphere (c(a)) should enhance tree growth either through a direct fertilization effect or indirectly by improving water use efficiency in dry areas. However, this hypothesis has received little support in cold-limited and subalpine forests where positive growth responses to either rising ca or warmer temperatures are still under debate. In this study, we address this issue by analyzing an extensive dendrochronological network of high-elevation Pinus uncinata forests in Spain (28 sites, 544 trees) encompassing the whole biogeographical extent of the species. We determine if the basal area increment (BAI) trends are linked to climate warming and increased c(a) by focusing on region- and age-dependent responses. The largest improvement in BAI over the past six centuries occurred during the last 150 years affecting young trees and being driven by recent warming. Indeed, most studied regions and age classes presented BAI patterns mainly controlled by temperature trends, while growing-season precipitation was only relevant in the driest sites. Growth enhancement was linked to rising ca in mature (151-300 year-old trees) and old-mature trees (301-450 year-old trees) from the wettest sites only. This finding implies that any potential fertilization effect of elevated c(a) on forest growth is contingent on tree features that vary with ontogeny and it depends on site conditions (for instance water availability). Furthermore, we found widespread growth decline in drought-prone sites probably indicating that the rise in ca did not compensate for the reduction in water availability. Thus, warming-triggered drought stress may become a more important direct driver of growth than rising ca in similar subalpine forests. We argue that broad approaches in biogeographical and temporal terms are required to adequately evaluate any effect of rising c(a) on forest growth. © 2014 John Wiley & Sons Ltd.
Alamgir, Mohammed; Campbell, Mason J; Turton, Stephen M; Pert, Petina L; Edwards, Will; Laurance, William F
2016-07-20
Tropical forests are major contributors to the terrestrial global carbon pool, but this pool is being reduced via deforestation and forest degradation. Relatively few studies have assessed carbon storage in degraded tropical forests. We sampled 37,000 m(2) of intact rainforest, degraded rainforest and sclerophyll forest across the greater Wet Tropics bioregion of northeast Australia. We compared aboveground biomass and carbon storage of the three forest types, and the effects of forest structural attributes and environmental factors that influence carbon storage. Some degraded forests were found to store much less aboveground carbon than intact rainforests, whereas others sites had similar carbon storage to primary forest. Sclerophyll forests had lower carbon storage, comparable to the most heavily degraded rainforests. Our findings indicate that under certain situations, degraded forest may store as much carbon as intact rainforests. Strategic rehabilitation of degraded forests could enhance regional carbon storage and have positive benefits for tropical biodiversity.
Directory of Open Access Journals (Sweden)
T. R. Roth
2017-11-01
Full Text Available Forest cover modifies snow accumulation and ablation rates via canopy interception and changes in sub-canopy energy balance processes. However, the ways in which snowpacks are affected by forest canopy processes vary depending on climatic, topographic and forest characteristics. Here we present results from a 4-year study of snow–forest interactions in the Oregon Cascades. We continuously monitored snow and meteorological variables at paired forested and open sites at three elevations representing the Low, Mid, and High seasonal snow zones in the study region. On a monthly to bi-weekly basis, we surveyed snow depth and snow water equivalent across 900 m transects connecting the forested and open pairs of sites. Our results show that relative to nearby open areas, the dense, relatively warm forests at Low and Mid sites impede snow accumulation via canopy snow interception and increase sub-canopy snowpack energy inputs via longwave radiation. Compared with the Forest sites, snowpacks are deeper and last longer in the Open site at the Low and Mid sites (4–26 and 11–33 days, respectively. However, we see the opposite relationship at the relatively colder High sites, with the Forest site maintaining snow longer into the spring by 15–29 days relative to the nearby Open site. Canopy interception efficiency (CIE values at the Low and Mid Forest sites averaged 79 and 76 % of the total event snowfall, whereas CIE was 31 % at the lower density High Forest site. At all elevations, longwave radiation in forested environments appears to be the primary energy component due to the maritime climate and forest presence, accounting for 93, 92, and 47 % of total energy inputs to the snowpack at the Low, Mid, and High Forest sites, respectively. Higher wind speeds in the High Open site significantly increase turbulent energy exchanges and snow sublimation. Lower wind speeds in the High Forest site create preferential snowfall deposition. These
Charles R. Berry
1977-01-01
Dried sewage sludge was applied at rates of 0, 17, 34, and 69 metric tons/ha on a badly eroded forest site in the Piedmont region of northeast Georgia. Production of weed bio mass varied directly with amount of sludge applied. Heigh growth for both shortleafand loblolly pine seedlings appeared to be greater on plots receiving 17 metric tons of sludge/ha, bu differences...
Creation of forest edges has a global impact on forest vertebrates
Pfeifer, M.; Lefebvre, V.; Peres, C. A.; Banks-Leite, C.; Wearn, O. R.; Marsh, C. J.; Butchart, S. H. M.; Arroyo-Rodríguez, V.; Barlow, J.; Cerezo, A.; Cisneros, L.; D'Cruze, N.; Faria, D.; Hadley, A.; Harris, S. M.; Klingbeil, B. T.; Kormann, U.; Lens, L.; Medina-Rangel, G. F.; Morante-Filho, J. C.; Olivier, P.; Peters, S. L.; Pidgeon, A.; Ribeiro, D. B.; Scherber, C.; Schneider-Maunoury, L.; Struebig, M.; Urbina-Cardona, N.; Watling, J. I.; Willig, M. R.; Wood, E. M.; Ewers, R. M.
2017-11-01
Forest edges influence more than half of the world’s forests and contribute to worldwide declines in biodiversity and ecosystem functions. However, predicting these declines is challenging in heterogeneous fragmented landscapes. Here we assembled a global dataset on species responses to fragmentation and developed a statistical approach for quantifying edge impacts in heterogeneous landscapes to quantify edge-determined changes in abundance of 1,673 vertebrate species. We show that the abundances of 85% of species are affected, either positively or negatively, by forest edges. Species that live in the centre of the forest (forest core), that were more likely to be listed as threatened by the International Union for Conservation of Nature (IUCN), reached peak abundances only at sites farther than 200-400 m from sharp high-contrast forest edges. Smaller-bodied amphibians, larger reptiles and medium-sized non-volant mammals experienced a larger reduction in suitable habitat than other forest-core species. Our results highlight the pervasive ability of forest edges to restructure ecological communities on a global scale.
Phylobetadiversity among forest types in the Brazilian Atlantic Forest complex.
Duarte, Leandro Da Silva; Bergamin, Rodrigo Scarton; Marcilio-Silva, Vinícius; Seger, Guilherme Dubal Dos Santos; Marques, Márcia Cristina Mendes
2014-01-01
Phylobetadiversity is defined as the phylogenetic resemblance between communities or biomes. Analyzing phylobetadiversity patterns among different vegetation physiognomies within a single biome is crucial to understand the historical affinities between them. Based on the widely accepted idea that different forest physiognomies within the Southern Brazilian Atlantic Forest constitute different facies of a single biome, we hypothesize that more recent phylogenetic nodes should drive phylobetadiversity gradients between the different forest types within the Atlantic Forest, as the phylogenetic divergence among those forest types is biogeographically recent. We compiled information from 206 checklists describing the occurrence of shrub/tree species across three different forest physiognomies within the Southern Brazilian Atlantic Forest (Dense, Mixed and Seasonal forests). We analyzed intra-site phylogenetic structure (phylogenetic diversity, net relatedness index and nearest taxon index) and phylobetadiversity between plots located at different forest types, using five different methods differing in sensitivity to either basal or terminal nodes (phylogenetic fuzzy weighting, COMDIST, COMDISTNT, UniFrac and Rao's H). Mixed forests showed higher phylogenetic diversity and overdispersion than the other forest types. Furthermore, all forest types differed from each other in relation phylobetadiversity patterns, particularly when phylobetadiversity methods more sensitive to terminal nodes were employed. Mixed forests tended to show higher phylogenetic differentiation to Dense and Seasonal forests than these latter from each other. The higher phylogenetic diversity and phylobetadiversity levels found in Mixed forests when compared to the others likely result from the biogeographical origin of several taxa occurring in these forests. On one hand, Mixed forests shelter several temperate taxa, like the conifers Araucaria and Podocarpus. On the other hand, tropical groups, like
Managing Southeastern US Forests for Increased Water Yield
Acharya, S.; Kaplan, D. A.; Mclaughlin, D. L.; Cohen, M. J.
2017-12-01
Forested lands influence watershed hydrology by affecting water quantity and quality in surface and groundwater systems, making them potentially effective tools for regional water resource planning. In this study, we quantified water use and water yield by pine forests under varying silvicultural management (e.g., high density plantation, thinning, and prescribed burning). Daily forest water use (evapotranspiration, ET) was estimated using continuously monitored soil-moisture in the root-zone at six sites across Florida (USA), each with six plots ranging in forest leaf-area index (LAI). Plots included stands with different rotational ages (from clear-cut to mature pine plantations) and those restored to more historical conditions. Estimated ET relative to potential ET (PET) was strongly associated with LAI, root-zone soil-moisture status, and site hydroclimate; these factors explained 85% of the variation in the ET:PET ratio. Annual water yield (Yw) calculated from these ET estimates and a simple water balance differed significantly among sites and plots (ranging from -0.12 cm/yr to > 100 cm/yr), demonstrating substantive influence of management regimes. LAI strongly influenced Yw in all sites, and a general linear model with forest attributes (LAI and groundcover), hydroclimate, and site characteristics explained >90% of variation in observed Yw. These results can be used to predict water yield changes under different management and climate scenarios and may be useful in the development of payment for ecosystem services approaches that identify water as an important product of forest best management practices.
Forest Islands and Castaway Communities: REDD+ and Forest Restoration in Prey Lang Forest
Directory of Open Access Journals (Sweden)
Courtney Work
2017-02-01
Full Text Available Climate Change policies are playing an ever-increasing role in global development strategies and their implementation gives rise to often-unforeseen social conflicts and environmental degradations. A landscape approach to analyzing forest-based Climate Change Mitigation policies (CCM and land grabs in the Prey Lang Forest landscape, Cambodia revealed two Korea-Cambodia partnership projects designed to increase forest cover that are juxtaposed in this paper. Case study data revealed a REDD+ project with little negative impact or social conflict in the project area and an Afforestation/Reforestation (A/R project that created both social and ecological conflicts. The study concludes that forest-based CCM policies can reduce conflict through efforts at minimal transformation of local livelihoods, maximal attention to the tenure rights, responsibilities, and authority of citizens, and by improving, not degrading, the project landscapes. The paper presents the circumstances under which these guidelines are sidestepped by the A/R project, and importantly reveals that dramatic forest and livelihood transformation had already affected the community and environment in the REDD+ project site. There are deep contradictions at the heart of climate change policies toward which attention must be given, lest we leave our future generations with nothing but forest islands and castaway communities.
Forest road and fuel break siting with respect to reference fire intensities
Energy Technology Data Exchange (ETDEWEB)
Eastaugh, C. S.; Molina, D. M.
2012-11-01
Forest roads and permanent fuel breaks are an important part of fire suppression infrastructure, but due to maintenance and environmental costs many forest agencies seek to reduce the extent of these networks. The question of which roads should be retained or where fuel breaks should be established is contentious, and few quantified methods exist to aid management decisions. This study uses GIS procedures and develops a metric for road network vulnerability, which may be used to determine the relative effectiveness of a road network or a particular fuel break as a fire control line. The method constructs reference fire intensities, and compares the fire intensity at roadsides or fuel breaks with the overall forest average. In the case study area in Victoria's Central Highlands (southeast Australia), average fire intensities on the forest road network are found to closely match the forest average, indicating that roads in their current locations are not skewed towards more dangerous parts of the forest. The fuel break network however is likely to face fire intensities substantially greater than those in the average forest area. (Author) 33 refs.
78 FR 16830 - Notice of New Fee Site
2013-03-19
... New Fee Site AGENCY: Rio Grande National Forest, USDA Forest Service. ACTION: Notice of New Fee Site... Forest is proposing to add a cabin for rent to the public for a $50 fee for the overnight rental. It was.... People are invited to comment on this proposal. DATES: Send any comments about these fee proposals by...
Effects of coffee management on deforestation rates and forest integrity.
Hylander, Kristoffer; Nemomissa, Sileshi; Delrue, Josefien; Enkosa, Woldeyohannes
2013-10-01
Knowledge about how forest margins are utilized can be crucial for a general understanding of changes in forest cover, forest structure, and biodiversity across landscapes. We studied forest-agriculture transitions in southwestern Ethiopia and hypothesized that the presence of coffee (Coffea arabica)decreases deforestation rates because of coffee's importance to local economies and its widespread occurrence in forests and forest margins. Using satellite images and elevation data, we compared changes in forest cover over 37 years (1973-2010) across elevations in 2 forest-agriculture mosaic landscapes (1100 km(2) around Bonga and 3000 km(2) in Goma-Gera). In the field in the Bonga area, we determined coffee cover and forest structure in 40 forest margins that differed in time since deforestation. Both the absolute and relative deforestation rates were lower at coffee-growing elevations compared with at higher elevations (-10/20% vs. -40/50% comparing relative rates at 1800 m asl and 2300-2500 m asl, respectively). Within the coffee-growing elevation, the proportion of sites with high coffee cover (>20%) was significantly higher in stable margins (42% of sites that had been in the same location for the entire period) than in recently changed margins (0% of sites where expansion of annual crops had changed the margin). Disturbance level and forest structure did not differ between sites with 30% or 3% coffee. However, a growing body of literature on gradients of coffee management in Ethiopia reports coffee's negative effects on abundances of forest-specialist species. Even if the presence of coffee slows down the conversion of forest to annual-crop agriculture, there is a risk that an intensification of coffee management will still threaten forest biodiversity, including the genetic diversity of wild coffee. Conservation policy for Ethiopian forests thus needs to develop strategies that acknowledge that forests without coffee production may have higher deforestation
Impacts of fire on forest age and runoff in mountain ash forests
Wood, S.A.; Beringer, J.; Hutley, L.B.; McGuire, A.D.; Van Dijk, A.; Kilinc, M.
2008-01-01
Runoff from mountain ash (Eucalyptus regnans F.Muell.) forested catchments has been shown to decline significantly in the few decades following fire - returning to pre-fire levels in the following centuries - owing to changes in ecosystem water use with stand age in a relationship known as Kuczera's model. We examined this relationship between catchment runoff and stand age by measuring whole-ecosystem exchanges of water using an eddy covariance system measuring forest evapotranspiration (ET) combined with sap-flow measurements of tree water use, with measurements made across a chronosequence of three sites (24, 80 and 296 years since fire). At the 296-year old site eddy covariance systems were installed above the E. regnans overstorey and above the distinct rainforest understorey. Contrary to predictions from the Kuczera curve, we found that measurements of whole-forest ET decreased by far less across stand age between 24 and 296 years. Although the overstorey tree water use declined by 1.8 mm day-1 with increasing forest age (an annual decrease of 657 mm) the understorey ET contributed between 1.2 and 1.5 mm day-1, 45% of the total ET (3 mm day-1) at the old growth forest. ?? CSIRO 2008.
Vulnerability of tropical forest ecosystems and forest dependent communities to droughts.
Vogt, D J; Vogt, K A; Gmur, S J; Scullion, J J; Suntana, A S; Daryanto, S; Sigurðardóttir, R
2016-01-01
Energy captured by and flowing through a forest ecosystem can be indexed by its total Net Primary Productivity (NPP). This forest NPP can also be a reflection of its sensitivity to, and its ability to adapt to, any climate change while also being harvested by humans. However detecting and identifying the vulnerability of forest and human ecosystems to climate change requires information on whether these coupled social and ecological systems are able to maintain functionality while responding to environmental variability. To better understand what parameters might be representative of environmental variability, we compiled a metadata analysis of 96 tropical forest sites. We found that three soil textural classes (i.e., sand, sandy loam and clay) had significant but different relationships between NPP and precipitation levels. Therefore, assessing the vulnerability of forests and forest dependent communities to drought was carried out using data from those sites that had one of those three soil textural classes. For example, forests growing on soil textures of sand and clay had NPP levels decreasing as precipitation levels increased, in contrast to those forest sites that had sandy loam soils where NPP levels increased. Also, forests growing on sandy loam soil textures appeared better adapted to grow at lower precipitation levels compared to the sand and clay textured soils. In fact in our tropical database the lowest precipitation level found for the sandy loam soils was 821 mm yr(-1) compared to sand at 1739 mm yr(-1) and clay at 1771 mm yr(-1). Soil texture also determined the level of NPP reached by a forest, i.e., forest growing on sandy loam and clay reached low-medium NPP levels while higher NPP levels (i.e., medium, high) were found on sand-textured soils. Intermediate precipitation levels (>1800-3000 mm yr(-1)) were needed to grow forests at the medium and high NPP levels. Low thresholds of NPP were identified at both low (∼750 mm) and high precipitation
Managing carbon sequestration and storage in northern hardwood forests
Eunice A. Padley; Deahn M. Donner; Karin S. Fassnacht; Ronald S. Zalesny; Bruce Birr; Karl J. Martin
2011-01-01
Carbon has an important role in sustainable forest management, contributing to functions that maintain site productivity, nutrient cycling, and soil physical properties. Forest management practices can alter ecosystem carbon allocation as well as the amount of total site carbon.
Protecting and restoring longleaf pine forests on the Kisatchie National Forest in Louisiana
James D. Haywood; Michael Elliot-Smith; Finis Harris; Alton Martin
2000-01-01
Longleaf pine (Pinus palustris Mill.) forests once constituted a major ecosystem in the Southern United States stretching from southeastern Virginia south to central Florida and west into East Texas. These forests covered a wide range of site conditions, from wet pine flatwoods to dry mountain slopes. Intensive exploitation reduced the extent of old-...
The experimental design of the Missouri Ozark Forest Ecosystem Project
Steven L. Sheriff; Shuoqiong. He
1997-01-01
The Missouri Ozark Forest Ecosystem Project (MOFEP) is an experiment that examines the effects of three forest management practices on the forest community. MOFEP is designed as a randomized complete block design using nine sites divided into three blocks. Treatments of uneven-aged, even-aged, and no-harvest management were randomly assigned to sites within each block...
Directory of Open Access Journals (Sweden)
A. A. Onuchin
2014-02-01
Full Text Available In the paper disturbance of Angara river region forests were estimated and peculiarities of forest regeneration after logging and wild fires were analyzed. According to the landscape classification of the regional study, three groups of landscapes differencing on types of forest successions were developed. It was shown that water protective and water regulate functions of the Angara river region forests change under commercial forest harvesting. Comparisons of the inventory and hydrological data detected that hydrological consequences of commercial forest harvesting are dependent on climatic parameters and forest regeneration peculiarities. In the continental climate conditions, when forest regeneration is delayed, snow storms are more active, snow evaporation increases and runoff reduces. In the process of logging sites overgrown with secondary small-leaved forest, snow accumulation increases and runoff increases, exceeding the value of annual runoff at undisturbed watersheds.
Use of ground-based radiometers for L-Band Freeze/Thaw retrieval in a boreal forest site
Roy, A.; Sonnentag, O.; Derksen, C.; Toose, P.; Pappas, C.; Mavrovic, A.; El Amine, M.; Royer, A.; Berg, A. A.; Rowlandson, T. L.; Barr, A.; Black, T. A.
2017-12-01
The boreal forest is the second largest land biome in the world and thus plays a major role in the global and regional climate systems. The extent, timing and duration of the seasonal freeze/thaw (F/T) state influences vegetation developmental stages (phenology) and, consequently, constitutes an important control on how boreal forest ecosystems exchange carbon, water and energy with the atmosphere. Recently, new L-Band satellite-derived F/T information has become available. However, disentangling the seasonally differing contributions from forest overstory and understory vegetation, and the ground surface to the satellite signal remains challenging. Here we present results from an ongoing campaign with two L-Band surface-based radiometers (SBR) installed on a micrometeorological tower at the Southern Old Black Spruce site (53.99°N / 105.12°W) in central Saskatchewan. One radiometer unit is installed on top of the tower viewing the multi-layer vegetation canopy from above. A second radiometer unit is installed within the multi-layer canopy, viewing the understory and the ground surface only. The objectives of our study are to (i) disentangle the L-Band F/T signal contribution of boreal forest overstory from the combined understory and ground surface contribution, and (ii) link the L-Band F/T signal to related boreal forest structural and functional characteristics. Analysis of these radiometer measurements made from September to November 2016 shows that when the ground surface is thawed, the main contributor to both radiometer signals is soil moisture. The Pearson correlation coefficient between brightness temperature (TB) at vertical polarization (V-pol) and soil permittivity is 0.79 for the radiometer above the canopy and 0.74 for the radiometer below the canopy. Under cold conditions when the soil was thawed (snow insulation) and the trees were frozen (below 0°C), TB at V-pol is negatively correlated with tree permittivity. The freezing tree contribution to
Structural Dynamics of Tropical Moist Forest Gaps
Hunter, Maria O.; Keller, Michael; Morton, Douglas; Cook, Bruce; Lefsky, Michael; Ducey, Mark; Saleska, Scott; de Oliveira, Raimundo Cosme; Schietti, Juliana
2015-01-01
Gap phase dynamics are the dominant mode of forest turnover in tropical forests. However, gap processes are infrequently studied at the landscape scale. Airborne lidar data offer detailed information on three-dimensional forest structure, providing a means to characterize fine-scale (1 m) processes in tropical forests over large areas. Lidar-based estimates of forest structure (top down) differ from traditional field measurements (bottom up), and necessitate clear-cut definitions unencumbered by the wisdom of a field observer. We offer a new definition of a forest gap that is driven by forest dynamics and consistent with precise ranging measurements from airborne lidar data and tall, multi-layered tropical forest structure. We used 1000 ha of multi-temporal lidar data (2008, 2012) at two sites, the Tapajos National Forest and Ducke Reserve, to study gap dynamics in the Brazilian Amazon. Here, we identified dynamic gaps as contiguous areas of significant growth, that correspond to areas > 10 m2, with height gap at Tapajos National Forest (4.8 %) as compared to Ducke Reserve (2.0 %). On average, gaps were smaller at Ducke Reserve and closed slightly more rapidly, with estimated height gains of 1.2 m y-1 versus 1.1 m y-1 at Tapajos. At the Tapajos site, height growth in gap centers was greater than the average height gain in gaps (1.3 m y-1 versus 1.1 m y-1). Rates of height growth between lidar acquisitions reflect the interplay between gap edge mortality, horizontal ingrowth and gap size at the two sites. We estimated that approximately 10 % of gap area closed via horizontal ingrowth at Ducke Reserve as opposed to 6 % at Tapajos National Forest. Height loss (interpreted as repeat damage and/or mortality) and horizontal ingrowth accounted for similar proportions of gap area at Ducke Reserve (13 % and 10 %, respectively). At Tapajos, height loss had a much stronger signal (23 % versus 6 %) within gaps. Both sites demonstrate limited gap contagiousness defined by an
Creed, Irena F; Spargo, Adam T; Jones, Julia A; Buttle, Jim M; Adams, Mary B; Beall, Fred D; Booth, Eric G; Campbell, John L; Clow, Dave; Elder, Kelly; Green, Mark B; Grimm, Nancy B; Miniat, Chelcy; Ramlal, Patricia; Saha, Amartya; Sebestyen, Stephen; Spittlehouse, Dave; Sterling, Shannon; Williams, Mark W; Winkler, Rita; Yao, Huaxia
2014-01-01
Climate warming is projected to affect forest water yields but the effects are expected to vary. We investigated how forest type and age affect water yield resilience to climate warming. To answer this question, we examined the variability in historical water yields at long-term experimental catchments across Canada and the United States over 5-year cool and warm periods. Using the theoretical framework of the Budyko curve, we calculated the effects of climate warming on the annual partitioning of precipitation (P) into evapotranspiration (ET) and water yield. Deviation (d) was defined as a catchment's change in actual ET divided by P [AET/P; evaporative index (EI)] coincident with a shift from a cool to a warm period – a positive d indicates an upward shift in EI and smaller than expected water yields, and a negative d indicates a downward shift in EI and larger than expected water yields. Elasticity was defined as the ratio of interannual variation in potential ET divided by P (PET/P; dryness index) to interannual variation in the EI – high elasticity indicates low d despite large range in drying index (i.e., resilient water yields), low elasticity indicates high d despite small range in drying index (i.e., nonresilient water yields). Although the data needed to fully evaluate ecosystems based on these metrics are limited, we were able to identify some characteristics of response among forest types. Alpine sites showed the greatest sensitivity to climate warming with any warming leading to increased water yields. Conifer forests included catchments with lowest elasticity and stable to larger water yields. Deciduous forests included catchments with intermediate elasticity and stable to smaller water yields. Mixed coniferous/deciduous forests included catchments with highest elasticity and stable water yields. Forest type appeared to influence the resilience of catchment water yields to climate warming, with conifer and deciduous catchments more susceptible to
Management impacts on forest floor and soil organic carbon in northern temperate forests of the US
Coeli M. Hoover
2011-01-01
The role of forests in the global carbon cycle has been the subject of a great deal of research recently, but the impact of management practices on forest soil dynamics at the stand level has received less attention. This study used six forest management experimental sites in five northern states of the US to investigate the effects of silvicultural treatments (light...
Directory of Open Access Journals (Sweden)
Matić Branislava I.
2017-01-01
Full Text Available Mining and mineral processing is still a vital source of income in Serbia, due to mineral abundance in copper, lead, zinc, antimony. Copper mining and metal-processing are located in the east: Bor, Veliki Krivelj, Cerovo, Majdanpek. Abandoned sites from antimony mining and processing and secondary lead smelter are at the western border: Zajača, Krupanj, Stolice. Coal mining and power plants are surrounding Belgrade: Obrenovac (2 power plants, Grabovac (plant ash landfill, Kolubara and Kostolac. Main objective is to focus on potential public health hazards from industrial contamination in Serbia. Key public health issue is presence of As and Cd in ambient air PM10 close to industrially contaminated sites due to the fact that ores have high naturally occurring contents of heavy metals and metalloids. Data originate from Serbian Environmental Protection Agency, Mining and Metallurgy Institute Bor, Belgrade Institute of Public Health, as part of continuous measurement of air quality within State network of automatic stations. Concentration of As in PM10 are extremely above the limit value in Bor and Lazarevac, with Cd values slightly increased in Bor. Serbia lacks the legal framework for continuous and institutionalized follow-up of population groups vulnerable to hazardous environmental exposure, although measured concentration indicate urgent need for such activities.
Complementary models of tree species-soil relationships in old-growth temperate forests
Cross, Alison; Perakis, Steven S.
2011-01-01
Ecosystem level studies identify plant soil feed backs as important controls on soil nutrient availability,particularly for nitrogen and phosphorus. Although site and species specific studies of tree species soil relationships are relatively common,comparatively fewer studies consider multiple coexisting speciesin old-growth forests across a range of sites that vary underlying soil fertility. We characterized patterns in forest floor and mineral soil nutrients associated with four common tree species across eight undisturbed old-growth forests in Oregon, USA, and used two complementary conceptual models to assess tree species soil relationships. Plant soil feedbacks that could reinforce sitelevel differences in nutrient availability were assessed using the context dependent relationships model, where by relative species based differences in each soil nutrient divergedorconvergedas nutrient status changed across sites. Tree species soil relationships that did not reflect strong feedbacks were evaluated using a site independent relationships model, where by forest floor and surface mineral soil nutrient tools differed consistently by tree species across sites,without variation in deeper mineral soils. We found that theorganically cycled elements carbon, nitrogen, and phosphorus exhibited context-dependent differences among species in both forest floor and mineral soil, and most of ten followed adivergence model,where by species differences were greatest at high-nutrient sites. These patterns are consistent with the oryemphasizing biotic control of these elements through plant soil feedback mechanisms. Site independent species differences were strongest for pool so if the weather able cations calcium, magnesium, potassium,as well as phosphorus, in mineral soils. Site independent species differences in forest floor nutrients we reattributable too nespecies that displayed significant greater forest floor mass accumulation. Our finding confirmed that site-independent and
Soil carbon storage following road removal and timber harvesting in redwood forests
Seney, Joseph; Madej, Mary Ann
2015-01-01
Soil carbon storage plays a key role in the global carbon cycle and is important for sustaining forest productivity. Removal of unpaved forest roads has the potential for increasing carbon storage in soils on forested terrain as treated sites revegetate and soil properties improve on the previously compacted road surfaces. We compared soil organic carbon (SOC) content at several depths on treated roads to SOC in adjacent second-growth forests and old-growth redwood forests in California, determined whether SOC in the upper 50 cm of soil varies with the type of road treatment, and assessed the relative importance of site-scale and landscape-scale variables in predicting SOC accumulation in treated road prisms and second-growth redwood forests. Soils were sampled at 5, 20, and 50 cm depths on roads treated by two methods (decommissioning and full recontouring), and in adjacent second-growth and old-growth forests in north coastal California. Road treatments spanned a period of 32 years, and covered a range of geomorphic and vegetative conditions. SOC decreased with depth at all sites. Treated roads on convex sites exhibited higher SOC than on concave sites, and north aspect sites had higher SOC than south aspect sites. SOC at 5, 20, and 50 cm depths did not differ significantly between decommissioned roads (treated 18–32 years previous) and fully recontoured roads (treated 2–12 years previous). Nevertheless, stepwise multiple regression models project higher SOC developing on fully recontoured roads in the next few decades. The best predictors for SOC on treated roads and in second-growth forest incorporated aspect, vegetation type, soil depth, lithology, distance from the ocean, years since road treatment (for the road model) and years since harvest (for the forest model). The road model explained 48% of the variation in SOC in the upper 50 cm of mineral soils and the forest model, 54%
Insights on Forest Structure and Composition from Long-Term Research in the Luquillo Mountains
Directory of Open Access Journals (Sweden)
Tamara Heartsill Scalley
2017-06-01
Full Text Available The science of ecology fundamentally aims to understand species and their relation to the environment. At sites where hurricane disturbance is part of the environmental context, permanent forest plots are critical to understand ecological vegetation dynamics through time. An overview of forest structure and species composition from two of the longest continuously measured tropical forest plots is presented. Long-term measurements, 72 years at the leeward site, and 25 years at windward site, of stem density are similar to initial and pre-hurricane values at both sites. For 10 years post-hurricane Hugo (1989, stem density increased at both sites. Following that increase period, stem density has remained at 1400 to 1600 stems/ha in the leeward site, and at 1200 stems/ha in the windward site. The forests had similar basal area values before hurricane Hugo in 1989, but these sites are following different patterns of basal area accumulation. The leeward forest site continues to accumulate and increase basal area with each successive measurement, currently above 50 m2/ha. The windward forest site maintains its basal area values close to an asymptote of 35 m2/ha. Currently, the most abundant species at both sites is the sierra palm. Ordinations to explore variation in tree species composition through time present the leeward site with a trajectory of directional change, while at the windward site, the composition of species seems to be converging to pre-hurricane conditions. The observed differences in forest structure and composition from sites differently affected by hurricane disturbance provide insight into how particular forest characteristics respond at shorter or longer time scales in relation to previous site conditions and intensity of disturbance effects.
Ozkan, Kürsad; Gulsoy, Serkan; Aerts, Raf; Muys, Bart
2010-01-01
We explored the semi-natural forests in south western Anatolia along a gradient between Mediterranean and continental climates to determine the site requirements of Juniperus excelsa in Turkey. We hypothesized that environmental variables and indicator species can be used to predict differences in occurrence and cover of J. excelsa and can therefore support decision making in reforestation management planning. Plant species composition and environmental variables were assessed in 153 plots. Association between J. excelsa and other plant species and environmental variables were analyzed using Fisher exact probability tests and stepwise discriminant analysis. High altitude (> 1000 m) as a proxy for an Oromediterranean climate, and high surface stoniness as a proxy for low competition by other tree species, are positive site properties for J. excelsa. The tree species avoids Eumediterranean and Supramediterranean plant communities. Twelve plant species, including the herbs Dianthus zonatus, Ajuga chamaepitys and Paronchia carica and the shrub Cotoneaster nummularia may be used as site indicators for J. excelsa restoration. Platanus orientalis, with similar site requirements but at present negatively associated to J. excelsa due to competitive effects, may be considered an additional indicator if stand conversion (harvesting and replacing P. orientalis) is part of the management plan.
US Forest Service experimental forests and ranges: an untapped resource for social science
Susan Charnley; Lee K. Cerveny
2011-01-01
For a century, US Forest Service experimental forests and ranges (EFRs) have been a resource for scientists conducting long-term research relating to forestry and range management social science research has been limited, despite the history of occupation and current use of these sites for activities ranging from resource extraction and recreation to public education....
Karyn S. Rodkey; Donald J. Kaczmarek; Phillip E. Pope
1995-01-01
The forest floor plays a major role in the storage and recycling of nutrients which, in turn, are important in maintaining the growth and productivity of forest ecosystems. The development of forest floor organic layers as influenced by litter quality and site quality is unclear. Previous studies in this lab have shown that the size and distribution of available...
Biomass resilience of Neotropical secondary forests.
Poorter, Lourens; Bongers, Frans; Aide, T Mitchell; Almeyda Zambrano, Angélica M; Balvanera, Patricia; Becknell, Justin M; Boukili, Vanessa; Brancalion, Pedro H S; Broadbent, Eben N; Chazdon, Robin L; Craven, Dylan; de Almeida-Cortez, Jarcilene S; Cabral, George A L; de Jong, Ben H J; Denslow, Julie S; Dent, Daisy H; DeWalt, Saara J; Dupuy, Juan M; Durán, Sandra M; Espírito-Santo, Mario M; Fandino, María C; César, Ricardo G; Hall, Jefferson S; Hernandez-Stefanoni, José Luis; Jakovac, Catarina C; Junqueira, André B; Kennard, Deborah; Letcher, Susan G; Licona, Juan-Carlos; Lohbeck, Madelon; Marín-Spiotta, Erika; Martínez-Ramos, Miguel; Massoca, Paulo; Meave, Jorge A; Mesquita, Rita; Mora, Francisco; Muñoz, Rodrigo; Muscarella, Robert; Nunes, Yule R F; Ochoa-Gaona, Susana; de Oliveira, Alexandre A; Orihuela-Belmonte, Edith; Peña-Claros, Marielos; Pérez-García, Eduardo A; Piotto, Daniel; Powers, Jennifer S; Rodríguez-Velázquez, Jorge; Romero-Pérez, I Eunice; Ruíz, Jorge; Saldarriaga, Juan G; Sanchez-Azofeifa, Arturo; Schwartz, Naomi B; Steininger, Marc K; Swenson, Nathan G; Toledo, Marisol; Uriarte, Maria; van Breugel, Michiel; van der Wal, Hans; Veloso, Maria D M; Vester, Hans F M; Vicentini, Alberto; Vieira, Ima C G; Bentos, Tony Vizcarra; Williamson, G Bruce; Rozendaal, Danaë M A
2016-02-11
Land-use change occurs nowhere more rapidly than in the tropics, where the imbalance between deforestation and forest regrowth has large consequences for the global carbon cycle. However, considerable uncertainty remains about the rate of biomass recovery in secondary forests, and how these rates are influenced by climate, landscape, and prior land use. Here we analyse aboveground biomass recovery during secondary succession in 45 forest sites and about 1,500 forest plots covering the major environmental gradients in the Neotropics. The studied secondary forests are highly productive and resilient. Aboveground biomass recovery after 20 years was on average 122 megagrams per hectare (Mg ha(-1)), corresponding to a net carbon uptake of 3.05 Mg C ha(-1) yr(-1), 11 times the uptake rate of old-growth forests. Aboveground biomass stocks took a median time of 66 years to recover to 90% of old-growth values. Aboveground biomass recovery after 20 years varied 11.3-fold (from 20 to 225 Mg ha(-1)) across sites, and this recovery increased with water availability (higher local rainfall and lower climatic water deficit). We present a biomass recovery map of Latin America, which illustrates geographical and climatic variation in carbon sequestration potential during forest regrowth. The map will support policies to minimize forest loss in areas where biomass resilience is naturally low (such as seasonally dry forest regions) and promote forest regeneration and restoration in humid tropical lowland areas with high biomass resilience.
Operationalizing measurement of forest degradation
DEFF Research Database (Denmark)
Dons, Klaus; Smith-Hall, Carsten; Meilby, Henrik
2015-01-01
. In Tanzania, charcoal production is considered a major cause of forest degradation, but is challenging to quantify due to sub-canopy biomass loss, remote production sites and illegal trade. We studied two charcoal production sites in dry Miombo woodland representing open woodland conditions near human......Quantification of forest degradation in monitoring and reporting as well as in historic baselines is among the most challenging tasks in national REDD+ strategies. However, a recently introduced option is to base monitoring systems on subnational conditions such as prevalent degradation activities...
Energy Technology Data Exchange (ETDEWEB)
Murl, Jeffrey [USDOE Office of Legacy Management, Washington, DC (United States); Miller, Michele [Navarro Research and Engineering, Oak Ridge, TN (United States)
2016-07-01
The Site A/Plot M, Illinois, Decommissioned Reactor Site was inspected on May 17, 2016. The site, located within Cook County forest preserve that is open to the public, was found to be in good condition with one exception. Erosion on top of the grass-covered mound at Plot M continues to be a concern as presented in previous inspections. Ruts form in the soil on top of Plot M as a result of bike traffic using the open field as a pass thru between established bike trails within the forest preserve. Argonne National Laboratory (ANL) who is contracted directly from U.S. Department of Energy (DOE) has filled in the ruts with top soil and reseeding remains an ongoing process. Reseeded areas from 2015 are progressing nicely. No cause for a follow-up inspection was identified. In 2015, ANL plugged and abandoned 8 of 25 monitoring wells (BH41, BH51, BH52, BH54, DH9, DH10, DH13, and DH17). The 17 groundwater monitoring wells remaining at the site were inspected to confirm that they were locked and in good condition. Preliminary environmental monitoring results for 2015 are provided in a draft report titled Surveillance of Site A and Plot M, Report for 2015, prepared by ANL. The report also contains results of an independent analysis conducted by the Illinois Emergency Management Agency on some of the samples collected by ANL in 2015. The draft report states that the results of the surveillance program continue to indicate that the impact of radioactivity at Site A/Plot M is very low and does not endanger the health of those living in the area or visiting the site. The ANL monitoring report will be made available to the public on the DOE Office of Legacy Management public website when it is issued as final. A new county forest preserve campsite opened in 2015 at Bull Frog Lake, which is east of Plot M. Hiking trails connect Bull Frog Lake with Site A/Plot M. The site might receive more traffic from forest preserve visitors now that this new campsite is opened.
Securing tropical forest carbon
DEFF Research Database (Denmark)
Scharlemann, Jörn P. W.; Kapos, Valerie; Campbell, Alison
2010-01-01
Forest loss and degradation in the tropics contribute 6-17% of all greenhouse gas emissions. Protected areas cover 217.2 million ha (19.6%) of the world's humid tropical forests and contain c. 70.3 petagrams of carbon (Pg C) in biomass and soil to 1 m depth. Between 2000 and 2005, we estimate...... that 1.75 million ha of forest were lost from protected areas in humid tropical forests, causing the emission of 0.25-0.33 Pg C. Protected areas lost about half as much carbon as the same area of unprotected forest. We estimate that the reduction of these carbon emissions from ongoing deforestation...... in protected sites in humid tropical forests could be valued at USD 6,200-7,400 million depending on the land use after clearance. This is >1.5 times the estimated spending on protected area management in these regions. Improving management of protected areas to retain forest cover better may be an important...
Louis R. Iverson; Martin E. Dale; Charles T. Scott; Anantha Prasad; Anantha Prasad
1997-01-01
A geographic information system (GIS) approach was used in conjunction with forest-plot data to develop an integrated moisture index (IMI), which was then used to predict forest productivity (site index) and species composition for forests in Ohio. In this region, typical of eastern hardwoods across the Midwest and southern Appalachians, topographic aspect and position...
Nitrogen in soil water at five nitrogen-enriched forest sites in Sweden
International Nuclear Information System (INIS)
Ring, Eva
2001-01-01
Increased inputs of N to forest land may increase acidification and eutrophication. This thesis deals with N in soil water at 50 cm depth in N-enriched coniferous forests in Sweden. The experimental sites were enriched in N, either by fertilization or deposition. Soil water was collected by suction cups at varying degrees of N enrichment, after clear felling at two sites in central (Billingsjoen) and S Sweden (Farabol), and in three closely situated Norway spruce stands in SW Sweden. Billingsjoen was fertilized with ammonium nitrate at totals of 360-1800 kg N ha -1 , and Farabol with urea at totals of 600 kg N ha -1 . At clearfelling, which was performed six and seven years after the last fertilization, the soil N storage was increased by fertilization at Billingsjoen but not at Farabol. At Billingsjoen, the soil-water concentration of nitrate increased with increasing N dose. The increased nitrate concentrations reduced pH by up to nearly two units. In the eighth year after clear felling, the effects on all major cations and anions in the control, the 360 and 1800 kg N ha -1 treatments were examined. At the high N dose, nitrate and aluminium had significantly increased, and the pH and acid-neutralizing capacity had decreased, compared with the control and the low N dose. At Farabol, the estimated total leaching of nitrate-N in the control surpassed that of the N treatment by approximately 40%. The difference in leaching appears attributable to the greater biomass and N storage of the field-layer vegetation in the N treatment than in the control. At Farabol, the field-layer vegetation seems to have acted as an important sink for N as opposed to the Billingsjoen clearcut where the field layer was sparse. The Norway spruce stands in SW Sweden had a similar N deposition, but the concentrations of nitrate in soil water and estimated leaching rates differed substantially. In the soil with the highest leaching rate, potential nitrification was largest and the C to N
Reproductive success of Cabralea canjerana (Meliaceae in Atlantic forest fragments, Brazil
Directory of Open Access Journals (Sweden)
Edivani Villaron Franceschinelli
2015-06-01
Full Text Available In Brazil, the Atlantic forest remnants have high biological diversity and a high level of endemism, but very little is known about the reproductive success of native species. Cabralea canjerana is a common tree in the Montane Atlantic forest, and its reproduction is highly dependent on pollinators. In order to contribute with the particular knowledge on this species, we collected data in three fragmented and three continuous forest sites, where the effects of fragmentation on both mutualistic (pollination and antagonistic (seed predation interactions were analysed. We determined fruit production and weight of 25 trees per site. The number of seeds and the percentage of predated and aborted seeds were also accessed for seven fruits of 10 trees per site. Pollinator visitation frequencies to flowers were recorded in two forest fragments and in two sites of the continuous forest. Our data showed that plants of C. canjerana produced more fruits (z-value=-8.24; p<0.0001 and seeds per fruit (z-value=-6.58; p=0.002 in the continuous than in the fragmented sites. This was likely due to differences in pollination, because the number of pollinator visits was higher in the continuous forest than in the fragments. Seed abortion (z-value=4.08, p<0.001 and predation (z-value=3.72, p=0.0002, on the other hand, were higher in the fragmented than in the continuous sites. Then, mutualistic and antagonistic interactions were affected by fragmentation, decreasing the reproductive success of the study tree. This study was the first to show a decrease in the reproductive output in forest fragments in an Atlantic forest tree species. This decrease may threaten the population structure and viability of C. canjerana in forest fragments. Rev. Biol. Trop. 63 (2: 515-524. Epub 2015 June 01.
Andreasen, Mie; Jensen, Karsten H.; Desilets, Darin; Zreda, Marek; Bogena, Heye R.; Looms, Majken C.
2017-04-01
Cosmic-ray neutron intensity is inversely correlated to all hydrogen present in the upper decimeters of the subsurface and the first few hectometers of the atmosphere above the ground surface. This correlation forms the base of the cosmic-ray neutron soil moisture estimation method. The method is, however, complicated by the fact that several hydrogen pools other than soil moisture affect the neutron intensity. In order to improve the cosmic-ray neutron soil moisture estimation method and explore the potential for additional applications, knowledge about the environmental effect on cosmic-ray neutron intensity is essential (e.g., the effect of vegetation, litter layer and soil type). In this study the environmental effect is examined by performing a sensitivity analysis using neutron transport modeling. We use a neutron transport model with various representations of the forest and different parameters describing the subsurface to match measured height profiles and time series of thermal and epithermal neutron intensities at a field site in Denmark. Overall, modeled thermal and epithermal neutron intensities are in satisfactory agreement with measurements; however, the choice of forest canopy conceptualization is found to be significant. Modeling results show that the effect of canopy interception, soil chemistry and dry bulk density of litter and mineral soil on neutron intensity is small. On the other hand, the neutron intensity decreases significantly with added litter-layer thickness, especially for epithermal neutron energies. Forest biomass also has a significant influence on the neutron intensity height profiles at the examined field site, altering both the shape of the profiles and the ground-level thermal-to-epithermal neutron ratio. This ratio increases with increasing amounts of biomass, and was confirmed by measurements from three sites representing agricultural, heathland and forest land cover. A much smaller effect of canopy interception on the ground
Directory of Open Access Journals (Sweden)
Seth Kane
2018-04-01
Full Text Available Implementation of Reducing Emissions from Deforestation and Forest Degradation (REDD+ is designed to relieve pressure on tropical forests, however, many are concerned that it is a threat to the rights of forest communities. These potential risks need serious attention as earlier studies have shown that the Asia-Pacific region is a forest conflict hotspot, with many economic, environmental and social implications at global (e.g. climate change to local levels (e.g. poverty. Drawing on an analysis of nine case studies from four countries (Cambodia, Myanmar, Nepal and Vietnam this paper examines why and how REDD+ can be a driver for forest conflict and how it also has the potential to simultaneously transform these conflicts. The analytical framework, “sources of impairment”, applied in the study was developed to increase understanding and facilitate the resolution of forest landscape conflicts in a sustainable manner (i.e. transformation. The main findings are that REDD+ can be a source of conflict in the study sites, but also had transformative potential when good practices were followed. For example, in some sites, the REDD+ projects were sources of impairment for forest communities by restricting access to forest resources. However, the research also identified REDD+ projects that enabled the participation of traditionally marginalized groups and built local forest management capacities, leading to strengthened tenure for some forest communities. Similarly, in some countries REDD+ has served as a mechanism to pilot Free, Prior and Informed Consent (FPIC, which will likely have significant impacts in mitigating conflicts by addressing the sources at local to national levels. Based on these findings, there are many reasons to be optimistic that REDD+ can address the underlying causes of forest landscape conflicts, especially when linked with other governance initiatives such as Forest Law Enforcement, Governance and Trade – Voluntary
International Nuclear Information System (INIS)
Prinz, B.; Koeth, I.; Krause, G.H.M.; Thiele, V.
1989-01-01
In 1984 Northrhine Westfalia established a research program 'Air Pollution and Forest Decline'. Results of various experiments, carried out on the level of 1. epidemiological observations, 2. semi-controlled experiments in open-to-chambers as well as 3. controlled fumigation experiments are presented as an overview. Emphasis is put on field experiments at the regional research site Eggegebirge/Velmerstot, where the Landesanstalt fuer Immissionsschutz analysed among others yearly nutrient cycling and leaching phenomena of injured and healthy spruce trees (type: montanious yellowing). Deposition measurements were carried on a horizontal and vertical trajectory outside and inside a young spruce stand. Preliminary results showed that atmospheric acidic deposition accounts only for 1/3 of the acidification of the soil within the stand, where acidification processes are most prevalent. (orig.) [de
Effectiveness of community forestry in Prey Long forest, Cambodia.
Lambrick, Frances H; Brown, Nick D; Lawrence, Anna; Bebber, Daniel P
2014-04-01
Cambodia has 57% forest cover, the second highest in the Greater Mekong region, and a high deforestation rate (1.2%/year, 2005-2010). Community forestry (CF) has been proposed as a way to reduce deforestation and support livelihoods through local management of forests. CF is expanding rapidly in Cambodia. The National Forests Program aims to designate one million hectares of forest to CF by 2030. However, the effectiveness of CF in conservation is not clear due to a global lack of controlled comparisons, multiple meanings of CF, and the context-specific nature of CF implementation. We assessed the effectiveness of CF by comparing 9 CF sites with paired controls in state production forest in the area of Prey Long forest, Cambodia. We assessed forest condition in 18-20 randomly placed variable-radius plots and fixed-area regeneration plots. We surveyed 10% of households in each of the 9 CF villages to determine the proportion that used forest products, as a measure of household dependence on the forest. CF sites had fewer signs of anthropogenic damage (cut stems, stumps, and burned trees), higher aboveground biomass, more regenerating stems, and reduced canopy openness than control areas. Abundance of economically valuable species, however, was higher in control sites. We used survey results and geographic parameters to model factors affecting CF outcomes. Interaction between management type, CF or control, and forest dependence indicated that CF was more effective in cases where the community relied on forest products for subsistence use and income. © 2014 Society for Conservation Biology.
R.K. Dumroese; D.F. Jacobs; T.D. Landis
2005-01-01
Forest regeneration is a cyclic operation. Seeds are collected from mature trees and planted in nurseries so that the resulting seedlings can be outplanted to the forest after the mature trees are harvested. Similarly, the process of deciding upon, and growing, the best seedlings for that site should be a cyclic process between foresters and nursery managers. The ideal...
Public Preferences Across Europe for Different Forest Stand Types as Sites for Recreation
Directory of Open Access Journals (Sweden)
David M. Edwards
2012-03-01
Full Text Available A Delphi survey involving experts in forest preference research was carried out to derive scores for the recreational value of 240 forest stand types across Europe. The survey was organized around four regional panels: Great Britain, Nordic Region, Central Europe, and Iberia. In each region, 60 forest stand types were defined according to five forest management alternatives (FMAs on a continuum of management intensity, four phases of development (establishment, young, medium, and adult, and three tree species types (conifer, broadleaved, and mixed stands of conifer and broadleaved. The resulting scores were examined using conjoint analysis to determine the relative importance of the three structural attributes (FMA, phase of development, and tree species type, and each level or component of the attributes. The findings quantify the extent to which forest visitors prefer a degree of management to unmanaged forest nature reserves across the four regions. Phase of development was shown to make the highest contribution to the recreational value of forests while the contribution of tree species type was shown to be relatively unimportant. While the results are indicative, they provide evidence to support long-term retention and low-impact silviculture in forests where recreation is a primary objective of management.
Effects of forest fires in southern and central of Zabaykal region
Directory of Open Access Journals (Sweden)
L. V. Buryak
2016-12-01
Full Text Available The fire frequency situation in Zabaykal region from 1964 to 2015 is evaluated and discussed in the paper. The main reasons of decadal increase of fire numbers and the area burned are revealed. The main reasons of high fire frequency and the increase of fire activity in the last decades are shown. The characteristics of the weather conditions in the years of high fire frequency are presented. Fire activity was found to increase not only because of the droughts in the last decades but also due to forest disturbances in Zabaykalsky Krai by illegal logging. Based on the data from 170 sample sites laid out with the use of satellite images, forest inventory data and results of ground sample transects, the impact of the wildfires of different type, form and severity on tree mortality in the light-coniferous forests was estimated, as well as the amount of tree regeneration in the forest areas disturbed by fires, logged sites (both burned and unburned, and sites burned repeatedly was evaluated. Wildfires in the Zabaykal region were found to be strong ecological factor influencing on the probability of existence of many forest ecosystems. In case of further climate warming and repeated fires, the part of the forests may transform to the non forest areas. The steppification of the burned sites in the southern forest-steppe regions and in the low parts of the southern slopes at the border with steppe landscapes as well as desertification in the central parts of the region and swamping of burned sites located in the wet soils are observed. Wind and water soil erosion happens at the large burned sites.
Atmospheric mercury deposition to forests in the eastern USA
International Nuclear Information System (INIS)
Risch, Martin R.; DeWild, John F.; Gay, David A.; Zhang, Leiming; Boyer, Elizabeth W.; Krabbenhoft, David P.
2017-01-01
Atmospheric mercury (Hg) deposition to forests is important because half of the land cover in the eastern USA is forest. Mercury was measured in autumn litterfall and weekly precipitation samples at a total of 27 National Atmospheric Deposition Program (NADP) monitoring sites in deciduous and mixed deciduous-coniferous forests in 16 states in the eastern USA during 2007–2014. These simultaneous, uniform, repeated, annual measurements of forest Hg include the broadest area and longest time frame to date. The autumn litterfall-Hg concentrations and litterfall mass at the study sites each year were combined with annual precipitation-Hg data. Rates of litterfall-Hg deposition were higher than or equal to precipitation-Hg deposition rates in 70% of the annual data, which indicates a substantial contribution from litterfall to total atmospheric-Hg deposition. Annual litterfall-Hg deposition in this study had a median of 11.7 μg per square meter per year (μg/m 2 /yr) and ranged from 2.2 to 23.4 μg/m 2 /yr. It closely matched modeled dry-Hg deposition, based on land cover at selected NADP Hg-monitoring sites. Mean annual atmospheric-Hg deposition at forest study sites exhibited a spatial pattern partly explained by statistical differences among five forest-cover types and related to the mapped density of Hg emissions. Forest canopies apparently recorded changes in atmospheric-Hg concentrations over time because litterfall-Hg concentrations decreased year to year and litterfall-Hg concentrations were significantly higher in 2007–2009 than in 2012–2014. These findings reinforce reported decreases in Hg emissions and atmospheric elemental-Hg concentrations during this same time period. Methylmercury (MeHg) was detected in all litterfall samples at all sites, compared with MeHg detections in less than half the precipitation samples at selected sites during the study. These results indicate MeHg in litterfall is a pathway into the terrestrial food web where it can
Boreal Forests of Kamchatka: Structure and Composition
Directory of Open Access Journals (Sweden)
Markus P. Eichhorn
2010-09-01
Full Text Available Central Kamchatka abounds in virgin old-growth boreal forest, formed primarily by Larix cajanderi and Betula platyphylla in varying proportions. A series of eight 0.25–0.30 ha plots captured the range of forests present in this region and their structure is described. Overall trends in both uplands and lowlands are for higher sites to be dominated by L. cajanderi with an increasing component of B. platyphylla with decreasing altitude. The tree line on wet sites is commonly formed by mono-dominant B. ermanii forests. Basal area ranged from 7.8–38.1 m2/ha and average tree height from 8.3–24.7 m, both being greater in lowland forests. Size distributions varied considerably among plots, though they were consistently more even for L. cajanderi than B. platyphylla. Upland sites also contained a dense subcanopy of Pinus pumila averaging 38% of ground area. Soil characteristics differed among plots, with upland soils being of lower pH and containing more carbon. Comparisons are drawn with boreal forests elsewhere and the main current threats assessed. These forests provide a potential baseline to contrast with more disturbed regions elsewhere in the world and therefore may be used as a target for restoration efforts or to assess the effects of climate change independent of human impacts.
Berner, Logan T.; Law, Beverly E.
2016-01-01
Plant trait measurements are needed for evaluating ecological responses to environmental conditions and for ecosystem process model development, parameterization, and testing. We present a standardized dataset integrating measurements from projects conducted by the Terrestrial Ecosystem Research and Regional Analysis- Pacific Northwest (TERRA-PNW) research group between 1999 and 2014 across Oregon and Northern California, where measurements were collected for scaling and modeling regional terrestrial carbon processes with models such as Biome-BGC and the Community Land Model. The dataset contains measurements of specific leaf area, leaf longevity, leaf carbon and nitrogen for 35 tree and shrub species derived from more than 1,200 branch samples collected from over 200 forest plots, including several AmeriFlux sites. The dataset also contains plot-level measurements of forest composition, structure (e.g., tree biomass), and productivity, as well as measurements of soil structure (e.g., bulk density) and chemistry (e.g., carbon). Publically-archiving regional datasets of standardized, co-located, and geo-referenced plant trait measurements will advance the ability of earth system models to capture species-level climate sensitivity at regional to global scales.
Charles R. Blinn; Rick Dahlamn; James A. Mattson; Michael A. Thompson
1999-01-01
Various approaches are available to minimize impacts on forest productivity during forest road building and timber harvesting activities. These approaches include a variety of practices and technologies. They include practices such as reducing road and trail development, using designated trails, and leaving slash at the stump on nutrient deficient sites. Technology...
Leaching of nitrate from temperate forests - effects of air pollution and forest management
DEFF Research Database (Denmark)
Gundersen, Per; Schmidt, Inger Kappel; Raulund-Rasmussen, Karsten
2006-01-01
deposition (> 8-10 kg ha(-1) a(-1)). We synthesized the current understanding of factors controlling N leaching in relation to three primary causes of N cycle disruption: (i) Increased N input (air pollution, fertilization, N-2 fixing plants). In European forests, elevated N deposition explains approximately...... half of the variability in N leaching, some of the remaining variability could be explained by differences in N availability or "N status". For coniferous forests, needle N content above 1.4% and (or) forest floor C:N ratio lower than 25 were thresholds for elevated nitrate leaching. At adjacent sites...... conifer forests receive higher N deposition and exhibit higher nitrate loss than deciduous forests; an exception is alder that shows substantial nitrate leaching through N fixation input. Fertilization with N poses limited risk to water quality, when applied to N-limited forests. (ii) Reduced plant uptake...
ESTIMATION OF CARBON SEQUESTRATION BY RUSSIAN FORESTS: GEOSPATIAL ISSUE
Directory of Open Access Journals (Sweden)
N. V. Malysheva
2017-01-01
Full Text Available Сategories of carbon sequestration assessment for Russian forests are identified by GIS toolkit. Those are uniform by bioclimatic and site-specific conditions strata corresponding to modern version of bioclimatic forest district division. Stratification of forests at early stage substantially reduces the ambiguity of the evaluation because phytomass conversion sequestration capacity and expansion factor dependent on site-specific condition for calculating of forest carbon sink are absolutely necessary. Forest management units were linked to strata. Biomass conversion and expansion factor for forest carbon sink assessment linked to the strata were recalculated for forest management units. All operations were carried out with GIS analytical toolkit due to accessible functionalities. Units for forest carbon storage inventory and forest carbon balance calculation were localized. Production capacity parameters and forest carbon sequestration capacity have been visualized on maps complied by ArcGIS. Based on spatially-explicit information, we have found out that the greatest annual rates of forest’s carbon accumulation in Russian forests fall into mixed coniferous-deciduous forests of European-Ural part of Russia to Kaliningrad, Smolensk and Briansk Regions, coniferous-deciduous forests close to the boundary of Khabarovsk Region and Primorskij Kray in the Far East, as well as separate forest management units of Kabardino-Balkariya NorthCaucasian mountain area. The geospatial visualization of carbon sequestration by Russian forests and carbon balance assessment has been given.
Global demand for gold is another threat for tropical forests
International Nuclear Information System (INIS)
Alvarez-Berríos, Nora L; Mitchell Aide, T
2015-01-01
The current global gold rush, driven by increasing consumption in developing countries and uncertainty in financial markets, is an increasing threat for tropical ecosystems. Gold mining causes significant alteration to the environment, yet mining is often overlooked in deforestation analyses because it occupies relatively small areas. As a result, we lack a comprehensive assessment of the spatial extent of gold mining impacts on tropical forests. In this study, we provide a regional assessment of gold mining deforestation in the tropical moist forest biome of South America. Specifically, we analyzed the patterns of forest change in gold mining sites between 2001 and 2013, and evaluated the proximity of gold mining deforestation to protected areas (PAs). The forest cover maps were produced using the Land Mapper web application and images from the MODIS satellite MOD13Q1 vegetation indices 250 m product. Annual maps of forest cover were used to model the incremental change in forest in ∼1600 potential gold mining sites between 2001–2006 and 2007–2013. Approximately 1680 km 2 of tropical moist forest was lost in these mining sites between 2001 and 2013. Deforestation was significantly higher during the 2007–2013 period, and this was associated with the increase in global demand for gold after the international financial crisis. More than 90% of the deforestation occurred in four major hotspots: Guianan moist forest ecoregion (41%), Southwest Amazon moist forest ecoregion (28%), Tapajós–Xingú moist forest ecoregion (11%), and Magdalena Valley montane forest and Magdalena–Urabá moist forest ecoregions (9%). In addition, some of the more active zones of gold mining deforestation occurred inside or within 10 km of ∼32 PAs. There is an urgent need to understand the ecological and social impacts of gold mining because it is an important cause of deforestation in the most remote forests in South America, and the impacts, particularly in aquatic systems
Numerical modeling of the airflow around a forest edge using LiDAR-derived forest heigths
DEFF Research Database (Denmark)
Boudreault, Louis-Etienne; Dellwik, Ebba; Bechmann, Andreas
A 3D methodology to quantify the effect of forests on the mean wind flow field is presented. The methodology is based on the treatment of forest raw data of light detection and ranging (LiDAR) scans, and a computational fluid dynamics (CFD) method based on a Reynolds-averaged Navier-Stokes (Ra......NS) approach using the k−e turbulence model with a corresponding canopy model. The example site investigated is a forest edge located on the Falster island in Denmark, where a measurement campaign was conducted. The LiDAR scans are used in order to obtain the forest heights, which served as input...
Reducing biosolids disposal costs using land application in forested areas
International Nuclear Information System (INIS)
Huffines, R.L.
1995-01-01
Switching biosolids land application from a reclamation site to a forested site significantly reduced the cost of biosolids disposal at the Savannah River Site. Previous beneficial reuse programs focused on reclamation of existing borrow pits. While extremely beneficial, this program became very costly due to the regulatory requirements for groundwater monitoring, soil monitoring and frequent biosolids analyses. A new program was developed to reuse biosolids in forested areas where the biosolids could be used as a soil conditioner and fertilizer to enhance timber yield. The forested land application site was designed so that groundwater monitoring and soil monitoring could be eliminated while biosolids monitoring and site maintenance were minimized. Monitoring costs alone were reduced by 80%. Capital costs for site preparation were also significantly reduced since there was no longer a need for expensive groundwater monitoring wells
Alabama, 2012 - forest inventory and analysis factsheet
Andrew J. Hartsell
2013-01-01
These early surveys were not concerned with the forests, species, and tree sizes that were not considered commercially viable. Early surveys reported only on growing-stock trees on timberlands, i.e. commercially important tree species and tree sizes on forests that could sustain harvest operations. Currently, FIA reports on all of the forest lands regardless of site...
Monitoring and Modeling Carbon Dynamics at a Network of Intensive Sites in the USA and Mexico
Birdsey, R.; Wayson, C.; Johnson, K. D.; Pan, Y.; Angeles, G.; De Jong, B. H.; Andrade, J. L.; Dai, Z.
2013-05-01
The Forest Services of the USA and Mexico, supported by NASA and USAID, have begun to establish a network of intensive forest carbon monitoring sites. These sites are used for research and teaching, developing forest management practices, and forging links to the needs of communities. Several of the sites have installed eddy flux towers to basic meteorology data and daily estimates of forest carbon uptake and release, the processes that determine forest growth. Field sampling locations at each site provide estimates of forest biomass and carbon stocks, and monitor forest dynamic processes such as growth and mortality rates. Remote sensing facilitates scaling up to the surrounding landscapes. The sites support information requirements for implementing programs such as Reducing Emissions from Deforestation and Forest Degradation (REDD+), enabling communities to receive payments for ecosystem services such as reduced carbon emissions or improved forest management. In addition to providing benchmark data for REDD+ projects, the sites are valuable for validating state and national estimates from satellite remote sensing and the national forest inventory. Data from the sites provide parameters for forest models that support strategic management analysis, and support student training and graduate projects. The intensive monitoring sites may be a model for other countries in Latin America. Coordination among sites in the USA, Mexico and other Latin American countries can ensure harmonization of approaches and data, and share experiences and knowledge among countries with emerging opportunities for implementing REDD+ and other conservation programs.
Forest report 2017; Waldzustandsbericht 2017
Energy Technology Data Exchange (ETDEWEB)
NONE
2017-07-01
This forest report of Lower Saxony (Germany) contains the following topics: Forestry Environment Monitoring (defoliation results of all tree species), weather and climate, insects and fungi, site information for the Federal Forest Inventory in Lower Saxony, infiltrated substances, development of soil acidification on intensive monitoring areas in northwestern Germany, and substrate group mottled sandstone.
Mike Hillis; Vick Applegate; Steve Slaughter; Michael G. Harrington; Helen Smith
2001-01-01
Forest Service land managers, with the collaborative assistance from research, applied a disturbance based restoration strategy to rehabilitate a greatly-altered, high risk Northern Rocky Mountain old-forest ponderosa pine-Douglas-fir stand. Age-class structure and fire history for the site have been documented in two research papers (Arno and others 1995, 1997)....
Migration and bioavailability of 137Cs in forest soil of southern Germany
International Nuclear Information System (INIS)
Konopleva, I.; Klemt, E.; Konoplev, A.; Zibold, G.
2009-01-01
To give a quantitative description of the radiocaesium soil-plant transfer for fern (Dryopteris carthusiana) and blackberry (Rubus fruticosus), physical and chemical properties of soils in spruce and mixed forest stands were investigated. Of special interest was the selective sorption of radiocaesium, which was determined by measuring the Radiocaesium Interception Potential (RIP). Forest soil and plants were taken at 10 locations of the Altdorfer Wald (5 sites in spruce forest and 5 sites in mixed forest). It was found that the bioavailability of radiocaesium in spruce forest was on average seven times higher than in mixed forest. It was shown that important factors determining the bioavailability of radiocaesium in forest soil were its exchangeability and the radiocaesium interception potential (RIP) of the soil. Low potassium concentration in soil solution of forest soils favors radiocaesium soil-plant transfer. Ammonium in forest soils plays an even more important role than potassium as a mobilizer of radiocaesium. The availability factor - a function of RIP, exchangeability and cationic composition of soil solution - characterized reliably the soil-plant transfer in both spruce and mixed forest. For highly organic soils in coniferous forest, radiocaesium sorption at regular exchange sites should be taken into account when its bioavailability is considered
Atmospheric mercury deposition to forests in the eastern USA.
Risch, Martin R; DeWild, John F; Gay, David A; Zhang, Leiming; Boyer, Elizabeth W; Krabbenhoft, David P
2017-09-01
Atmospheric mercury (Hg) deposition to forests is important because half of the land cover in the eastern USA is forest. Mercury was measured in autumn litterfall and weekly precipitation samples at a total of 27 National Atmospheric Deposition Program (NADP) monitoring sites in deciduous and mixed deciduous-coniferous forests in 16 states in the eastern USA during 2007-2014. These simultaneous, uniform, repeated, annual measurements of forest Hg include the broadest area and longest time frame to date. The autumn litterfall-Hg concentrations and litterfall mass at the study sites each year were combined with annual precipitation-Hg data. Rates of litterfall-Hg deposition were higher than or equal to precipitation-Hg deposition rates in 70% of the annual data, which indicates a substantial contribution from litterfall to total atmospheric-Hg deposition. Annual litterfall-Hg deposition in this study had a median of 11.7 μg per square meter per year (μg/m 2 /yr) and ranged from 2.2 to 23.4 μg/m 2 /yr. It closely matched modeled dry-Hg deposition, based on land cover at selected NADP Hg-monitoring sites. Mean annual atmospheric-Hg deposition at forest study sites exhibited a spatial pattern partly explained by statistical differences among five forest-cover types and related to the mapped density of Hg emissions. Forest canopies apparently recorded changes in atmospheric-Hg concentrations over time because litterfall-Hg concentrations decreased year to year and litterfall-Hg concentrations were significantly higher in 2007-2009 than in 2012-2014. These findings reinforce reported decreases in Hg emissions and atmospheric elemental-Hg concentrations during this same time period. Methylmercury (MeHg) was detected in all litterfall samples at all sites, compared with MeHg detections in less than half the precipitation samples at selected sites during the study. These results indicate MeHg in litterfall is a pathway into the terrestrial food web where it can
Trends in stream nitrogen concentrations for forested reference catchments across the USA
International Nuclear Information System (INIS)
Argerich, A; Greathouse, E; Johnson, S L; Sebestyen, S D; Rhoades, C C; Knoepp, J D; Adams, M B; Likens, G E; Campbell, J L; McDowell, W H; Scatena, F N; Ice, G G
2013-01-01
To examine whether stream nitrogen concentrations in forested reference catchments have changed over time and if patterns were consistent across the USA, we synthesized up to 44 yr of data collected from 22 catchments at seven USDA Forest Service Experimental Forests. Trends in stream nitrogen presented high spatial variability both among catchments at a site and among sites across the USA. We found both increasing and decreasing trends in monthly flow-weighted stream nitrate and ammonium concentrations. At a subset of the catchments, we found that the length and period of analysis influenced whether trends were positive, negative or non-significant. Trends also differed among neighboring catchments within several Experimental Forests, suggesting the importance of catchment-specific factors in determining nutrient exports. Over the longest time periods, trends were more consistent among catchments within sites, although there are fewer long-term records for analysis. These findings highlight the critical value of long-term, uninterrupted stream chemistry monitoring at a network of sites across the USA to elucidate patterns of change in nutrient concentrations at minimally disturbed forested sites. (letter)
Spatial and functional city structure with examples of Valjevo, Bor and Knjaževac
Directory of Open Access Journals (Sweden)
Spasić Nenad
2005-01-01
Full Text Available Cities represent such social environments which develop under the influence of their resource hinterland, yet at the same time they vigorously affect changes in their immediate or broader surroundings, depending on dynamics of city limits change. From city origins to the present day, interdependences between its spatial and functional structures can be noticed. Historical context plays a significant role in city development, both in terms of its spatial structure formation as well as in terms of development of city functions and territorial distribution of urban services. Spatial structure of a city is also defined by a set of geographical, economic, social functional and other features in their interdependency. Functional structure of a city depends on its size and position it takes in the functional distribution on a regional level as well as it is related to the functional capacity of a city. This paper analyses concrete examples of spatial and functional structures featuring three Serbian towns: Valjevo, Bor and Knjaževac. From the analysis of their common attributes in this respect, the following can be noticed: formation of the case study towns happened around inherited historical city cores, which even now perform a number of public functions; basic road networks significantly influenced formation of spatial patterns of these towns; spatial development of the towns in the last decade or so was slowed down because of economic and social stagnation, which didn't show major influence on change of spatial and functional structures of the towns involved.
Monitoring coniferous forest biomass change using a Landsat trajectory-based approach
Magdalena Main-Knorn; Warren B. Cohen; Robert E. Kennedy; Wojciech Grodzki; Dirk Pflugmacher; Patrick Griffiths; Patrick Hostert
2013-01-01
Forest biomass is a major store of carbon and thus plays an important role in the regional and global carbon cycle. Accurate forest carbon sequestration assessment requires estimation of both forest biomass and forest biomass dynamics over time. Forest dynamics are characterized by disturbances and recovery, key processes affecting site productivity and the forest...
[Effect of forest management on the herpetofauna of a temperate forest of western Oaxaca, Mexico].
Aldape-López, César Tonatiuh; Santos-Moreno, Antonio
2016-09-01
The development of silvicultural techniques has as main objective to maximize the production of timber, whereas at the same time minimize the impact generated during and after forest intervention in the local diversity. However, these activities change local climate, and this, in turn, alter the composition of natural communities. The effect of these changes may be greater in those taxonomic groups with high sensitivity to habitat disturbance, such as amphibians and reptiles, which are the unique terrestrial ectothermic vertebrates. The present study aims to know the differences in diversity of amphibians and reptiles in a temperate forest under two silvicultural treatments, one of low and the other of high intensity, as well as from one, five and ten years of regeneration since the last logging event, Sierra Sur of Oaxaca, Mexico. Records of 21 species of herpetofauna (six amphibians and 15 reptiles) were obtained. The total species richness was similar in both treatments; however, the composition varied between sites with different recovery times. Higher abundance of amphibian was presented on sites with the low-intensity treatment, while reptiles were more abundant at sites with intensive treatment. Compared to a mature forest without management, sites with intensive treatment have more rare species, although the values of true diversity of amphibians were similar between treatments with different intensities, while for reptiles sites under treatment showed less diversity that unmanaged site: 33 % for intensive treatment and 28 % at sites with low intensity with respect to one control site. Complementary Analysis showed a difference of 86 % between the compositions of species in sites with intensive treatment. The treatment intensity was associated with an increase in the number of species, but the way they respond to changes in habitat depends largely on the population characteristics of each species and its ability to adapt to new conditions.
Effects of national forest-management regimes on unprotected forests of the Himalaya.
Brandt, Jodi S; Allendorf, Teri; Radeloff, Volker; Brooks, Jeremy
2017-12-01
Globally, deforestation continues, and although protected areas effectively protect forests, the majority of forests are not in protected areas. Thus, how effective are different management regimes to avoid deforestation in non-protected forests? We sought to assess the effectiveness of different national forest-management regimes to safeguard forests outside protected areas. We compared 2000-2014 deforestation rates across the temperate forests of 5 countries in the Himalaya (Bhutan, Nepal, China, India, and Myanmar) of which 13% are protected. We reviewed the literature to characterize forest management regimes in each country and conducted a quasi-experimental analysis to measure differences in deforestation of unprotected forests among countries and states in India. Countries varied in both overarching forest-management goals and specific tenure arrangements and policies for unprotected forests, from policies emphasizing economic development to those focused on forest conservation. Deforestation rates differed up to 1.4% between countries, even after accounting for local determinants of deforestation, such as human population density, market access, and topography. The highest deforestation rates were associated with forest policies aimed at maximizing profits and unstable tenure regimes. Deforestation in national forest-management regimes that emphasized conservation and community management were relatively low. In India results were consistent with the national-level results. We interpreted our results in the context of the broader literature on decentralized, community-based natural resource management, and our findings emphasize that the type and quality of community-based forestry programs and the degree to which they are oriented toward sustainable use rather than economic development are important for forest protection. Our cross-national results are consistent with results from site- and regional-scale studies that show forest-management regimes that
Understanding forest-derived biomass supply with GIS modelling
DEFF Research Database (Denmark)
Hock, B. K.; Blomqvist, L.; Hall, P.
2012-01-01
distribution, and the cost of delivery as forests are frequently remote from energy users. A GIS-based model was developed to predict supply curves of forest biomass material for a site or group of sites, both now and in the future. The GIS biomass supply model was used to assist the New Zealand Energy...... Efficiency and Conservation Authority's development of a national target for biomass use for industrial heat production, to determine potential forest residue volumes for industrial heat and their delivery costs for 19 processing plants of the dairy company Fonterra, and towards investigating options...
Klap, J.M.; Reinds, G.J.; Bleeker, A.; Vries, de W.
2000-01-01
Site-specific estimations of meteorological stress and atmospheric deposition were made for the systematic 8 x 8 km2 forest condition monitoring network in Germany for the years 1987-1995. Winter cold and late frost were important temperature stress variables and relative transpiration was a good
The response of methane and nitrous oxide fluxes to forest change in Europe
Directory of Open Access Journals (Sweden)
P. Gundersen
2012-10-01
Full Text Available Forests in Europe are changing due to interactions between climate change, nitrogen (N deposition and new forest management practices. The concurrent impact on the forest greenhouse gas (GHG balance is at present difficult to predict due to a lack of knowledge on controlling factors of GHG fluxes and response to changes in these factors. To improve the mechanistic understanding of the ongoing changes, we studied the response of soil–atmosphere exchange of nitrous oxide (N2O and methane (CH4 at twelve experimental or natural gradient forest sites, representing anticipated future forest change. The experimental manipulations, one or more per site, included N addition (4 sites, changes of climate (temperature, 1 site; precipitation, 2 sites, soil hydrology (3 sites, harvest intensity (1 site, wood ash fertilisation (1 site, pH gradient in organic soil (1 site and afforestation of cropland (1 site.
On average, N2O emissions increased by 0.06 ± 0.03 (range 0–0.3 g N2O-N m−2 yr−1 across all treatments on mineral soils, but the increase was up to 10 times higher in an acidic organic soil. Soil moisture together with mineral soil C / N ratio and pH were found to significantly influence N2O emissions across all treatments. Emissions were increased by elevated N deposition, especially in interaction with increased soil moisture. High pH reduced the formation of N2O, even under otherwise favourable soil conditions.
Oxidation (uptake of CH4 was on average reduced from 0.16 ± 0.02 to 0.04 ± 0.05 g CH4-C m−2 yr−1 by the investigated treatments. The CH4 exchange was significantly influenced by soil moisture and soil C / N ratio across all treatments, and CH4 emissions occurred only in wet or water-saturated conditions.
For most of the investigated forest manipulations
Evaluating forest land development effects on private forestry in eastern Oregon.
Jeffrey D. Kline; David L. Azuma
2007-01-01
Research suggests that forest land development can reduce the productivity of remaining forest land because private forest owners reduce their investments in forest management. We developed empirical models describing forest stocking, thinning, harvest, and postharvest tree planting in eastern Oregon, as functions of stand and site characteristics, ownership, and...
Data base for early postfire succession in Northern Rocky Mountain forests
Peter F. Stickney; Robert B. Campbell
2000-01-01
Web site and CD-ROM include 21 pages of text plus electronic data for 55 succession sites including color plates, tables, and figures. Provides data on quantitative postfire changes of plant species and forest vegetation components for up to the first 25 years of secondary plant succession for 55 forest sites in northern Idaho and northwestern Montana. Cover (aerial...
Ecosystem Carbon Emissions from 2015 Forest Fires in Interior Alaska
Potter, Christopher S.
2018-01-01
In the summer of 2015, hundreds of wildfires burned across the state of Alaska, and consumed more than 1.6 million ha of boreal forest and wetlands in the Yukon-Koyukuk region. Mapping of 113 large wildfires using Landsat satellite images from before and after 2015 indicated that nearly 60% of this area was burned at moderate-to-high severity levels. Field measurements near the town of Tanana on the Yukon River were carried out in July of 2017 in both unburned and 2015 burned forested areas (nearly adjacent to one-another) to visually verify locations of different Landsat burn severity classes (low, moderate, or high). Results: Field measurements indicated that the loss of surface organic layers in boreal ecosystem fires is a major factor determining post-fire soil temperature changes, depth of thawing, and carbon losses from the mineral topsoil layer. Measurements in forest sites showed that soil temperature profiles to 30 cm depth at burned forest sites increased by an average of 8o - 10o C compared to unburned forest sites. Sampling and laboratory analysis indicated a 65% reduction in soil carbon content and a 58% reduction in soil nitrogen content in severely burned sample sites compared to soil mineral samples from nearby unburned spruce forests. Conclusions: Combined with nearly unprecedented forest areas severely burned in the Interior region of Alaska in 2015, total ecosystem fire emission of carbon to the atmosphere exceeded most previous estimates for the state.
Rebmann, Corinna; Claudia, Schütze; Sara, Marañón-Jiménez; Sebastian, Gimper; Matthias, Zink; Luis, Samaniego; Matthias, Cuntz
2017-04-01
The reduction of greenhouse gas (GHG) emissions and the optimization of Carbon sequestration by ecosystems have become priority objectives for current climate change policies. In this context, the long term research project TERENO and the research infrastructure ICOS have been established. The eddy covariance technique allows obtaining an integrative estimate of the ecosystem carbon, water and energy balances at the ecosystem level. The relative contributions of evaporation and transpiration as well as carbon sources and sinks need, however, to be determined separately for thorough process understanding. Two different ecosystem observatories have recently been established in the Magdeburger Börde: a deciduous forest (Hohes Holz) and a meadow (Grosses Bruch). A comprehensive system of instrumentation provides continuous data for the evaluation of energy, water and carbon fluxes at the 1500 ha large forest site, including a 50 m high eddy covariance (EC) tower for micrometeorological investigations in different heights above and below canopy, throughfall and stem flow sensors, a soil moisture and temperature sensor network, soil respiration chambers, sap flow sensors, and ancillary analysis of trees such a dendrometer and leaf area index measurements. Eddy covariance measurements allow the assessment of the carbon (Net Ecosystem Exchange, NEE) and water balance at the ecosystem scale. To better understand the contributing processes we partition water und carbon fluxes of the forest ecosystem by different methods. Tower-based data of NEE are therefore complemented and validated by continuous automatic and manual campaign measurements of soil effluxes and their drivers. Water fluxes into the ecosystem are partitioned by stem flow and throughfall measurements and a distributed soil moisture network. Gap fraction in the forest has a strong influence on the distribution on the water fluxes and is therefore determined on a regular basis. Since the establishment of the
Studying the processes of sodium-water interaction in the BOR-60 reactor micromodule steam generator
International Nuclear Information System (INIS)
Tsykanov, V.A.; Antipin, G.K.; Borisov, V.V.
1981-01-01
Main results of experimental studies of emergency regimes of micromodule steam generator (MSG) at small and big leaks of water into sodium, realized using the 30 MW MSG, operating in the BOR-o0 reactor, are considered. The aims of the study are as follows: the modelling of macroleak in ''Nadja'' steam generator for the BN-350 reactor; testing the conceptions of alarm signalling and MSG protection; testing under real conditions of new perspective systems of leak detection; gaining the experimence and development of the ways to eliminate the consequences of accident caused by big water leak into sodium; accumulation of knowledge on restoration of MSG operating ability after accident; experimental test of calculational techniques for big leak accidents to use them in future for calculational studies of similar situations at other reactors equipped with sodium-water steam generators; refinement of characteristics of hydrodynamic and thermal effects interaction zone for big leak in real circuit during the plant operation. A series of experiments with the imitation of water leak into sodium by means of argon and steam supply through injection devices, located before the steam superheater module of one of the sections and between evaporator module of the same section, is conducted. The range of steam flow rate is 0.02-0.45 g/s. Duration of steam supply is 100-400 s. A conclusion is made that the results obtained can be used for steam generator of the BN-350 reactor [ru
Johnny L. Boggs; Steven G. McNulty; Linda H. Pardo
2007-01-01
We evaluated foliar and forest floor chemistry across a gradient of N deposition in the Northeast at 11 red spruce (Picea rubens Sarg.) sites in 1987/1988 and foliar and forest floor chemistry and basal area growth at six paired spruce and deciduous sites in 1999. The six red spruce plots were a subset of the original 1987/1988 spruce sites. In 1999...
Culture phenomenon analysis on the forest tour activity of China
Institute of Scientific and Technical Information of China (English)
Jiang Minjin
2006-01-01
This paper analyzes culture and forest culture, the intension of culture and forest culture, combines the understanding of the main cultural factor with the forest tour activity of China, analyzes the compatible phenomenon of Chinese forest culture and traditional culture, and explores culture of forest tourist site containing the meaning in forest tour. The author thinks the tour of forest culture which will be the important component of forest tour in forest culture,This paper puts forward simple questions existing in exploitation and advantage of forest tour culture, and proposes some countermeasures.
Competition amplifies drought stress in forests across broad climatic and compositional gradients
Gleason, Kelly; Bradford, John B.; Bottero, Alessandra; D'Amato, Tony; Fraver, Shawn; Palik, Brian J.; Battaglia, Michael; Iverson, Louis R.; Kenefic, Laura; Kern, Christel C.
2017-01-01
Forests around the world are experiencing increasingly severe droughts and elevated competitive intensity due to increased tree density. However, the influence of interactions between drought and competition on forest growth remains poorly understood. Using a unique dataset of stand-scale dendrochronology sampled from 6405 trees, we quantified how annual growth of entire tree populations responds to drought and competition in eight, long-term (multi-decadal), experiments with replicated levels of density (e.g., competitive intensity) arrayed across a broad climatic and compositional gradient. Forest growth (cumulative individual tree growth within a stand) declined during drought, especially during more severe drought in drier climates. Forest growth declines were exacerbated by high density at all sites but one, particularly during periods of more severe drought. Surprisingly, the influence of forest density was persistent overall, but these density impacts were greater in the humid sites than in more arid sites. Significant density impacts occurred during periods of more extreme drought, and during warmer temperatures in the semi-arid sites but during periods of cooler temperatures in the humid sites. Because competition has a consistent influence over growth response to drought, maintaining forests at lower density may enhance resilience to drought in all climates.
EUFODOS: European Forest Downstream Services - Improved Information on Forest Structure and Damage
Hirschmugl, M.; Gallaun, H.; Wack, R.; Granica, K.; Schardt, M.
2013-05-01
Forests play a key role in the European economy and environment. This role incorporates ecological functions which can be affected by the occurrence of insect infestations, forest fire, heavy snowfall or windfall events. Local or Regional Authorities (LRAs) thus require detailed information on the degradation status of their forests to be able to take appropriate measures for their forest management plans. In the EUFODOS project, state-of-the-art satellite and laser scanning technologies are used to provide forest authorities with cost-effective and comprehensive information on forest structure and damage. One of the six test sites is located in the Austrian province of Styria where regional forest authorities have expressed a strong need for detailed forest parameters in protective forest. As airborne laser-scanning data is available, it will be utilized to derive detailed forest parameters such as the upper forest border line, tree height, growth classes, forest density, vertical structure or volume. At the current project status, the results of (i) the forest border line, (ii) the segmentation of forest stands and (iii) the tree top detection are available and presented including accuracy assessment and interim results are shown for timber volume estimations. The final results show that the forest border can be mapped operationally with an overall accuracy of almost 99% from LiDAR data. For the segmentation of forest stands, a comparison of the automatically derived result with visual-manual delineation showed in general a more detailed segmentation result, but for all visual-manual segments a congruence of 87% within a 4 m buffer. Tree top detections were compared to stem numbers estimated based on angle-count samplings in a field campaign, which led to a correlation coefficient (R) of 0.79.
NACP North American Forest Dynamics Project: Forest Disturbance and Regrowth Data
National Aeronautics and Space Administration — ABSTRACT: This data set provides the results of time-series analyses of Landsat imagery for 55 selected forested sites across the conterminous U.S.A. The output is a...
Mapping Russian forest biomass with data from satellites and forest inventories
International Nuclear Information System (INIS)
Houghton, R A; Butman, D; Bunn, A G; Krankina, O N; Schlesinger, P; Stone, T A
2007-01-01
The forests of Russia cover a larger area and hold more carbon than the forests of any other nation and thus have the potential for a major role in global warming. Despite a systematic inventory of these forests, however, estimates of total carbon stocks vary, and spatial variations in the stocks within large aggregated units of land are unknown, thus hampering measurement of sources and sinks of carbon. We mapped the distribution of living forest biomass for the year 2000 by developing a relationship between ground measurements of wood volume at 12 sites throughout the Russian Federation and data from the MODIS satellite bidirectional reflectance distribution function (BRDF) product (MOD43B4). Based on the results of regression-tree analyses, we used the MOD43B4 product to assign biomass values to individual 500 m x 500 m cells in areas identified as forest by two satellite-based maps of land cover. According to the analysis, the total living biomass varied between 46 and 67 Pg, largely because of different estimates of forest area. Although optical data are limited in distinguishing differences in biomass in closed canopy forests, the estimates of total living biomass obtained here varied more in response to different definitions of forest than to saturation of the optical sensing of biomass
Mapping Russian forest biomass with data from satellites and forest inventories
Energy Technology Data Exchange (ETDEWEB)
Houghton, R A [Woods Hole Research Center, 149 Woods Hole Road, Falmouth, MA 02540 (United States); Butman, D [Yale School of Forestry and Environmental Science, Yale University, New Haven, CT 06511 (United States); Bunn, A G [Department of Environmental Sciences, Huxley College of the Environment, Western Washington University, 516 High Street, Bellingham, WA 98225-9181 (United States); Krankina, O N [Department of Forest Science, Oregon State University, 202 Richardson Hall, Corvallis, OR 97331-5752 (United States); Schlesinger, P [Woods Hole Research Center, 149 Woods Hole Road, Falmouth, MA 02540 (United States); Stone, T A [Woods Hole Research Center, 149 Woods Hole Road, Falmouth, MA 02540 (United States)
2007-10-15
The forests of Russia cover a larger area and hold more carbon than the forests of any other nation and thus have the potential for a major role in global warming. Despite a systematic inventory of these forests, however, estimates of total carbon stocks vary, and spatial variations in the stocks within large aggregated units of land are unknown, thus hampering measurement of sources and sinks of carbon. We mapped the distribution of living forest biomass for the year 2000 by developing a relationship between ground measurements of wood volume at 12 sites throughout the Russian Federation and data from the MODIS satellite bidirectional reflectance distribution function (BRDF) product (MOD43B4). Based on the results of regression-tree analyses, we used the MOD43B4 product to assign biomass values to individual 500 m x 500 m cells in areas identified as forest by two satellite-based maps of land cover. According to the analysis, the total living biomass varied between 46 and 67 Pg, largely because of different estimates of forest area. Although optical data are limited in distinguishing differences in biomass in closed canopy forests, the estimates of total living biomass obtained here varied more in response to different definitions of forest than to saturation of the optical sensing of biomass.
Visually Determined Soil Disturbance Classes Used as Indices of Forest Harvesting Disturbance
W. Michael Aust; James A. Burger; Emily A. Carter; David P. Preston; Steven C. Patterson
1998-01-01
Visual estimates of soil and site disturbances are used by foresters, soil scientists, logging supervisors. and machinery operators to minimize harvest disturbances to forest sites, to evaluate compliance with forestry Best Management Practices (BMPs), and to determine the need for ameliorative practices such as tnechanical site preparation. Although estimates are...
Curtis, P. S.; Gough, C. M.; Vogel, C. S.
2005-12-01
Carbon (C) storage increasingly is considered an important part of the economic return of forestlands, making easily parameterized models for assessing current and future C storage important for both ecosystem and money managers. For the deciduous forests of the northern midwest, USA, detailed information relating annual C storage to local site characteristics can be combined with spatially extensive forest inventories to produce simple, robust models of C storage useful at a variety of scales. At the University of Michigan Biological Station (45o35`' N, 84o42`' W) we measured C storage, or net ecosystem production (NEP), in 65 forest stands varying in age, disturbance history, and productivity (site index) using biometric methods, and independently measured net C exchange at the landscape level using meteorological methods. Our biometric and meteorological estimates of NEP converged to within 1% of each other over five years, providing important confirmation of the robustness of these two approaches applied within northern deciduous forests (Gough et al. 2005). We found a significant relationship between NEP, stand age ( A, yrs), and site index ( Is, m), where NEP = 0.134 + 0.022 * (LN[ A* Is]) (r2 = 0.50, P database (ncrs2.fs.fed.us/4801/fiadb/) to estimate forest C storage at different scales across the upper midwest, Great Lakes region. Model estimates were validated against independent estimates of C storage for other forests in the region. At the local ecosystem-level (~1 km2) C storage averaged 1.52 Mg ha-1 yr-1. Scaling to the two-county area surrounding our meteorological and biometric study sites, average stand age decreased and site index increased, resulting in estimated storage of 1.62 Mg C ha-1 yr-1, or 0.22 Tg C yr-1 in the 1350 km2 of deciduous forest in this area. For the state of Michigan (31,537 km2 of deciduous forest), average uptake was estimated at 1.55 Mg C ha-1 yr-1, or 4.9 Tg C yr-1 total storage. For the three state region encompassing
Roth, T. R.; Nolin, A. W.
2015-12-01
Forest canopies intercept as much as 60% of snowfall in maritime environments, while processes of sublimation and melt can reduce the amount of snow transferred from the canopy to the ground. This research examines canopy interception efficiency (CIE) as a function of forest and event-scale snowfall characteristics. We use a 4-year dataset of continuous meteorological measurements and monthly snow surveys from the Forest Elevation Snow Transect (ForEST) network that has forested and open sites at three elevations spanning the rain-snow transition zone to the upper seasonal snow zone. Over 150 individual storms were classified by forest and storm type characteristics (e.g. forest density, vegetation type, air temperature, snowfall amount, storm duration, wind speed, and storm direction). The between-site comparisons showed that, as expected, CIE was highest for the lower elevation (warmer) sites with higher forest density compared with the higher elevation sites where storm temperatures were colder, trees were smaller and forests were less dense. Within-site comparisons based on storm type show that this classification system can be used to predict CIE.Our results suggest that the coupling of forest type and storm type information can improve estimates of canopy interception. Understanding the effects of temperature and storm type in temperate montane forests is also valuable for future estimates of canopy interception under a warming climate.
Dwarf forest recovery after disturbances in the Luquillo Mountains of Puerto Rico
P.L. Weaver
2008-01-01
Dwarf forest in Puerto Ricoâs Luquillo Mountains varies according to substrate and topography with very short, dense forest growing on exposed, rocky sites. High elevation level sites suffered considerable damage during past hurricanes whereas the trees on certain lower slopes were protected by ridges or spurs. Post-disturbance recovery of dwarf forest on two types of...
Energy Technology Data Exchange (ETDEWEB)
Fonseca, F.; Figueiredo, T. de; Martins, A.
2014-06-01
Aim of study: This study aims at evaluating the impact of site preparation techniques prior to plantation on carbon storage and distribution in a young mixed stand of Pseudotsuga menziesii (PM) and Castanea sativa (CS). Area of study: The experimental field was established near Macedo de Cavaleiros, Northern Portugal, at 700 m elevation, mean annual temperature 12 degree centigrade and mean annual rainfall 678 mm. Material and methods: The experimental layout includes three replicates, where the different treatments corresponding to different tillage intensities were randomly distributed (high, moderate and slight intensity), in plots with an area of 375 m{sup 2} each. Twenty six months after forest stand installation, samples of herbaceous vegetation (0.49 m{sup 2} quadrat), forest species (8 PM and 8 CS) and mineral soil (at 0-5, 5-15, 15-30 and 30-60 cm depth) were collected in 15 randomly selected points in each treatment, processed in laboratory and analyzed for carbon by elemental carbon analyzer. Main results: The results obtained showed that: (i) more than 90% of the total carbon stored in the system is located in the soil, increasing in depth with tillage intensity; (ii) the contribution of herbaceous vegetation and related roots to the carbon storage is very low; (iii) the amount of carbon per tree is higher in CS than in PM; (iv) the global carbon storage was affected by soil tillage generally decreasing with the increase of tillage intensity. Accordingly, carbon storage capacity as affected by the application of different site preparation techniques should be a decision support tool in afforestation schemes. (Author)
Kelp forest monitoring 1993 annual report. Channel Islands National Park. Final report
Energy Technology Data Exchange (ETDEWEB)
Kushner, D.; Walder, R.; Gorodezky, L.; Lerma, D.; Richards, D.
1993-06-01
The 1993 results of the Channel Islands National Park Kelp Forest Monitoring Project are described in this report. Population dynamics of 68 taxa or categories of algea, fish, and invertebrates were measured at 16 permanent sites around the five islands within the park. Survey techniques utilized SCUBA and surface-supplied-air, and included quadrats, band transects, random contacts, fish transects, video transects, size frequency measurements, artificial recruitment modules, and species list surveys. Temperature data was collected using Sea Data batheothermographs, and HOBOTEMP temperature loggers. Temperature loggers were installed at each of the sixteen sites. Size frequency measurements were taken from artifical recruitment modules at nine sites. In 1993, 13 sites had giant kelp, Macrocysts pyrifera, forests, one site was dominated by the aggregating red sea cucumber, pachythyone rubra, one site was dominated by red sea urchins, Strongylocentrotus franciscanus, and another by purple sea urchins, S. purpuratus. The 13 sites with kelp forests consisted of 10 mature and three young kelp forests. Wasting disease was observed in sea stars and wasting syndrome was apparent in sea urchins. Sea urchins wasting syndrome appears to have caused mass mortality of purple sea urchins, S. purpuratus, at two Santa Barbara Island sites.
You, Ye-Ming; Wang, Juan; Sun, Xiao-Lu; Tang, Zuo-Xin; Zhou, Zhi-Yong; Sun, Osbert Jianxin
2016-01-01
Understanding the controls on soil carbon dynamics is crucial for modeling responses of ecosystem carbon balance to global change, yet few studies provide explicit knowledge on the direct and indirect effects of forest stands on soil carbon via microbial processes. We investigated tree species, soil, and site factors in relation to soil carbon density and mineralization in a temperate forest of central China. We found that soil microbial biomass and community structure, extracellular enzyme activities, and most of the site factors studied varied significantly across contrasting forest types, and that the associations between activities of soil extracellular enzymes and microbial community structure appeared to be weak and inconsistent across forest types, implicating complex mechanisms in the microbial regulation of soil carbon metabolism in relation to tree species. Overall, variations in soil carbon density and mineralization are predominantly accounted for by shared effects of tree species, soil, microclimate, and microbial traits rather than the individual effects of the four categories of factors. Our findings point to differential controls on soil carbon density and mineralization among contrasting forest types and highlight the challenge to incorporate microbial processes for constraining soil carbon dynamics in global carbon cycle models. PMID:26925871
Directory of Open Access Journals (Sweden)
Heydari Mehdi
2014-09-01
Full Text Available There has been observed widespread destruction of natural ecosystems around the world due to population growth, land use change and clear cutting which have affected soil properties. Different management strategies have been so far implemented to reduce this crisis in various regions of the world, such as e.g. short-term and long-term conservation management in the Zagros region. However, any management approach should be evaluated with appropriate measures to determine how managed areas respond. The main objective of the present study was to evaluate the potential of earthworms as an indicator for different forest management strategies and human disturbances in Zagros oak (Quercus persica Jaub. and Spach forest. The sites selected included undisturbed one as the control (Un, the sites under five-year conservation management (FCM and twenty-year conservation management (TCM as well as the disturbed site (D. The results of principal component analysis (PCA showed that different regions separated into the components: PC1 and PC2. Un and TCM sites gathered together and represented higher values of the factors such as pH, Kavailable, OC, clay content, Pavailable, CEC, overstory tree canopy, Ntot, biomass and abundance of earthworms. The positive direction of the first axis reflected a gradient of EC, BD and Ptot. According to the logistic model, NH4-N and EC played the most important role in earthworm presence and absence in Zagros forest ecosystem. Earthworm abundance and biomass could be a good indicator to evaluate different forest management strategies in the study area.
McGarvey, Jennifer C; Thompson, Jonathan R; Epstein, Howard E; Shugart, Herman H
2015-02-01
Few old-growth stands remain in the matrix of secondary forests that dominates the eastern North American landscape. These remnant stands offer insight on the potential carbon (C) storage capacity of now-recovering secondary forests. We surveyed the remaining old-growth forests on sites characteristic of the general Mid-Atlantic United States and estimated the size of multiple components of forest C storage. Within and between old-growth stands, variability in C density is high and related to overstory tree species composition. The sites contain 219 ± 46 Mg C/ha (mean ± SD), including live and dead aboveground biomass, leaf litter, and the soil O horizon, with over 20% stored in downed wood and snags. Stands dominated by tulip poplar (Liriodendron tulipifera) store the most live biomass, while the mixed oak (Quercus spp.) stands overall store more dead wood. Total C density is 30% higher (154 Mg C/ha), and dead wood C density is 1800% higher (46 Mg C/ha) in the old-growth forests than in the surrounding younger forests (120 and 5 Mg C/ha, respectively). The high density of dead wood in old growth relative to secondary forests reflects a stark difference in historical land use and, possibly, the legacy of the local disturbance (e.g., disease) history. Our results demonstrate the potential for dead wood to maintain the sink capacity of secondary forests for many decades to come.
Calcareous forest seepages acting as biodiversity hotspots and refugia for woodland snail faunas
Horsák, Michal; Tajovská, Eva; Horsáková, Veronika
2017-07-01
Land-snail species richness has repeatedly been found to increase with the increasing site calcium content and humidity. These two factors, reported as the main drivers of land-snail assemblage diversity, are also among the main habitat characteristics of calcareous seepages. Here we explore local species richness and compositional variation of forest spring-fed patches (i.e. seepages), to test the hypothesis that these habitats might act as biodiversity hotspots and refugia of regional snail faunas. In contrast to treeless spring fens, only little is known about land snail faunas inhabiting forest seepages. Studying 25 isolated calcareous forest seepages, evenly distributed across the White Carpathians Protected Landscape Area (SE Czech Republic), we found that these sites, albeit spatially very limited, can harbour up to 66% of the shelled land-snail species known to occur in this well-explored protected area (in total 83 species). By comparing land snail assemblages of the studied seepages with those occurring in the woodland surroundings of each site as well as those previously sampled in 28 preserved forest sites within the study area, we found the seepages to be among the most species rich sites. Although the numbers of species did not statistically differ among these three systems, we found highly significant differences in species composition. Seepage faunas were composed of many species significantly associated with spring sites, in contrast to the assemblages of both surrounding and preserved forest sites. Our results highly support the hypothesis that calcareous forest seepages might serve as refugia and biodiversity hotspots of regional land snail faunas. Protection of these unique habitats challenges both conservation plans and forest management guidelines as they might act as sources for the recolonization and restoration of forest snail assemblages particularly in areas impoverished by harvesting and clearcutting.
International Nuclear Information System (INIS)
Sifeddine, A.; Bertaux, J.; Mourguiart, Ph.; Disnar, J.R.; Laggoun-Defarge, F.; Argollo, J.
1998-01-01
A sedimentological study of a 755 cm length core sampled in the middle of a marshy depression surrounded by a cloud forest in the central Andes reveals that this site has recorded important environmental variations during the last 50 000 years. For the most part (625 cm) the core is composed of detrital rich sediments deposited during the Upper Pleistocene. The highest amount of detrital influx underlines the Last Glacial Maximum which ranges from ca 29,000 14 C yr B.P. to ca 16,000 14 C yr B.P. (ca 18,500 cal yr B.P.), between two relatively humid phases. The sedimentation of the present Interglacial, starting at ca 12,500 14 C yr B.P. (14,500 cal yr B.P.), is mainly organic, as a consequence of the great development of soils and the forest vegetal cover the catchment area. The maximum extension of this vegetal cover ranging from 12,500 to ca 10,500 14 C yr B.P. (14,500 and 12,400 cal yr B.P.) is followed from 10,500 to 8,000 14 C yr B.P. (12,400 and 8,800 cal yr B.P.) by a drier period is revealed by the occurrence of micro-charcoals in the sediment. Between ca 8,000 and 4,000 14 C yr B.P. (8,800 and 4,500 cal yr B.P.), the sharp increase of micro-charcoals content, likely related to palaeo-fires, underlines an intensification of this dry trend. (authors)
Czech Academy of Sciences Publication Activity Database
Mairota, P.; Buckley, P.; Suchomel, C.; Heinsoo, K.; Verheyen, K.; Hédl, Radim; Terzuolo, P. G.; Sindaco, R.; Carpanelli, A.
2016-01-01
Roč. 9, AUG 2016 (2016), s. 560-568 ISSN 1971-7458 Institutional support: RVO:67985939 Keywords : biodiversity * habitats directive * forest habitat types Subject RIV: GK - Forestry Impact factor: 1.623, year: 2016
Directory of Open Access Journals (Sweden)
Kayanna L. Warren
2014-01-01
Full Text Available There has been effort worldwide to quantify how much carbon forests contain in order to designate appropriate offset credits to forest carbon climate mitigation. Carbon pools on or immediately below the soil surface are understood to be very active in response to environmental change but are not well understood. Our study focused on the effects of shelterwood regeneration harvests in New England on the carbon stored in litter, woody debris, and surface soil carbon. Results demonstrate significant difference in surface (0–10 cm soil carbon between control (nonharvested and harvested sites, with higher carbon percentage on control sites. Results showed a significant difference in coarse woody debris with higher amounts of carbon per area on harvested sites. No significant difference in litter mass was recorded between harvested and control sites. When coarse woody debris and litter are included with soil carbon, total carbon did not have a significant decline over 20 years following shelterwood treatment to the forest to secure regeneration, but there was considerable variability among sites. When taking all surface soil carbon measurements together, our results suggest that for accounting purposes the measurement of below-ground carbon after shelterwood harvests is not necessary for the southern New England region.
Migration and bioavailability of {sup 137}Cs in forest soil of southern Germany
Energy Technology Data Exchange (ETDEWEB)
Konopleva, I.; Klemt, E. [Hochschule Ravensburg-Weingarten, University of Applied Sciences, 88250 Weingarten (Germany); Konoplev, A. [Scientific Production Association ' TYPHOON' , Obninsk (Russian Federation); Zibold, G. [Hochschule Ravensburg-Weingarten, University of Applied Sciences, 88250 Weingarten (Germany)], E-mail: zibold@hs-weingarten.de
2009-04-15
To give a quantitative description of the radiocaesium soil-plant transfer for fern (Dryopteris carthusiana) and blackberry (Rubus fruticosus), physical and chemical properties of soils in spruce and mixed forest stands were investigated. Of special interest was the selective sorption of radiocaesium, which was determined by measuring the Radiocaesium Interception Potential (RIP). Forest soil and plants were taken at 10 locations of the Altdorfer Wald (5 sites in spruce forest and 5 sites in mixed forest). It was found that the bioavailability of radiocaesium in spruce forest was on average seven times higher than in mixed forest. It was shown that important factors determining the bioavailability of radiocaesium in forest soil were its exchangeability and the radiocaesium interception potential (RIP) of the soil. Low potassium concentration in soil solution of forest soils favors radiocaesium soil-plant transfer. Ammonium in forest soils plays an even more important role than potassium as a mobilizer of radiocaesium. The availability factor - a function of RIP, exchangeability and cationic composition of soil solution - characterized reliably the soil-plant transfer in both spruce and mixed forest. For highly organic soils in coniferous forest, radiocaesium sorption at regular exchange sites should be taken into account when its bioavailability is considered.
Contrasting Patterns of Damage and Recovery in Logged Amazon Forests From Small Footprint LiDAR Data
Morton, D. C.; Keller, M.; Cook, B. D.; Hunter, Maria; Sales, Marcio; Spinelli, L.; Victoria, D.; Andersen, H.-E.; Saleska, S.
2012-01-01
Tropical forests ecosystems respond dynamically to climate variability and disturbances on time scales of minutes to millennia. To date, our knowledge of disturbance and recovery processes in tropical forests is derived almost exclusively from networks of forest inventory plots. These plots typically sample small areas (less than or equal to 1 ha) in conservation units that are protected from logging and fire. Amazon forests with frequent disturbances from human activity remain under-studied. Ongoing negotiations on REDD+ (Reducing Emissions from Deforestation and Forest Degradation plus enhancing forest carbon stocks) have placed additional emphasis on identifying degraded forests and quantifying changing carbon stocks in both degraded and intact tropical forests. We evaluated patterns of forest disturbance and recovery at four -1000 ha sites in the Brazilian Amazon using small footprint LiDAR data and coincident field measurements. Large area coverage with airborne LiDAR data in 2011-2012 included logged and unmanaged areas in Cotriguacu (Mato Grosso), Fiona do Jamari (Rondonia), and Floresta Estadual do Antimary (Acre), and unmanaged forest within Reserva Ducke (Amazonas). Logging infrastructure (skid trails, log decks, and roads) was identified using LiDAR returns from understory vegetation and validated based on field data. At each logged site, canopy gaps from logging activity and LiDAR metrics of canopy heights were used to quantify differences in forest structure between logged and unlogged areas. Contrasting patterns of harvesting operations and canopy damages at the three logged sites reflect different levels of pre-harvest planning (i.e., informal logging compared to state or national logging concessions), harvest intensity, and site conditions. Finally, we used multi-temporal LiDAR data from two sites, Reserva Ducke (2009, 2012) and Antimary (2010, 2011), to evaluate gap phase dynamics in unmanaged forest areas. The rates and patterns of canopy gap
LBA-ECO CD-10 Forest Litter Data for km 67 Tower Site, Tapajos National Forest
National Aeronautics and Space Administration — ABSTRACT: This data set contains a single text file which reports litter type and mass in the old-growth upland forest at the Para Western (Santarem) - km 67,...
Mame E. Redwood; Glenn R. Matlack; Cynthia D. Huebner
2018-01-01
An effective management plan for invasive herb populations must consider the potential for regeneration from the soil seedbank. To test chis potential, we examined two species, Japanese scilcgrass and garlic mustard, at deciduous forest sites in southeastern Ohio. Seeds were buried in nylon mesh bags and recovered at regular intervals over 24 mo. Recovered seeds were...
Canada's forest biomass resources: deriving estimates from Canada's forest inventory
International Nuclear Information System (INIS)
Penner, M.; Power, K.; Muhairwe, C.; Tellier, R.; Wang, Y.
1997-01-01
A biomass inventory for Canada was undertaken to address the data needs of carbon budget modelers, specifically to provide estimates of above-ground tree components and of non-merchantable trees in Canadian forests. The objective was to produce a national method for converting volume estimates to biomass that was standardized, repeatable across the country, efficient and well documented. Different conversion methods were used for low productivity forests (productivity class 1) and higher productivity forests (productivity class 2). The conversion factors were computed by constructing hypothetical stands for each site, age, species and province combination, and estimating the merchantable volume and all the above-ground biomass components from suitable published equations. This report documents the procedures for deriving the national biomass inventory, and provides illustrative examples of the results. 46 refs., 9 tabs., 5 figs
Testing for change in structural elements of forest inventories
Melinda Vokoun; David Wear; Robert Abt
2009-01-01
In this article we develop a methodology to test for changes in the underlying relationships between measures of forest productivity (structural elements) and site characteristics, herein referred to as structural changes, using standard forest inventories. Changes in measures of forest growing stock volume and number of trees for both...
Daniel Neary; Deborah Hayes; Lindsey Rustad; James Vose; Gerald Gottfried; Stephen Sebesteyn; Sherri Johnson; Fred Swanson; Mary Adams
2012-01-01
The US Forest Service initiated its catchment research program in 1909 with the first paired catchment study at Wagon Wheel Gap, Colorado, USA. It has since developed the Experimental Forests and Ranges Network, with over 80 long-term research study sites located across the contiguous USA, Alaska, Hawaii, and the Caribbean. This network provides a unique, powerful...
Forest biomass carbon stocks and variation in Tibet's carbon-dense forests from 2001 to 2050.
Sun, Xiangyang; Wang, Genxu; Huang, Mei; Chang, Ruiying; Ran, Fei
2016-10-05
Tibet's forests, in contrast to China's other forests, are characterized by primary forests, high carbon (C) density and less anthropogenic disturbance, and they function as an important carbon pool in China. Using the biomass C density data from 413 forest inventory sites and a spatial forest age map, we developed an allometric equation for the forest biomass C density and forest age to assess the spatial biomass C stocks and variation in Tibet's forests from 2001 to 2050. The results indicated that the forest biomass C stock would increase from 831.1 Tg C in 2001 to 969.4 Tg C in 2050, with a net C gain of 3.6 Tg C yr -1 between 2001 and 2010 and a decrease of 1.9 Tg C yr -1 between 2040 and 2050. Carbon tends to allocate more in the roots of fir forests and less in the roots of spruce and pine forests with increasing stand age. The increase of the biomass carbon pool does not promote significant augmentation of the soil carbon pool. Our findings suggest that Tibet's mature forests will remain a persistent C sink until 2050. However, afforestation or reforestation, especially with the larger carbon sink potential forest types, such as fir and spruce, should be carried out to maintain the high C sink capacity.
Chakraborty, Anusheema; Joshi, Pawan Kumar; Sachdeva, Kamna
2018-05-01
Our study explores the nexus between forests and local communities through participatory assessments and household surveys in the central Himalayan region. Forest dependency was compared among villages surrounded by oak-dominated forests (n = 8) and pine-dominated forests (n = 9). Both quantitative and qualitative analyses indicate variations in the degree of dependency based on proximity to nearest forest type. Households near oak-dominated forests were more dependent on forests (83.8%) compared to households near pine-dominated forests (69.1%). Forest dependency is mainly subsistence-oriented for meeting basic household requirements. Livestock population, cultivated land per household, and non-usage of alternative fuels are the major explanatory drivers of forest dependency. Our findings can help decision and policy makers to establish nested governance mechanisms encouraging prioritized site-specific conservation options among forest-adjacent households. Additionally, income diversification with respect to alternate livelihood sources, institutional reforms, and infrastructure facilities can reduce forest dependency, thereby, allowing sustainable forest management.
EUFODOS: European Forest Downstream Services – Improved Information on Forest Structure and Damage
Directory of Open Access Journals (Sweden)
M. Hirschmugl
2013-05-01
Full Text Available Forests play a key role in the European economy and environment. This role incorporates ecological functions which can be affected by the occurrence of insect infestations, forest fire, heavy snowfall or windfall events. Local or Regional Authorities (LRAs thus require detailed information on the degradation status of their forests to be able to take appropriate measures for their forest management plans. In the EUFODOS project, state-of-the-art satellite and laser scanning technologies are used to provide forest authorities with cost-effective and comprehensive information on forest structure and damage. One of the six test sites is located in the Austrian province of Styria where regional forest authorities have expressed a strong need for detailed forest parameters in protective forest. As airborne laser-scanning data is available, it will be utilized to derive detailed forest parameters such as the upper forest border line, tree height, growth classes, forest density, vertical structure or volume. At the current project status, the results of (i the forest border line, (ii the segmentation of forest stands and (iii the tree top detection are available and presented including accuracy assessment and interim results are shown for timber volume estimations. The final results show that the forest border can be mapped operationally with an overall accuracy of almost 99% from LiDAR data. For the segmentation of forest stands, a comparison of the automatically derived result with visual-manual delineation showed in general a more detailed segmentation result, but for all visual-manual segments a congruence of 87% within a 4 m buffer. Tree top detections were compared to stem numbers estimated based on angle-count samplings in a field campaign, which led to a correlation coefficient (R of 0.79.
Integration of ground and satellite data to model Mediterranean forest processes
Chiesi, M.; Fibbi, L.; Genesio, L.; Gioli, B.; Magno, R.; Maselli, F.; Moriondo, M.; Vaccari, F. P.
2011-06-01
The current work presents the testing of a modeling strategy that has been recently developed to simulate the gross and net carbon fluxes of Mediterranean forest ecosystems. The strategy is based on the use of a NDVI-driven parametric model, C-Fix, and of a biogeochemical model, BIOME-BGC, whose outputs are combined to simulate the behavior of forest ecosystems at different development stages. The performances of the modeling strategy are evaluated in three Italian study sites (San Rossore, Lecceto and Pianosa), where carbon fluxes are being measured through the eddy correlation technique. These sites are characterized by variable Mediterranean climates and are covered by different types of forest vegetation (pine wood, Holm oak forest and Macchia, respectively). The results of the tests indicate that the modeling strategy is generally capable of reproducing monthly GPP and NEE patterns in all three study sites. The highest accuracy is obtained in the most mature, homogenous pine wood of San Rossore, while the worst results are found in the Lecceto forest, where there are the most heterogeneous terrain, soil and vegetation conditions. The main error sources are identified in the inaccurate definition of the model inputs, particularly those regulating the site water budgets, which exert a strong control on forest productivity during the Mediterranean summer dry season. In general, the incorporation of NDVI-derived fAPAR estimates corrects for most of these errors and renders the forest flux simulations more stable and accurate.
Water-use dynamics of a peat swamp forest and a dune forest in Maputaland, South Africa
Directory of Open Access Journals (Sweden)
A. D. Clulow
2013-05-01
Full Text Available Peat swamp forests are the second rarest forest type found in South Africa while dune forests have been under severe threat through mining and agriculture. Both forest types exist in the conservation area, and World Heritage site, known as the iSimangaliso Wetland Park on the East coast of South Africa. The area is prone to severe droughts (Taylor et al., 2006 and recent attempts to understand the local water balance revealed that there was insufficient information on the water use of the indigenous forests of the area. The peat swamp forest and dune forest sites studied in this research were located within close proximity to each other, yet, are characterised by different landscape positions in terms of water availability. The coastal dune forest soil profile was generally dry and sandy and the tree roots did not have access to the water table. In contrast the peat swamp forest is located in an interdunal wetland where the trees have permanent access to water. The climate at both sites is subtropical with a mean annual precipitation of 1200 mm yr−1. However, over 20 months of measurement, the first summer (October 2009 to March 2010 was drier (424 versus 735 mm than the second summer (October 2010 to March 2011 emphasising the variability of the rainfall in the area and providing a wide range of conditions measured. The sap flow of an evergreen, overstory Syzygium cordatum and a semi-deciduous, understory Shirakiopsis elliptica were measured in the peat swamp forest using the heat ratio method. The Syzygium cordatum water use was not highly seasonal and the daily maximum water use ranged from approximately 30 L d−1 in winter to 45 L d−1 in summer whereas the extit{Shirakiopsis elliptica} water use was more seasonal at 2 L d−1 in winter and 12 L d−1 in summer. The water use of the Syzygium cordatum was not influenced by seasonal rainfall variations and was actually higher in the drier summer (October 2009 to March 2010. Three trees of
Insights on Forest Structure and Composition from Long-Term Research in the Luquillo Mountains
Tamara Heartsill Scalley
2017-01-01
The science of ecology fundamentally aims to understand species and their relation to the environment. At sites where hurricane disturbance is part of the environmental context, permanent forest plots are critical to understand ecological vegetation dynamics through time. An overview of forest structure and species composition from two of the longest continuously measured tropical forest plots is presented. Long-term measurements, 72 years at the leeward site, and 25 years at windward site, o...
Directory of Open Access Journals (Sweden)
Diane Fielding
2012-01-01
Full Text Available Woody biomass has been identified as an important renewable energy source capable of offsetting fossil fuel use. The potential environmental impacts associated with using woody biomass for energy have spurred development of biomass harvesting guidelines (BHGs in some states and proposals for BHGs in others. We examined stakeholder opinions about BHGs through 60 semistructured interviews with key participants in the North Carolina, USA, forest business sector—forest managers, loggers, and forest landowners. Respondents generally opposed requirements for new BHGs because guidelines added to best management practices (BMPs. Most respondents believed North Carolina’s current BMPs have been successful and sufficient in protecting forest health; biomass harvesting is only an additional component to harvesting with little or no modification to conventional harvesting operations; and scientific research does not support claims that biomass harvesting negatively impacts soil, water quality, timber productivity, or wildlife habitat. Some respondents recognized possible benefits from the implementation of BHGs, which included reduced site preparation costs and increases in proactive forest management, soil quality, and wildlife habitat. Some scientific literature suggests that biomass harvests may have adverse site impacts that require amelioration. The results suggest BHGs will need to be better justified for practitioners based on the scientific literature or linked to demand from new profitable uses or subsidies to offset stakeholder perceptions that they create unnecessary costs.
Boreal Forests of Kamchatka: Structure and Composition
Eichhorn, Markus P.
2010-01-01
Central Kamchatka abounds in virgin old-growth boreal forest, formed primarily by Larix cajanderi and Betula platyphylla in varying proportions. A series of eight 0.25–0.30 ha plots captured the range of forests present in this region and their structure is described. Overall trends in both uplands and lowlands are for higher sites to be dominated by L. cajanderi with an increasing component of B. platyphylla with decreasing altitude. The tree line on wet sites is commonly formed by mono-domi...
Air pollution impacts on forests in changing climate
M. Lorenz; N. Clarke; E. Paoletti; A. Bytnerowicz; N. Grulke; N. Lukina; H. Sase; J. Staelens
2010-01-01
Growing awareness of air pollution effects on forests has, from the early 1980s on, led to intensive forest damage research and monitoring. This has fostered air pollution control, especially in Europe and North America, and to a smaller extent also in other parts of the world. At several forest sites in these regions, there are first indications of a recovery of...
Heller, R. C.; Aldrich, R. C.; Weber, F. P.; Driscoll, R. S. (Principal Investigator)
1974-01-01
The author has identified the following significant results. Some current beetle-killed ponderosa pine can be detected on S190-B photography imaged over the Bear Lodge mountains in the Black Hills National Forest. Detections were made on SL-3 imagery (September 13, 1973) using a zoom lens microscope to view the photography. At this time correlations have not been made to all of the known infestation spots in the Bear Lodge mountains; rather, known infestations have been located on the SL-3 imagery. It was determined that the beetle-killed trees were current kills by stereo viewing of SL-3 imagery on one side and SL-2 on the other. A successful technique was developed for mapping current beetle-killed pine using MSS imagery from mission 247 flown by the C-130 over the Black Hills test site in September 1973. Color enhancement processing on the NASA/JSC, DAS system using three MSS channels produced an excellent quality detection map for current kill pine. More importantly it provides a way to inventory the dead trees by relating PCM counts to actual numbers of dead trees.
International Nuclear Information System (INIS)
Persson, Hans; Stadenberg, Ingela
2007-12-01
The seasonal growth dynamics of live and dead roots for trees and the field layer species (g/m 2 , varying diameter fractions) and live/dead ratios were analysed at a fresh/moist coniferous fern forest site close to the nuclear power plant at Forsmark in the central eastern parts of Sweden. The changes in depth distribution of fine roots were observed at depth intervals of the top humus horizon down to 40 cm in the mineral soil profile. The bulk of living fine roots of trees ( 2 . The total quantity of fine roots (live + dead) amounted to 543, 434, 314 and 546 g/m 2 . Considerable quantities of fine roots (< 1 mm in diameter) were attributed to field-layer species (about 18% of the total biomass during the whole period of investigation). The turnover rate (the rate of construction of new roots) for tree fine roots < 1 mm in diameter amounted to at least the size of the average fine-root biomass. Our methods of estimating fine-root production and mortality, involved periodic measurements of live and dead dry weight of the fine roots from sequential core samples of the forest soil. The collected data give a proper and instant measure of the spatial and temporal distribution of fine roots in the undisturbed soil-profile. Data from other fine-root investigations suggest turnover rates in agreement with our present findings. Differences between root growth and turnover should be expected between trees of different age, tree species and different forest sites, but also between different years. Substantial variations in fine-root biomass, necromass and live/dead ratios are found in different forest sites. Correct methods for estimating the amount of live and dead fine-roots in the soil at regular time intervals are essential for any calculation of fine-root turnover. Definition of root vitality differs in literature, making it difficult to compare results from different root investigators. Our investigation clarifies the importance of using distinct morphological criteria
Analysis of forest structure using thematic mapper simulator data
Peterson, D. L.; Westman, W. E.; Brass, J. A.; Stephenson, N. J.; Ambrosia, V. G.; Spanner, M. A.
1986-01-01
The potential of Thematic Mapper Simulator (TMS) data for sensing forest structure information has been explored by principal components and feature selection techniques. In a survey of forest structural properties conducted for 123 field sites of the Sequoia National Park, the canopy closure could be well estimated (r = 0.62 to 0.69) by a variety of channel bands and band ratios, without reference to the forest type. Estimation of the basal area was less successful (r = 0.51 or less) on the average, but could be improved for certain forest types when data were stratified by floristic composition. To achieve such a stratification, individual sites were ordinated by a detrended correspondence analysis based on the canopy of dominant species. The analysis of forest structure in the Sequoia data suggests that total basal area can be best predicted in stands of lower density, and in younger even-aged managed stands.
Coarse woody debris in undisturbed and logged forests in the eastern Brazilian Amazon.
Michael Keller; Michael Palace; Gregory P. Asner; Rodrigo Jr. Pereira; Jose Natalino M. Silva
2004-01-01
Coarse woody debris (CWD) is an important component of the carbon cycle in tropical forests. We measured the volume and density of fallen CWD at two sites, Cauaxi and Tapajós in the Eastern Amazon. At both sites we studied undisturbed forests (UFs) and logged forests 1 year after harvest. Conventional logging (CL) and reduced impact logging (RIL) were...
Impacts of access and benefit sharing on livelihoods and forest
DEFF Research Database (Denmark)
Yietagesu, Aklilu Ameha; Nielsen, Oystein Juul; Larsen, Helle Overgaard
2014-01-01
The introduction of participatory forest management (PFM) may involve the exclusion of previous forest users from accessing forest resources. This is the case for PFM in the two Ethiopian pioneer sites, Dodola and Chilimo that represent two distinct PFM approaches in Ethiopia. This paper analyses...
Directory of Open Access Journals (Sweden)
Geneviève Tremblay
2017-12-01
Full Text Available The use of forest roads as foundations for dam construction by beavers is a recurrent problem in the management of forest road networks. In order to limit the damage to forest roads, our goal was to calculate the probability of beaver dam installation on culverts, according to surrounding habitat parameters, which could allow for improvement in the spatial design of new roads that minimise conflicts with beavers. Comparisons of culverts with (n = 77 and without (n = 51 dams in northwestern Quebec showed that catchment surface, cumulate length of all local streams within a 2-km radius, and road embankment height had a negative effect on the probability of dam construction on culverts, while flow level and culvert diameter ratio had a positive effect. Nevertheless, predicted probabilities of dam construction on culverts generally exceeded 50%, even on sites that were less favourable to beavers. We suggest that it would be more reasonable to take their probable subsequent presence into account at the earliest steps of road conception. Installing mitigation measures such as pre-dams during road construction would probably reduce the occurrence of conflicts with beavers and thus reduce the maintenance costs of forest roads.
Haug, Ingeborg; Setaro, Sabrina; Suárez, Juan Pablo
2013-01-01
Arbuscular mycorrhizae are important for growth and survival of tropical trees. We studied the community of arbuscular mycorrhizal fungi in a tropical mountain rain forest and in neighbouring reforestation plots in the area of Reserva Biológica San Francisco (South Ecuador). The arbuscular mycorrhizal fungi were analysed with molecular methods sequencing part of the 18 S rDNA. The sequences were classified as Operational Taxonomic Units (OTUs). We found high fungal species richness with OTUs belonging to Glomerales, Diversisporales and Archaeosporales. Despite intensive sampling, the rarefaction curves are still unsaturated for the pristine forest and the reforestation plots. The communities consisted of few frequent and many rare species. No specific interactions are recognizable. The plant individuals are associated with one to ten arbuscular mycorrhizal fungi and mostly with one to four. The fungal compositions associated with single plant individuals show a great variability and variety within one plant species. Planted and naturally occurring plants show high similarities in their fungal communities. Pristine forest and reforestation plots showed similar richness, similar diversity and a significantly nested structure of plant-AMF community. The results indicate that small-scale fragmentation presently found in this area has not destroyed the natural AMF community, at least yet. Thus, the regeneration potential of natural forest vegetation at the tested sites is not inhibited by a lack of appropriate mycobionts. PMID:23671682
Use of Aerial Hyperspectral Imaging For Monitoring Forest Health
Milton O. Smith; Nolan J. Hess; Stephen Gulick; Lori G. Eckhardt; Roger D. Menard
2004-01-01
This project evaluates the effectiveness of aerial hyperspectral digital imagery in the assessment of forest health of loblolly stands in central Alabama. The imagery covers 50 square miles, in Bibb and Hale Counties, south of Tuscaloosa, AL, which includes intensive managed forest industry sites and National Forest lands with multiple use objectives. Loblolly stands...
Bright, Ryan M; Antón-Fernández, Clara; Astrup, Rasmus; Cherubini, Francesco; Kvalevåg, Maria; Strømman, Anders H
2014-02-01
Empirical models alongside remotely sensed and station measured meteorological observations are employed to investigate both the local and global direct climate change impacts of alternative forest management strategies within a boreal ecosystem of eastern Norway. Stand-level analysis is firstly executed to attribute differences in daily, seasonal, and annual mean surface temperatures to differences in surface intrinsic biophysical properties across conifer, deciduous, and clear-cut sites. Relative to a conifer site, a slight local cooling of −0.13 °C at a deciduous site and −0.25 °C at a clear-cut site were observed over a 6-year period, which were mostly attributed to a higher albedo throughout the year. When monthly mean albedo trajectories over the entire managed forest landscape were taken into consideration, we found that strategies promoting natural regeneration of coniferous sites with native deciduous species led to substantial global direct climate cooling benefits relative to those maintaining current silviculture regimes – despite predicted long-term regional warming feedbacks and a reduced albedo in spring and autumn months. The magnitude and duration of the cooling benefit depended largely on whether management strategies jointly promoted an enhanced material supply over business-as-usual levels. Expressed in terms of an equivalent CO2 emission pulse at the start of the simulation, the net climate response at the end of the 21st century spanned −8 to −159 Tg-CO2-eq., depending on whether near-term harvest levels increased or followed current trends, respectively. This magnitude equates to approximately −20 to −300% of Norway's annual domestic (production) emission impact. Our analysis supports the assertion that a carbon-only focus in the design and implementation of forest management policy in boreal and other climatically similar regions can be counterproductive – and at best – suboptimal if boreal forests are to be used as a
Forest biomass carbon stocks and variation in Tibet’s carbon-dense forests from 2001 to 2050
Sun, Xiangyang; Wang, Genxu; Huang, Mei; Chang, Ruiying; Ran, Fei
2016-01-01
Tibet’s forests, in contrast to China’s other forests, are characterized by primary forests, high carbon (C) density and less anthropogenic disturbance, and they function as an important carbon pool in China. Using the biomass C density data from 413 forest inventory sites and a spatial forest age map, we developed an allometric equation for the forest biomass C density and forest age to assess the spatial biomass C stocks and variation in Tibet’s forests from 2001 to 2050. The results indicated that the forest biomass C stock would increase from 831.1 Tg C in 2001 to 969.4 Tg C in 2050, with a net C gain of 3.6 Tg C yr−1 between 2001 and 2010 and a decrease of 1.9 Tg C yr−1 between 2040 and 2050. Carbon tends to allocate more in the roots of fir forests and less in the roots of spruce and pine forests with increasing stand age. The increase of the biomass carbon pool does not promote significant augmentation of the soil carbon pool. Our findings suggest that Tibet’s mature forests will remain a persistent C sink until 2050. However, afforestation or reforestation, especially with the larger carbon sink potential forest types, such as fir and spruce, should be carried out to maintain the high C sink capacity. PMID:27703215
Methods of ecological capability evaluation of forest
International Nuclear Information System (INIS)
Hosseini, M.; Makhdoum, M.F.; Akbarnia, M.; Saghebtalebi, Kh.
2000-01-01
In this research common methods of ecological capability evaluation of forests were reviewed and limitations for performance were analysed. Ecological capability of forests is an index that show site potential in several role of wood production, soil conservation, flood control, biodiversity, conservation and water supply. This index is related to ecological characteristics of land, such as soil, micro climate, elevation, slope and aspect that affect potential of sites. Suitable method of ecological capability evaluation must be chosen according to the objective of forestry. Common methods for ecological capability evaluation include plant and animal diversity, site index curve, soil and land form, inter branches, index plants, leave analyses, analyses regeneration and ecological mapping
FOREST AND WOODLAND COVER AND CHANGE IN COASTAL TANZANIA AND KENYA, 1990 TO 2000
DEFF Research Database (Denmark)
Tabor, Karyn; Burgess, Neil David; Mbilinyi, Boniface P.
2010-01-01
, and local knowledge. Analyses showed that around 6820 km2 of coastal forest habitat remained in ~2000 (2260 km2 in Kenya and 4560 km2 in Tanzania). In terms of change, a total of 424 km2 (6%) of forest was cleared between ~1990 and ~2000; 53 km2 in Kenya and 371 km2 in Tanzania. Rates of forest loss were 8...... times higher in unprotected areas than in protected sites such as Forest Reserves and National Parks. Key Biodiversity Areas had forest loss rates 2.5 times faster than protected areas while Alliance for Zero Extinction sites had the slowest rates of forest loss for the region. These baseline forest...
Energy Technology Data Exchange (ETDEWEB)
Ota, Masakazu, E-mail: ohta.masakazu@jaea.go.jp; Nagai, Haruyasu; Koarashi, Jun
2016-05-01
A process-based model for {sup 137}Cs transfer in forest surface environments was developed to assess the dynamic behavior of Fukushima-derived {sup 137}Cs in a Japanese forest. The model simulation successfully reproduced the observed data from 3 year migration of {sup 137}Cs in the organic and mineral soil layers at a contaminated forest near Fukushima. The migration of {sup 137}Cs from the organic layer to the mineral soil was explained by the direct deposition pattern on the forest floor and the turnover of litter materials in the organic layer under certain ecological conditions. Long-term predictions indicated that more than 90% of the deposited {sup 137}Cs would remain within the top 5 cm of the soil for up to 30 years after the accident, suggesting that the forest acts as an effective long-term reservoir of {sup 137}Cs with limited transfer via the groundwater pathway. The model was also used to explore the potential impacts of soil organic matter (SOM) interactions on the mobility and bioavailability of {sup 137}Cs in the soil–plant system. The simulation results for hypothetical organic soils with modified parameters of {sup 137}Cs turnover revealed that the SOM-induced reduction of {sup 137}Cs adsorption elevates the fraction of dissolved {sup 137}Cs in the soil solution, thereby increasing the soil-to-plant transfer of {sup 137}Cs without substantially altering the fractional distribution of {sup 137}Cs in the soil. Slower fixation of {sup 137}Cs on the flayed edge site of clay minerals and enhanced mobilization of the clay-fixed {sup 137}Cs in organic-rich soils also appeared to elevate the soil-to-plant transfer of {sup 137}Cs by increasing the fraction of the soil-adsorbed (exchangeable) {sup 137}Cs. A substantial proportion (approximate 30%–60%) of {sup 137}Cs in these organic-rich soils was transferred to layers deeper than 5 cm decades later. These results suggested that SOM influences the behavior of {sup 137}Cs in forests over a prolonged
Carbon and nitrogen distribution in oak-hickory forests distributed along a productivity gradient
Energy Technology Data Exchange (ETDEWEB)
Reber, R.T.; Kaczmarek, D.J.; Pope, P.E.; Rodkey, K.S. [Purdue Univ., West Lafayette, IN (United States)
1993-12-31
Biomass, carbon and nitrogen pools were determined for oak-hickory forests of varying productivity. Little information of this type is available for the central hardwood region. Six oak-hickory dominated forests were chosen to represent a range in potential site productivity as influenced by soil type, amount of recyclable nutrients and available water. Biomass, carbon and nitrogen storage were determined for the following components: above ground standing biomass, fine root biomass, forest floor organic layers and litterfall. As site sequestered at each site was dependent more on the amount of living biomass at each site Litterfall, to some extent, increased with increasing site productivity. As potential site productivity decreased, total fine root biomass increased. The data suggest that as site quality decreased fine root production and turnover may become as important in nutrient cycling as annual litterfall.
Focused sunlight factor of forest fire danger assessment using Web-GIS and RS technologies
Baranovskiy, Nikolay V.; Sherstnyov, Vladislav S.; Yankovich, Elena P.; Engel, Marina V.; Belov, Vladimir V.
2016-08-01
Timiryazevskiy forestry of Tomsk region (Siberia, Russia) is a study area elaborated in current research. Forest fire danger assessment is based on unique technology using probabilistic criterion, statistical data on forest fires, meteorological conditions, forest sites classification and remote sensing data. MODIS products are used for estimating some meteorological conditions and current forest fire situation. Geonformation technologies are used for geospatial analysis of forest fire danger situation on controlled forested territories. GIS-engine provides opportunities to construct electronic maps with different levels of forest fire probability and support raster layer for satellite remote sensing data on current forest fires. Web-interface is used for data loading on specific web-site and for forest fire danger data representation via World Wide Web. Special web-forms provide interface for choosing of relevant input data in order to process the forest fire danger data and assess the forest fire probability.
Energy Technology Data Exchange (ETDEWEB)
Nelson, E.A. [Westinghouse Savannah River Company, Aiken, SC (United States); Kolka, R.K. [USDA Forest Service, Charleston, SC (United States); Trettin, C.C. [USDA Forest Service, Charleston, SC (United States)
1997-01-01
This report documents the role of the USDA Forest Service and their collaborators (SRTC, SREL, and several universities) in wetlands monitoring and research on the Savannah River Site. This report describes the rationales, methods, and results (when available) of these studies and summarizes and integrates the available information through 1996.
Post-fire regeneration in seasonally dry tropical forest fragments in southeastern Brazil.
Costa, Mayke B; Menezes, Luis Fernando T DE; Nascimento, Marcelo T
2017-01-01
Seasonally dry tropical forest is one of the highly threatened biome. However, studies on the effect of fire on these tree communities are still scarce. In this context, a floristic and structural survey in three forest areas in the southeast of Brazil that were affected by fire between 14 and 25 years ago was performed with the objective of evaluating post-fire regeneration. In each site, five systematically placed plots (25 m x 25 m each) were established. The more recently burnt site had significantly lower values of richness and diversity than the other two sites. However, the sites did not differ in density and basal area. Annona dolabripetala, Astronium concinnum, Joannesia princeps and Polyandrococos caudescens were within the 10 most important species for the three sites. Comparing these data with adjacent mature forests, the results indicated differences both in structural and floristic aspects, suggesting that the time after fire was not sufficient for recuperation of these areas. The recovery process indicate at least 190 years for areas return to basal area values close to those observed in mature forests nearby.
International Nuclear Information System (INIS)
Lihavainen, Heikki; Asmi, Eija; Aaltonen, Veijo; Makkonen, Ulla; Kerminen, Veli-Matti
2015-01-01
We used more than five years of continuous aerosol measurements to estimate the direct radiative feedback parameter associated with the formation of biogenic secondary organic aerosol (BSOA) at a remote continental site at the edge of the boreal forest zone in Northern Finland. Our upper-limit estimate for this feedback parameter during the summer period (ambient temperatures above 10 °C) was −97 ± 66 mW m −2 K −1 (mean ± STD) when using measurements of the aerosol optical depth (f AOD ) and −63 ± 40 mW m −2 K −1 when using measurements of the ‘dry’ aerosol scattering coefficient at the ground level (f σ ). Here STD represents the variability in f caused by the observed variability in the quantities used to derive the value of f. Compared with our measurement site, the magnitude of the direct radiative feedback associated with BSOA is expected to be larger in warmer continental regions with more abundant biogenic emissions, and even larger in regions where biogenic emissions are mixed with anthropogenic pollution. (letter)
Berner, Logan T.; Law, Beverly E.
2016-01-01
Plant trait measurements are needed for evaluating ecological responses to environmental conditions and for ecosystem process model development, parameterization, and testing. We present a standardized dataset integrating measurements from projects conducted by the Terrestrial Ecosystem Research and Regional Analysis- Pacific Northwest (TERRA-PNW) research group between 1999 and 2014 across Oregon and Northern California, where measurements were collected for scaling and modeling regional terrestrial carbon processes with models such as Biome-BGC and the Community Land Model. The dataset contains measurements of specific leaf area, leaf longevity, leaf carbon and nitrogen for 35 tree and shrub species derived from more than 1,200 branch samples collected from over 200 forest plots, including several AmeriFlux sites. The dataset also contains plot-level measurements of forest composition, structure (e.g., tree biomass), and productivity, as well as measurements of soil structure (e.g., bulk density) and chemistry (e.g., carbon). Publically-archiving regional datasets of standardized, co-located, and geo-referenced plant trait measurements will advance the ability of earth system models to capture species-level climate sensitivity at regional to global scales. PMID:26784559
Mineral Soil Carbon in Managed Hardwood Forests of the Northeastern US
Vario, C.; Friedland, A.; Hornig, C.
2013-12-01
New England is characterized by extensive forest cover and large reservoirs of soil carbon (C). In northern hardwood forests, mineral soil C can account for up to 50% of total ecosystem C. There has been an increasing demand for forests to serve both as a C sink and a renewable energy source, and effective management of the ecosystem C balance relies on accurate modeling of each compartment of the ecosystem. However, the dynamics of soil C storage with respect to forest use are variable and poorly understood, particularly in mineral soils. For example, current regional models assume C pools after forest harvesting do not change, while some studies suggest that belowground mineral soil C pools can be affected by disturbances at the soil surface. We quantified mineral soil C pools in previously clear-cut stands in seven research or protected forests across New York, New Hampshire, Massachusetts, and Vermont. The ages of the sites sampled ranged from recently cleared to those with no disturbance history, with 21 forest stands represented in the study. Within each research forest studied, physical parameters such as soil type, forest type, slope and land-use history (aside from forest harvest) did not vary between the stands of different ages. Soil samples were collected to a depth of 60 cm below the mineral-organic boundary using a gas-powered augur and 9.5-cm diameter drill bit. Samples were collected in 10-cm increments in shallow mineral soil and 15-cm increments from 30-60 cm depth. Carbon, nitrogen (N), pH, texture and soil mineralogy were measured across the regional sites. At Bartlett Experimental Forest (BEF) in New Hampshire, mineral soil biogeochemistry in cut and uncut sites was studied at a finer scale. Measurements included soil temperature to 55 cm depth, carbon compound analyses using Py-GCMS and soil microbial messenger RNA extractions from mineral soil. Finally, we simulated C dynamics after harvesting by building a model in Stella, with a particular
Cosmic-ray neutron transport at a forest field site
DEFF Research Database (Denmark)
Andreasen, Mie; Jensen, Karsten Høgh; Desilets, Darin
2017-01-01
-ray neutron intensity is essential (e.g., the effect of vegetation, litter layer and soil type). In this study the environmental effect is examined by performing a sensitivity analysis using neutron transport modeling. We use a neutron transport model with various representations of the forest and different...
Tree Regeneration in Church Forests of Ethiopia: Effects of Microsites and Management
Wassie Eshete, A.; Sterck, F.J.; Teketay, D.; Bongers, F.
2009-01-01
Tree regeneration is severely hampered in the fragmented afromontane forests of northern Ethiopia. We explored how trees regenerate in remnant forests along the gradient from open field, forest edge to closed sites and canopy gaps inside the forest. We investigated the effects of seed sowing, litter
The impact of nitrogen deposition on carbon sequestration in European forests and forest soils
DEFF Research Database (Denmark)
de Vries, Wim; Reinds, Gert Jan; Gundersen, Per
2006-01-01
for CO2 emissions because of harvest and forest fires, was assumed 33% of the overall C pool changes by growth. C sequestration in the soil were based on calculated nitrogen (N) retention (N deposition minus net N uptake minus N leaching) rates in soils, multiplied by the C/N ratio of the forest soils......An estimate of net carbon (C) pool changes and long-term C sequestration in trees and soils was made at more than 100 intensively monitored forest plots (level II plots) and scaled up to Europe based on data for more than 6000 forested plots in a systematic 16 km x 16 km grid (level I plots). C...... pool changes in trees at the level II plots were based on repeated forest growth surveys At the level I plots, an estimate of the mean annual C pool changes was derived from stand age and available site quality characteristics. C sequestration, being equal to the long-term C pool changes accounting...
Tunay, Metin
2006-07-01
Forest road construction by bulldozers in Calabrian Pine (Pinus brutia Ten.) forests on mountainous terrain of Turkey causes considerable damage to the environment and the forest standing alongside the road. This situation obliges a study of environmentally sound road construction in Turkey. This study was carried out in 4 sample sites of Antalya Forest Directorate in steep (34-50% gradient) and very steep terrain (51-70% gradient) conditions with bulldozer and excavator machine and direct damages to forest during road construction was determined, including forest area losses and damages to downhill trees in mountainous areas. It was determined that in steep terrain when excavators were used, less forest area (22.16%) was destroyed compared to bulldozers and 26.54% less area in very steep terrain. The proportion of damage on trees where bulldozer worked was nearly twofold higher than excavator was used. The results of this research show that the environmentally sensitive techniques applied for the road construction projects are considerably superior to the traditional use of bulldozers on steep slopes. The environmentally sound forest road construction by use of excavator must be considered an appropriate and reliable solution for mountainous terrain where areas of sensitive forest ecosystems are to be opened up.
Preferences for variation in forest characteristics
DEFF Research Database (Denmark)
Filyushkina, Anna; Taye, Fitalew Agimass; Lundhede, Thomas
2017-01-01
. This study aims at evaluating the effects of variation both within and between stands on recreational values. A choice experiment (CE) was applied to elicit people's preferences for forest types on their next recreational visit. Each alternative is presented with drawings of three forest stands which differ...... with respect to tree species, height (age) and distance to the site, the latter representing the cost factor – willingness-to-travel. Respondents also compose their ideal recreational forest by selecting three types of stands from the catalogue of drawings. We find that mixed tree species are preferred...
Large-scale indicators for monitoring forest diversity of the main forest types in Calabria (Italy
Directory of Open Access Journals (Sweden)
Infusino M
2017-02-01
Full Text Available Recently, the Society’s perception of forest resources has gone through significant changes. Forest ecosystems play a multifunctional role and host an important portion of the whole biodiversity, particularly in the Mediterranean area. Remote sensing technologies provide a unique way to obtain spatially extensive information on forest ecosystems, but relatively few studies used such information to evaluate forest habitat and biotic diversity. In this paper we evaluate the effectiveness of remote sensing to predict forest diversity by linking remotely sensed information with diversity metrics obtained from ground measurements of butterfly diversity. The field work was carried out in Calabria in four different forest types (beech, chestnut, black pine and silver fir forests. The sampling of Lepidoptera was carried out by LED light traps. We positioned 9 traps per forest type, for a total of 36 sites chosen to sample the different stages of forest succession in each forest type. Samples were carried out once a month from May to November 2015. Data from in situ butterfly measurements were compared with above ground forest biomass estimated from airborne LiDAR with NDVI estimated from Landsat 8. Results indicated that the Geometridae/Noctuideae ratio of lepidopteran communities was significantly correlated with the tree biomass, its distribution among tree size classes and the NDVI. The Geometridae/Noctuidae ratio, therefore, represents an index easy to calculate, which can be employed to integrate data acquired from remote sensing in order to obtain continuous spatial estimates of forest naturalness.
Using Biomass to Improve Site Quality and Carbon Sequestration
Bryce J. Stokes; Felipe G. Sanchez; Emily A. Carter
1998-01-01
The future demands on forest lands are a concern because of reduced productivity, especially on inherently poor sites, sites with long-depleted soils, or those soils that bear repeated, intensive short rotations. Forests are also an important carbon sink and, when well managed, can make even more significant contributions to sequestration and to reduction of greenhouse...
Directory of Open Access Journals (Sweden)
Nurul Hazlina Zaini
2014-12-01
Full Text Available Herbaceous plants are important components of total plant species richness in tropical forests. Ground herb diversity and abundance were studied in a lowland Mixed Dipterocarp forest (Andulau and a heath forest (Bukit Sawat in Brunei Darussalam, Borneo. At each site, all ground herbs in twenty randomly selected 10 × 10 m subplots within a one hectare permanent plot were censused and identified. The study recorded a total of 20 families and 32 genera of ground herbs, with the family Zingiberaceae as the most abundant at both sites. Thirteen genera were recorded only at Andulau and 7 genera were exclusive to Bukit Sawat, with twelve genera common to both sites. Ground herb species richness appear higher at Andulau than Bukit Sawat (37 vs. 29, but this difference was not statistically significant at the subplot level. However, ground herb abundance and density were significantly higher at Bukit Sawat than Andulau (n = 846 vs. 385; 4230 vs. 1925 individuals ha-1. The more open canopy at Bukit Sawat may provide higher light availability here than at Andulau, which is characterised by a closed canopy. We suggest that light availability is the most important environmental factor influencing ground herb density and abundance at these sites.
Regeneration complexities of Pinus gerardiana in dry temperate forests of Indian Himalaya.
Kumar, Raj; Shamet, G S; Mehta, Harsh; Alam, N M; Kaushal, Rajesh; Chaturvedi, O P; Sharma, Navneet; Khaki, B A; Gupta, Dinesh
2016-04-01
Pinus gerardiana is considered an important species in dry temperate forests of North-Western Indian Himalaya because of its influence on ecological processes and economic dependence of local people in the region. But, large numbers of biotic and abiotic factors have affected P. gerardiana in these forests; hence, there is a crucial need to understand the regeneration dynamics of this tree species. The present investigation was conducted in P. gerardiana forests to understand vegetation pattern and regeneration processes on different sites in the region. Statistical analysis was performed to know variability in growing stock and regeneration on sample plots, while correlation coefficients and regression models were developed to find the relationship between regeneration and site factors. The vegetation study showed dominance of P. gerardiana, which is followed by Cedrus deodara, Pinus wallichiana and Quercus ilex in the region. The growing stock of P. gerardiana showed steep increasing and then steadily declining trend from lower to higher diameter class. The distribution of seedling, sapling, pole and trees was not uniform at different sites and less number of plots in each site were observed to have effective conditions for continuous regeneration, but mostly showed extremely limited regeneration. Regeneration success ranging from 8.44 to 15.93 % was recorded in different sites of the region, which suggests that in different sites regeneration success is influenced by collection of cone for extracting seed, grazing/browsing and physico-chemical properties of soil. Regeneration success showed significant correlation and relationship with most of abiotic and biotic factors. The regeneration success is lower than the requirement of sustainable forest, but varies widely among sites in dry temperate forests of Himalaya. More forest surveys are required to understand the conditions necessary for greater success of P. gerardiana in the region.
Matt D. Busse; Felipe G. Sanchez; Alice W. Ratcliff; John R. Butnor; Emily A. Carter; Robert F. Powers
2009-01-01
Sequestering carbon (C) in forest soils can benefit site fertility and help offset greenhouse gas emissions. However, identifying soil conditions and forest management practices which best promote C accumulation remains a challenging task. We tested whether soil incorporation of masticated woody residues alters short-term C storage at forested sites in western and...
Rolim, Samir Gonçalves; Sambuichi, Regina Helena Rosa; Schroth, Götz; Nascimento, Marcelo Trindade; Gomes, José Manoel Lucio
2017-03-01
Cocoa agroforests like the cabrucas of Brazil's Atlantic forest are among the agro-ecosystems with greatest potential for biodiversity conservation. Despite a global trend for their intensification, cocoa agroforests are also being abandoned for socioeconomic reasons especially on marginal sites, because they are incorporated in public or private protected areas, or are part of mandatory set-asides under Brazilian environmental legislation. However, little is known about phylogenetic structure, the processes of forest regeneration after abandonment and the conservation value of former cabruca sites. Here we compare the vegetation structure and composition of a former cabruca 30-40 years after abandonment with a managed cabruca and mature forest in the Atlantic forest region of Espirito Santo, Brazil. The forest in the abandoned cabruca had recovered a substantial part of its original structure. Abandoned cabruca have a higher density (mean ± CI95 %: 525.0 ± 40.3 stems per ha), basal area (34.0 ± 6.5 m 2 per ha) and species richness (148 ± 11.5 species) than managed cabruca (96.0 ± 17.7; 24.15 ± 3.9 and 114.5 ± 16.0, respectively) but no significant differences to mature forest in density (581.0 ± 42.2), basal area (29.9.0 ± 3.3) and species richness (162.6 ± 15.5 species). Thinning (understory removal) changes phylogenetic structure from evenness in mature forest to clustering in managed cabruca, but after 30-40 years abandoned cabruca had a random phylogenetic structure, probably due to a balance between biotic and abiotic filters at this age. We conclude that abandoned cocoa agroforests present highly favorable conditions for the regeneration of Atlantic forest and could contribute to the formation of an interconnected network of forest habitat in this biodiversity hotspot.
Simulation of the Effect of Intensive Forest Management on Forest Production in Sweden
Directory of Open Access Journals (Sweden)
Ola Rosvall
2011-03-01
Full Text Available The effects of intensifying the management of 15% of the Swedish forest land on potential future forest production over a 100-year period were investigated in a simulation study. The intensive management treatments, which were introduced over a period of 50 years, were: intensive fertilization of Norway spruce (IntFert; bulking-up Norway spruce elite populations using somatic embryogenesis (SE-seedlings; planting of lodgepole pine, hybrid larch, and Sitka spruce (Contorta, Larch, and Sitka; fertilization with wood ash on peatlands (Wood ash; and conventional fertilization in mature forests (ConFert. Potential sites for applying intensive forest management (IFM to sites with low nature conservation values were determined with a nature conservation score (NCS. Four different scenarios were simulated: “Base scenario”, which aimed at reducing the negative impact on nature conservation values, “Fast implementation”, “No IntFert” (IntFert was not used, and “Large Forest Companies”, where the majority of plots were selected on company land. Total yields during the 100-year simulation period were about 85–92% higher for the intensive forest management scenarios than for the reference scenario (business as usual. In the “No IntFert” scenario total production was 1.8% lower and in the “Large Forest Companies” scenario total production was 4.8% lower than in the “Base scenario”. “Fast implementation” of IFM increased yield by 15% compared to the “Base scenario”. Norway spruce SE-seedlings and IntFert gave the highest yields, measured as total production during the 100-year simulation period, but relative to the yields in the reference scenario, the highest increases in yield were for Contorta. The “Base scenario” and “No IntFert” gave the highest yields for plots with the lowest NCS, but plots with higher NCS had to be used in the “Fast implementation” and “Large Forest Companies” scenarios. More than
ORGEST: Regional guidelines and silvicultural models for sustainable forest management
Energy Technology Data Exchange (ETDEWEB)
Piqué, Míriam; Vericat, Pau; Beltrán, Mario
2017-11-01
Aim of the study: To develop regional guidelines for sustainable forest management. Area of the study: Forests of Catalonia (NE Spain). Material and methods: The process of developing the forest management guidelines (FMG) started by establishing a thorough classification of forest types at stand level. This classification hinges on two attributes: tree species composition and site quality based on ecological variables, which together determine potential productivity. From there, the management guidelines establish certain objectives and silvicultural models for each forest type. The forest type classifications, like the silvicultural models, were produced using both existing and newly-built growth models based on data from the National Forest Inventory (NFI) and expert knowledge. The effort involved over 20 expert working groups in order to better integrate the expertise and vision of different sectorial agents. Main results: The FMG consist in quantitative silvicultural models that include typical silvicultural variables, technical descriptions of treatments and codes of good practice. Guidelines now cover almost all forest types in Catalonia (spanning up to 90% of the Catalan forest area). Different silvicultural models have been developed for pure and mixed stands, different site quality classes (2–3 classes per species), and even- and multi-aged stands. Research highlights: FMG: i) orient the management of private and public forests, (ii) provide a technical scaffold for efficient allocation/investment of public subsidies in forest management, and (iii) bridge forest planning instruments at regional (strategic-tactical) and stand (operational) level.
ORGEST: Regional guidelines and silvicultural models for sustainable forest management
International Nuclear Information System (INIS)
Piqué, Míriam; Vericat, Pau; Beltrán, Mario
2017-01-01
Aim of the study: To develop regional guidelines for sustainable forest management. Area of the study: Forests of Catalonia (NE Spain). Material and methods: The process of developing the forest management guidelines (FMG) started by establishing a thorough classification of forest types at stand level. This classification hinges on two attributes: tree species composition and site quality based on ecological variables, which together determine potential productivity. From there, the management guidelines establish certain objectives and silvicultural models for each forest type. The forest type classifications, like the silvicultural models, were produced using both existing and newly-built growth models based on data from the National Forest Inventory (NFI) and expert knowledge. The effort involved over 20 expert working groups in order to better integrate the expertise and vision of different sectorial agents. Main results: The FMG consist in quantitative silvicultural models that include typical silvicultural variables, technical descriptions of treatments and codes of good practice. Guidelines now cover almost all forest types in Catalonia (spanning up to 90% of the Catalan forest area). Different silvicultural models have been developed for pure and mixed stands, different site quality classes (2–3 classes per species), and even- and multi-aged stands. Research highlights: FMG: i) orient the management of private and public forests, (ii) provide a technical scaffold for efficient allocation/investment of public subsidies in forest management, and (iii) bridge forest planning instruments at regional (strategic-tactical) and stand (operational) level.
Regional constraints to biological nitrogen fixation in post-fire forest communities
Yelenik, Stephanie; Perakis, Steven S.; Hibbs, David
2013-01-01
Biological nitrogen fixation (BNF) is a key ecological process that can restore nitrogen (N) lost in wildfire and shape the pace and pattern of post-fire forest recovery. To date, there is limited information on how climate and soil fertility interact to influence different pathways of BNF in early forest succession. We studied asymbiotic (forest floor and soil) and symbiotic (the shrub Ceanothus integerrimus) BNF rates across six sites in the Klamath National Forest, California, USA. We used combined gradient and experimental phosphorus (P) fertilization studies to explore cross-site variation in BNF rates and then related these rates to abiotic and biotic variables. We estimate that our measured BNF rates 22 years after wildfire (6.1–12.1 kg N·ha-1·yr-1) are unlikely to fully replace wildfire N losses. We found that asymbiotic BNF is P limited, although this is not the case for symbiotic BNF in Ceanothus. In contrast, Ceanothus BNF is largely driven by competition from other vegetation: in high-productivity sites with high potential evapotranspiration (Et), shrub biomass is suppressed as tree biomass increases. Because shrub biomass governed cross-site variation in Ceanothus BNF, this competitive interaction led to lower BNF in sites with high productivity and Et. Overall, these results suggest that the effects of nutrients play a larger role in driving asymbiotic than symbiotic fixation across our post-fire sites. However, because symbiotic BNF is 8–90x greater than asymbiotic BNF, it is interspecific plant competition that governs overall BNF inputs in these forests.
Nutrient cycling in Huntington Forest and Turkey Lakes deciduous stands: Nitrogen and sulfur
Energy Technology Data Exchange (ETDEWEB)
Mitchell, M J [State Univ. of New York, Syracuse, NY (USA); Foster, N W; Morrison, I K [Forestry Canada, Sault Ste. Marie, ON (Canada); Shepard, J P [National Council of the Paper Industry for Air and Stream Improvement, Gainsville, FL (USA)
1992-01-01
A study was conducted to analyze two tolerant hardwood forests that are exhibiting different levels of nitrate and sulfate leaching. Fluxes of N and S at the two sites were compared, and the fluxes of nitrate and sulfate through the forest canopy, forest floor, and mineral soil were determined in order to ascertain whether differences in these fluxes could be explained using information on the N, S, and C biogeochemistry of each site. One site is in the Adirondack region, where the impacts of acidic deposition have been noted; the other site is in central Ontario, and has geological, pedological, and hydrological characteristics that make it potentially sensitive to acidic deposition. An increase in concentration of sulfate and nitrate was noted after passage through the canopy at both sites. The Ontario site showed much greater leaching of nitrate. At the Adirondack site only, there was a marked increase in sulfate flux when water leached from the forest floor through the soil. The mineral soil was the largest pool of N and S for both sites. The Ontario soil had a C/N ratio of 16:1, narrower than the 34:1 ratio of the soil at the other site. The former ratio should favor accumulation of ammonium and nitrate ions, and subsequent nitrate leaching. Laboratory measurements suggest that the forest floor at the Ontario site may have higher N mineralization rates. Fluxes of N and S within the vegetation were generally similar at both sites. The higher nitrate leaching at the Ontario site may be attributed mostly to stand maturity coupled with tree mortality, but the absence of slow decomposing beech leaf litter and lower C/N ratio in the soil may also be contributing factors. 50 refs., 3 figs., 6 tabs.
Energy efficiency in U.S. Forest Service facilities: a multiregion review
Rachelle S. Meyer; David L. Nicholls; Trista M. Patterson; Rachel E. White
2013-01-01
We reviewed energy efficiency measures in facilities across the U.S. Department of Agriculture Forest Service, examining opportunities and obstacles, and identifying factors of project success. The adoption of energy efficiency measures at Forest Service sites was seen to be most likely when decision control was local to the site and when budget timing and structures...
Landscape and vegetation effects on avian reproduction on bottomland forest restorations
Twedt, Daniel J.; Somershoe, Scott G.; Hazler, Kirsten R.; Cooper, Robert J.
2010-01-01
Forest restoration has been undertaken on >200,000 ha of agricultural land in the Mississippi Alluvial Valley, USA, during the past few decades. Decisions on where and how to restore bottomland forests are complex and dependent upon landowner objectives, but for conservation of silvicolous (forest-dwelling) birds, ecologists have espoused restoration through planting a diverse mix of densely spaced seedlings that includes fast-growing species. Application of this planting strategy on agricultural tracts that are adjacent to extant forest or within landscapes that are predominately forested has been advocated to increase forest area and enhance forested landscapes, thereby benefiting area-sensitive, silvicolous birds. We measured support for these hypothesized benefits through assessments of densities of breeding birds and reproductive success of 9 species on 36 bottomland forest restoration sites. Densities of thamnic (shrub-scrub dwelling) and silvicolous birds, such as yellow-breasted chat (Icteria virens), indigo bunting (Passerina cyanea), and white-eyed vireo (Vireo griseus) were positively associated with 1) taller trees, 2) greater stem densities, and 3) a greater proportion of forest within the landscape, whereas densities of birds associated with grasslands, such as dickcissel (Spiza americana) and red-winged blackbird (Agelaius phoeniceus), were negatively associated with these variables. Vegetation structure, habitat edge, and temporal effects had greater influence on nest success than did landscape effects. Taller trees, increased density of woody stems, greater vegetation density, and more forest within the landscape were often associated with greater nest success. Nest success of grassland birds was positively related to distance from forest edge but, for thamnic birds, success was greater near edges. Moreover, nest success and estimated fecundity of thamnic species suggested their populations are self-sustaining on forest restoration sites, whereas
Carbon in boreal coniferous forest soil
Energy Technology Data Exchange (ETDEWEB)
Westman, C J; Ilvesniemi, H; Liski, J; Mecke, M [Helsinki Univ. (Finland). Dept. of Forest Ecology; Fritze, H; Helmisaari, H S; Pietikaeinen, J; Smolander, A [Finnish Forest Research Inst., Vantaa (Finland)
1997-12-31
The working hypothesis of the research was that the soil of boreal forests is a large carbon store and the amount of C is still increasing in young soils, like in the forest soils of Finland, which makes these soils important sinks for atmospheric CO{sub 2}. Since the processes defining the soil C balance, primary production of plants and decomposition, are dependent on environmental factors and site properties, it was assumed that the organic carbon pool in the soil is also dependent on the same factors. The soil C store is therefore likely to change in response to climatic warming. The aim of this research was to estimate the C balance of forest soil in Finland and predict changes in the balance in response to changes in climatic conditions. To achieve the aim (1) intensive empirical experimentation on the density of C in different pools in the soil and on fluxes between the pools was done was done, (2) the effect of site fertility and climate on the amount and properties of organic C in forest soil was investigated and (3) dynamic modelling for investigating dynamics of the soil C storage was used
Carbon in boreal coniferous forest soil
Energy Technology Data Exchange (ETDEWEB)
Westman, C.J.; Ilvesniemi, H.; Liski, J.; Mecke, M. [Helsinki Univ. (Finland). Dept. of Forest Ecology; Fritze, H.; Helmisaari, H.S.; Pietikaeinen, J.; Smolander, A. [Finnish Forest Research Inst., Vantaa (Finland)
1996-12-31
The working hypothesis of the research was that the soil of boreal forests is a large carbon store and the amount of C is still increasing in young soils, like in the forest soils of Finland, which makes these soils important sinks for atmospheric CO{sub 2}. Since the processes defining the soil C balance, primary production of plants and decomposition, are dependent on environmental factors and site properties, it was assumed that the organic carbon pool in the soil is also dependent on the same factors. The soil C store is therefore likely to change in response to climatic warming. The aim of this research was to estimate the C balance of forest soil in Finland and predict changes in the balance in response to changes in climatic conditions. To achieve the aim (1) intensive empirical experimentation on the density of C in different pools in the soil and on fluxes between the pools was done was done, (2) the effect of site fertility and climate on the amount and properties of organic C in forest soil was investigated and (3) dynamic modelling for investigating dynamics of the soil C storage was used
Long-term response of Caribbean palm forests to hurricanes
Ariel Lugo; J.L. Frangi
2016-01-01
We studied the response of Prestoea montana (Sierra Palm, hereafter Palm) brakes and a Palm floodplain forest to hurricanes in the Luquillo Experimental Forest in Puerto Rico. Over a span of 78 years, 3 hurricanes passed over the study sites for which we have 64 years of measurements for Palm brakes and 20 years for the Palm floodplain forest. For each stand, species...
Disturbing forest disturbances
Energy Technology Data Exchange (ETDEWEB)
Volney, W.J.A.; Hirsch, K.G. [Natural Resources Canada, Canadian Forest Service, Northern Forestry Centre, Edmonton, AB (Canada)
2005-10-01
This paper described the role that disturbances play in maintaining the ecological integrity of Canadian boreal forests. Potential adaptation options to address the challenges that these disturbances present were also examined. Many forest ecosystems need fire for regeneration, while other forests rely on a cool, wet disintegration process driven by insects and commensal fungi feeding on trees to effect renewal. While there are characteristic natural, temporal and spatial patterns to these disturbances, recent work has demonstrated that the disturbances are being perturbed by climatic change that has been compounded by anthropogenic disturbances in forests. Fire influences species composition and age structure, regulates forest insects and diseases, affects nutrient cycling and energy fluxes, and maintains the productivity of different habitats. Longer fire seasons as a result of climatic change will lead to higher intensity fires that may more easily evade initial attacks and become problematic. Fire regimes elevated beyond the range of natural variation will have a dramatic effect on the regional distribution and functioning of forest ecosystems and pose a threat to the safety and prosperity of people. While it was acknowledged that if insect outbreaks were to be controlled on the entire forest estate, the productivity represented by dead wood would be lost, it was suggested that insects such as the forest tent caterpillar and the spruce bud worm may also pose a greater threat as the climate gets warmer and drier. Together with fungal associates, saproxylic arthropods are active in nutrient cycling and ultimately determine the fertility of forest sites. It was suggested that the production of an age class structure and forest mosaic would render the forest landscape less vulnerable to the more negative aspects of climate change on vegetation response. It was concluded that novel management design paradigms are needed to successfully reduce the risk from threats
Forecasting the forest and the trees: consequences of drought in competitive forests
Clark, J. S.
2015-12-01
Models that translate individual tree responses to distribution and abundance of competing populations are needed to understand forest vulnerability to drought. Currently, biodiversity predictions rely on one scale or the other, but do not combine them. Synthesis is accomplished here by modeling data together, each with their respective scale-dependent connections to the scale needed for prediction—landscape to regional biodiversity. The approach we summarize integrates three scales, i) individual growth, reproduction, and survival, ii) size-species structure of stands, and iii) regional forest biomass. Data include 24,347 USDA Forest Inventory and Analysis (FIA) plots and 135 Long-term Forest Demography plots. Climate, soil moisture, and competitive interactions are predictors. We infer and predict the four-dimensional size/species/space/time (SSST) structure of forests, where all demographic rates respond to winter temperature, growing season length, moisture deficits, local moisture status, and competition. Responses to soil moisture are highly non-linear and not strongly related to responses to climatic moisture deficits over time. In the Southeast the species that are most sensitive to drought on dry sites are not the same as those that are most sensitive on moist sites. Those that respond most to spatial moisture gradients are not the same as those that respond most to regional moisture deficits. There is little evidence of simple tradeoffs in responses. Direct responses to climate constrain the ranges of few tree species, north or south; there is little evidence that range limits are defined by fecundity or survival responses to climate. By contrast, recruitment and the interactions between competition and drought that affect growth and survival are predicted to limit ranges of many species. Taken together, results suggest a rich interaction involving demographic responses at all size classes to neighbors, landscape variation in moisture, and regional
DEFF Research Database (Denmark)
Göckede, M.; Foken, T.; Aubinet, M.
2008-01-01
We applied a site evaluation approach combining Lagrangian Stochastic footprint modeling with a quality assessment approach for eddy-covariance data to 25 forested sites of the CarboEurope-IP network. The analysis addresses the spatial representativeness of the flux measurements, instrumental...... of the surrounding terrain, while the latent heat flux is subject to instrumentation-related problems. The Planar-Fit coordinate rotation proved to be a reliable tool for the majority of the sites using only a single set of rotation angles. Overall, we found a high average data quality for the CarboEurope-IP network...... effects on data quality, spatial patterns in the data quality, and the performance of the coordinate rotation method. Our findings demonstrate that application of a footprint filter could strengthen the CarboEurope-IP flux database, since only one third of the sites is situated in truly homogeneous...
Avian distribution in treefall gaps and understorey of terra firme forest in the lowland Amazon
JR WUNDERLE; MICHAEL R. WILLIG; LUIZA MAGALLI PINTO HENRIQUES
2005-01-01
We compared the bird distributions in the understorey of treefall gaps and sites with intact canopy in Amazonian terra firme forest in Brazil. We compiled 2216 mist-net captures (116 species) in 32 gap and 32 forest sites over 22.3 months. Gap habitats differed from forest habitats in having higher capture rates, total captures, species richness and diversity....
International Nuclear Information System (INIS)
Ota, Masakazu; Nagai, Haruyasu; Koarashi, Jun
2016-01-01
A process-based model for "1"3"7Cs transfer in forest surface environments was developed to assess the dynamic behavior of Fukushima-derived "1"3"7Cs in a Japanese forest. The model simulation successfully reproduced the observed data from 3 year migration of "1"3"7Cs in the organic and mineral soil layers at a contaminated forest near Fukushima. The migration of "1"3"7Cs from the organic layer to the mineral soil was explained by the direct deposition pattern on the forest floor and the turnover of litter materials in the organic layer under certain ecological conditions. Long-term predictions indicated that more than 90% of the deposited "1"3"7Cs would remain within the top 5 cm of the soil for up to 30 years after the accident, suggesting that the forest acts as an effective long-term reservoir of "1"3"7Cs with limited transfer via the groundwater pathway. The model was also used to explore the potential impacts of soil organic matter (SOM) interactions on the mobility and bioavailability of "1"3"7Cs in the soil–plant system. The simulation results for hypothetical organic soils with modified parameters of "1"3"7Cs turnover revealed that the SOM-induced reduction of "1"3"7Cs adsorption elevates the fraction of dissolved "1"3"7Cs in the soil solution, thereby increasing the soil-to-plant transfer of "1"3"7Cs without substantially altering the fractional distribution of "1"3"7Cs in the soil. Slower fixation of "1"3"7Cs on the flayed edge site of clay minerals and enhanced mobilization of the clay-fixed "1"3"7Cs in organic-rich soils also appeared to elevate the soil-to-plant transfer of "1"3"7Cs by increasing the fraction of the soil-adsorbed (exchangeable) "1"3"7Cs. A substantial proportion (approximate 30%–60%) of "1"3"7Cs in these organic-rich soils was transferred to layers deeper than 5 cm decades later. These results suggested that SOM influences the behavior of "1"3"7Cs in forests over a prolonged period through alterations of adsorption and fixation in
Horses help to maintain CERN's forests
François Briard
2016-01-01
On the initiative of the Office National des Forêts, France’s forestry commission, horses are helping to remove trees cut down in CERN’s forests. The CERN site covers 625 hectares, of which around 200 are fenced sites used for CERN’s research activities. The rest of the land consists of fields rented out to farmers and about 90 hectares of forests, mainly in France and managed by the French forestry commission, the Office National des Forêts (ONF), under an agreement with CERN signed in 2010. The upkeep of CERN’s forests requires regular maintenance work, which includes thinning out seedlings, selecting the strongest saplings and harvesting mature trees. This June, the ONF has decided to involve horses in the removal of felled trees from CERN’s woods in Prévessin. As Florent Daloz, the logger entrusted with this activity by the ONF, explains, the use of horses to haul timber completely died out i...
García, Mariano; Saatchi, Sassan; Ustin, Susan; Balzter, Heiko
2018-04-01
Spatially-explicit information on forest structure is paramount to estimating aboveground carbon stocks for designing sustainable forest management strategies and mitigating greenhouse gas emissions from deforestation and forest degradation. LiDAR measurements provide samples of forest structure that must be integrated with satellite imagery to predict and to map landscape scale variations of forest structure. Here we evaluate the capability of existing satellite synthetic aperture radar (SAR) with multispectral data to estimate forest canopy height over five study sites across two biomes in North America, namely temperate broadleaf and mixed forests and temperate coniferous forests. Pixel size affected the modelling results, with an improvement in model performance as pixel resolution coarsened from 25 m to 100 m. Likewise, the sample size was an important factor in the uncertainty of height prediction using the Support Vector Machine modelling approach. Larger sample size yielded better results but the improvement stabilised when the sample size reached approximately 10% of the study area. We also evaluated the impact of surface moisture (soil and vegetation moisture) on the modelling approach. Whereas the impact of surface moisture had a moderate effect on the proportion of the variance explained by the model (up to 14%), its impact was more evident in the bias of the models with bias reaching values up to 4 m. Averaging the incidence angle corrected radar backscatter coefficient (γ°) reduced the impact of surface moisture on the models and improved their performance at all study sites, with R2 ranging between 0.61 and 0.82, RMSE between 2.02 and 5.64 and bias between 0.02 and -0.06, respectively, at 100 m spatial resolution. An evaluation of the relative importance of the variables in the model performance showed that for the study sites located within the temperate broadleaf and mixed forests biome ALOS-PALSAR HV polarised backscatter was the most important
Salm,Rodolfo
2005-01-01
The hypothesis that forest disturbance is important for the recruitment of the large arborescent palms Attalea maripa was tested with a natural experiment in the Pinkaití site (7º 46'S; 51º 57'W), a seasonally-dry Amazonian forest. A 8,000 m long trail, that crosses, in its lower half, an open forest along the Pinkaití stream bottomlands and, on its upper half, a dense forest on a hill, was divided in 160 0.15 ha (50x30 m) sampling units. At each unit, adult palms were counted and percentage ...
Pannatier, Elisabeth Graf; Thimonier, Anne; Schmitt, Maria; Walthert, Lorenz; Waldner, Peter
2011-03-01
Trends in atmospheric acid deposition and in soil solution acidity from 1995 or later until 2007 were investigated at several forest sites throughout Switzerland to assess the effects of air pollution abatements on deposition and the response of the soil solution chemistry. Deposition of the major elements was estimated from throughfall and bulk deposition measurements at nine sites of the Swiss Long-Term Forest Ecosystem Research network (LWF) since 1995 or later. Soil solution was measured at seven plots at four soil depths since 1998 or later. Trends in the molar ratio of base cations to aluminum (BC/Al) in soil solutions and in concentrations and fluxes of inorganic N (NO(3)-N + NH(4)-N), sulfate (SO(4)-S), and base cations (BC) were used to detect changes in soil solution chemistry. Acid deposition significantly decreased at three out of the nine study sites due to a decrease in total N deposition. Total SO(4)-S deposition decreased at the nine sites, but due to the relatively low amount of SO(4)-S load compared to N deposition, it did not contribute to decrease acid deposition significantly. No trend in total BC deposition was detected. In the soil solution, no trend in concentrations and fluxes of BC, SO(4)-S, and inorganic N were found at most soil depths at five out of the seven sites. This suggests that the soil solution reacted very little to the changes in atmospheric deposition. A stronger reduction in base cations compared to aluminum was detected at two sites, which might indicate that acidification of the soil solution was proceeding faster at these sites.
Caraboidea distribution in different forest stands Chrea National Park, Algeria
International Nuclear Information System (INIS)
Belhadid, Z.; Gahdeb, C.; Ghalem, M.; Haddar, L.; Boughrara, H.
2013-01-01
T he distribution of the ground beetles in different forests of the national park of Chrea (Blida, Algerie) using pitfall traps was investigated . A total of 29 species of Caraboidea , in seven families, were collected, with the chestnut and holm oak forests were the most diversified sites with 16 species each. The family Pterostichidae is the richest with nine specie s. The distribution of the species of Caraboidea was influenced by the site altitude, since the site vegetation composition and fluctuations are dependent on several ecological parameters. (author)
Joseph Wunderle, Jr; Wayne J. Arendt
2011-01-01
The Luquillo Experimental Forest (LEF) located on the Caribbean island of Puerto Rico has a rich history of ecological research, including a variety of avian studies, and is one of the most active ecological research sites in the Neotropics. The LEF spans an elevational range from 100 to 1075mover which five life zones and four forest types are found in a warm, humid...
Use of ash in the fertilisation of peatland forests
International Nuclear Information System (INIS)
Moilanen, M.; Korpilahti, A.
2000-01-01
About 100,000 tonnes of bark and other wood-based ash are produced annually by the forest industries and heating plants in Finland. This amount would be sufficient for fertilising about 25,000 hectares of forest. When applied to peatland forests, this would produce extra forest growth of about 75,000 m 3 per a year. When considering the objectives of forestry, the practical benefits and economic profitability of ash fertilisation are at their peak on peatlands rich in nitrogen. Wood ash induces added tree growth (measured in terms of stemwood) in pine stands on herb- and sedge-rich parklands within 2-3 years of application. On nitrogen-deficient dwarf-shrub and Sphagnum-rich peatlands this growth reaction manifests itself only after 7-8 years have passed and even then at a considerably lower level. The application of mere ash does not result in notable increases in tree growth on upland forest sites. However, ash does change the growth conditions by reducing the acidity of the soil and by accelerating microbial decomposition. The phosphorus contained in ash has not been observed to have been leached into drainage waters on drained sites, at least not during the first two years after application, provided that care has been practised when spreading ash. However, the movement of readily-soluble nutrients has been observed and more so on nutrient-poor sites than on nutrient-rich sites. Although the suitability of ash as fertiliser in peatland forests has been recognised on the basis of long-term ash trials established at the Finnish Forest Research Institute, ash fertilisation has not been carried out made on a practical scale mainly because of the dust problem when spreading it. The purpose of pretreatment with ash is first and foremost to transform the ash into sufficiently dust-free form to enable it to be spread readily. An added advantage is that pelletised ash causes a lesser pH shock to plank than ash in dust form. (orig.)
Height-diameter allometry of tropical forest trees
T.R. Feldpausch; L. Banin; O.L. Phillips; T.R. Baker; S.L. Lewis; C.A. Quesada; K. Affum-Baffoe; E.J.M.M. Arets; N.J. Berry; M. Bird; E.S. Brondizio; P de Camargo; J. Chave; G. Djagbletey; T.F. Domingues; M. Drescher; P.M. Fearnside; M.B. Franca; N.M. Fyllas; G. Lopez-Gonzalez; A. Hladik; N. Higuchi; M.O. Hunter; Y. Iida; K.A. Salim; A.R. Kassim; M. Keller; J. Kemp; D.A. King; J.C. Lovett; B.S. Marimon; B.H. Marimon-Junior; E. Lenza; A.R. Marshall; D.J. Metcalfe; E.T.A. Mitchard; E.F. Moran; B.W. Nelson; R. Nilus; E.M. Nogueira; M. Palace; S. Patiño; K.S.-H. Peh; M.T. Raventos; J.M. Reitsma; G. Saiz; F. Schrodt; B. Sonke; H.E. Taedoumg; S. Tan; L. White; H. Woll; J. Lloyd
2011-01-01
Tropical tree height-diameter (H:D) relationships may vary by forest type and region making large-scale estimates of above-ground biomass subject to bias if they ignore these differences in stem allometry. We have therefore developed a new global tropical forest database consisting of 39 955 concurrent H and D measurements encompassing 283 sites in 22 tropical...
Metal partitioning and uptake in central Ontario forests
International Nuclear Information System (INIS)
Watmough, Shaun A.; Dillon, Peter J.; Epova, Ekaterina N.
2005-01-01
Evaluation of the potential environmental risk posed by metals depends to a great extent on modeling the fate and mobility of metals with soil-solution partitioning coefficients (K d ). However, the effect of biological cycling on metal partitioning is rarely considered in standard risk assessments. We determined soil-solution partitioning coefficients for 5 metals (Cd, Zn, Pb, Co and Ni) at 46 forested sites that border the Precambrian Shield in central Ontario, where soil pH aq varied from 3.9 to 8.1. Foliage from the dominant tree species and forest floor samples were also collected from each site to compare their metal levels with K d predictions. Analogous to other studies, log K d values for all metals were predicted by empirical linear regression with soil pH (r 2 = 0.66-0.72), demonstrating that metal partitioning between soil and soil solution can be reliably predicted for relatively unpolluted forest mineral soils by soil pH. In contrast, whereas the so-called bioavailable water-soluble metal fraction could be predicted from soil pH, metal concentrations in foliage and the forest floor at each site were not consistently related to pH. Risk assessment of metals should take into account the role of biota in metal cycling and partitioning in forests, particularly if metal bio-accumulation and chronic toxicity in the food chain, rather than metal mobility in soils, are of primary concern. - Metal cycling by plants should be considered in risk assessment studies
Effects of ionizing radiation on the boreal forest
International Nuclear Information System (INIS)
Amiro, B.D.
1995-08-01
The Field-Irradiator-Gamma (FIG) project chronically exposed a section of the boreal forest to ionizing radiation by placing a 137 Cs source on tope of a 20-m tower at a forest site in southeastern Manitoba. The irradiation continued from 1973 to 1986 and the forest was exposed to radiological dose rates ranging from 65 mGy.h -1 to 0.005 mGy.h -1 along a gradient extending 500 m from the source. The irradiation killed the tree canopy close to the irradiator, resulting in the formation of a herbaceous zone of vegetation at high dose rates. After 14 years of irradiation, some tree species were still being affected at dose rates as low as about 1 mGy.h -1 . The data gathered at the FIG site can be used to identify radiological dose rates that forest communities can tolerate. This information allows decisions to be made concerning guidelines for protection of the general environment from radionuclide emissions from various anthropogenic sources, such as nuclear reactors and uranium tailings. This report reviews the previous data collected at the FIG site during the pre-irradiation and irradiation phases and the methodology used to establish a baseline for future comparisons. Permanently marked sampling plots are a particular strength to the study, whereby researchers can compare the present forest community with that measured during the past 25 years. (author). 53 refs., 6 tabs., 22 figs
Effects of ionizing radiation on the boreal forest
Energy Technology Data Exchange (ETDEWEB)
Amiro, B D [Atomic Energy of Canada Ltd., Chalk River, ON (Canada). Chalk River Nuclear Labs.
1995-08-01
The Field-Irradiator-Gamma (FIG) project chronically exposed a section of the boreal forest to ionizing radiation by placing a {sup 137}Cs source on tope of a 20-m tower at a forest site in southeastern Manitoba. The irradiation continued from 1973 to 1986 and the forest was exposed to radiological dose rates ranging from 65 mGy.h{sup -1} to 0.005 mGy.h{sup -1} along a gradient extending 500 m from the source. The irradiation killed the tree canopy close to the irradiator, resulting in the formation of a herbaceous zone of vegetation at high dose rates. After 14 years of irradiation, some tree species were still being affected at dose rates as low as about 1 mGy.h{sup -1}. The data gathered at the FIG site can be used to identify radiological dose rates that forest communities can tolerate. This information allows decisions to be made concerning guidelines for protection of the general environment from radionuclide emissions from various anthropogenic sources, such as nuclear reactors and uranium tailings. This report reviews the previous data collected at the FIG site during the pre-irradiation and irradiation phases and the methodology used to establish a baseline for future comparisons. Permanently marked sampling plots are a particular strength to the study, whereby researchers can compare the present forest community with that measured during the past 25 years. (author). 53 refs., 6 tabs., 22 figs.
Atmospheric heavy metal input to forest soils in rural areas of Denmark
DEFF Research Database (Denmark)
Hovmand, Mads Frederik; Kemp, Kaare
2007-01-01
Atmospheric bulk deposition of heavy metals (HM) was measured from 1972/73 to the present time at five to ten forest sites in rural areas of Denmark. From 1979, HM in aerosols were measured at one to four forest sites. On the basis of these long-term continuous measurements, the atmospheric inputs...
Campbell, Mason J; Edwards, Will; Magrach, Ainhoa; Alamgir, Mohammed; Porolak, Gabriel; Mohandass, D; Laurance, William F
2018-04-01
Closed-canopy forests are being rapidly fragmented across much of the tropical world. Determining the impacts of fragmentation on ecological processes enables better forest management and improves species-conservation outcomes. Lianas are an integral part of tropical forests but can have detrimental and potentially complex interactions with their host trees. These effects can include reduced tree growth and fecundity, elevated tree mortality, alterations in tree-species composition, degradation of forest succession, and a substantial decline in forest carbon storage. We examined the individual impacts of fragmentation and edge effects (0-100-m transect from edge to forest interior) on the liana community and liana-host tree interactions in rainforests of the Atherton Tableland in north Queensland, Australia. We compared the liana and tree community, the traits of liana-infested trees, and determinants of the rates of tree infestation within five forest fragments (23-58 ha in area) and five nearby intact-forest sites. Fragmented forests experienced considerable disturbance-induced degradation at their edges, resulting in a significant increase in liana abundance. This effect penetrated to significantly greater depths in forest fragments than in intact forests. The composition of the liana community in terms of climbing guilds was significantly different between fragmented and intact forests, likely because forest edges had more small-sized trees favoring particular liana guilds which preferentially use these for climbing trellises. Sites that had higher liana abundances also exhibited higher infestation rates of trees, as did sites with the largest lianas. However, large lianas were associated with low-disturbance forest sites. Our study shows that edge disturbance of forest fragments significantly altered the abundance and community composition of lianas and their ecological relationships with trees, with liana impacts on trees being elevated in fragments relative
The Impact of Forest Density on Forest Height Inversion Modeling from Polarimetric InSAR Data
Directory of Open Access Journals (Sweden)
Changcheng Wang
2016-03-01
Full Text Available Forest height is of great significance in analyzing the carbon cycle on a global or a local scale and in reconstructing the accurate forest underlying terrain. Major algorithms for estimating forest height, such as the three-stage inversion process, are depending on the random-volume-over-ground (RVoG model. However, the RVoG model is characterized by a lot of parameters, which influence its applicability in forest height retrieval. Forest density, as an important biophysical parameter, is one of those main influencing factors. However, its influence to the RVoG model has been ignored in relating researches. For this paper, we study the applicability of the RVoG model in forest height retrieval with different forest densities, using the simulated and real Polarimetric Interferometric SAR data. P-band ESAR datasets of the European Space Agency (ESA BioSAR 2008 campaign were selected for experiments. The test site was located in Krycklan River catchment in Northern Sweden. The experimental results show that the forest density clearly affects the inversion accuracy of forest height and ground phase. For the four selected forest stands, with the density increasing from 633 to 1827 stems/Ha, the RMSEs of inversion decrease from 4.6 m to 3.1 m. The RVoG model is not quite applicable for forest height retrieval especially in sparsely vegetated areas. We conclude that the forest stand density is positively related to the estimation accuracy of the ground phase, but negatively correlates to the ground-to-volume scattering ratio.
Winning and losing tree species of reassembly in Minnesota's mixed and broadleaf forests.
Directory of Open Access Journals (Sweden)
Brice B Hanberry
Full Text Available We examined reassembly of winning and losing tree species, species traits including shade and fire tolerance, and associated disturbance filters and forest ecosystem types due to rapid forest change in the Great Lakes region since 1850. We identified winning and losing species by changes in composition, distribution, and site factors between historical and current surveys in Minnesota's mixed and broadleaf forests. In the Laurentian Mixed Forest, shade-intolerant aspen replaced shade-intolerant tamarack as the most dominant tree species. Fire-tolerant white pine and jack pine decreased, whereas shade-tolerant ashes, maples, and white cedar increased. In the Eastern Broadleaf Forest, fire-tolerant white oaks and red oaks decreased, while shade-tolerant ashes, American basswood, and maples increased. Tamarack, pines, and oaks have become restricted to sites with either wetter or sandier and drier soils due to increases in aspen and shade-tolerant, fire-sensitive species on mesic sites. The proportion of shade-tolerant species increased in both regions, but selective harvest reduced the applicability of functional groups alone to specify winners and losers. Harvest and existing forestry practices supported aspen dominance in mixed forests, although without aspen forestry and with fire suppression, mixed forests will transition to a greater composition of shade-tolerant species, converging to forests similar to broadleaf forests. A functional group framework provided a perspective of winning and losing species and traits, selective filters, and forest ecosystems that can be generalized to other regions, regardless of species identity.
Winning and losing tree species of reassembly in Minnesota's mixed and broadleaf forests.
Hanberry, Brice B; Palik, Brian J; He, Hong S
2013-01-01
We examined reassembly of winning and losing tree species, species traits including shade and fire tolerance, and associated disturbance filters and forest ecosystem types due to rapid forest change in the Great Lakes region since 1850. We identified winning and losing species by changes in composition, distribution, and site factors between historical and current surveys in Minnesota's mixed and broadleaf forests. In the Laurentian Mixed Forest, shade-intolerant aspen replaced shade-intolerant tamarack as the most dominant tree species. Fire-tolerant white pine and jack pine decreased, whereas shade-tolerant ashes, maples, and white cedar increased. In the Eastern Broadleaf Forest, fire-tolerant white oaks and red oaks decreased, while shade-tolerant ashes, American basswood, and maples increased. Tamarack, pines, and oaks have become restricted to sites with either wetter or sandier and drier soils due to increases in aspen and shade-tolerant, fire-sensitive species on mesic sites. The proportion of shade-tolerant species increased in both regions, but selective harvest reduced the applicability of functional groups alone to specify winners and losers. Harvest and existing forestry practices supported aspen dominance in mixed forests, although without aspen forestry and with fire suppression, mixed forests will transition to a greater composition of shade-tolerant species, converging to forests similar to broadleaf forests. A functional group framework provided a perspective of winning and losing species and traits, selective filters, and forest ecosystems that can be generalized to other regions, regardless of species identity.
Forest harvesting reduces the soil metagenomic potential for biomass decomposition.
Cardenas, Erick; Kranabetter, J M; Hope, Graeme; Maas, Kendra R; Hallam, Steven; Mohn, William W
2015-11-01
Soil is the key resource that must be managed to ensure sustainable forest productivity. Soil microbial communities mediate numerous essential ecosystem functions, and recent studies show that forest harvesting alters soil community composition. From a long-term soil productivity study site in a temperate coniferous forest in British Columbia, 21 forest soil shotgun metagenomes were generated, totaling 187 Gb. A method to analyze unassembled metagenome reads from the complex community was optimized and validated. The subsequent metagenome analysis revealed that, 12 years after forest harvesting, there were 16% and 8% reductions in relative abundances of biomass decomposition genes in the organic and mineral soil layers, respectively. Organic and mineral soil layers differed markedly in genetic potential for biomass degradation, with the organic layer having greater potential and being more strongly affected by harvesting. Gene families were disproportionately affected, and we identified 41 gene families consistently affected by harvesting, including families involved in lignin, cellulose, hemicellulose and pectin degradation. The results strongly suggest that harvesting profoundly altered below-ground cycling of carbon and other nutrients at this site, with potentially important consequences for forest regeneration. Thus, it is important to determine whether these changes foreshadow long-term changes in forest productivity or resilience and whether these changes are broadly characteristic of harvested forests.
Farris, Zach J; Morelli, Toni Lyn; Sefczek, Timothy; Wright, Patricia C
2011-01-01
The aye-aye is considered the most widely distributed lemur in Madagascar; however, the effect of forest quality on aye-aye abundance is unknown. We compared aye-aye presence across degraded and non-degraded forest at Ranomafana National Park, Madagascar. We used secondary signs (feeding sites, high activity sites) as indirect cues of aye-aye presence and Canarium trees as an indicator of resource availability. All 3 measured variables indicated higher aye-aye abundance within non-degraded forest; however, the differences across forest type were not significant. Both degraded and non-degraded forests showed a positive correlation between feeding sites and high activity sites. We found that Canarium, an important aye-aye food source, was rare and had limited dispersal, particularly across degraded forest. This preliminary study provides baseline data for aye-aye activity and resource utilization across degraded and non-degraded forests. Copyright © 2011 S. Karger AG, Basel.
Effectiveness of Africa's tropical protected areas for maintaining forest cover.
Bowker, J N; De Vos, A; Ament, J M; Cumming, G S
2017-06-01
The effectiveness of parks for forest conservation is widely debated in Africa, where increasing human pressure, insufficient funding, and lack of management capacity frequently place significant demands on forests. Tropical forests house a substantial portion of the world's remaining biodiversity and are heavily affected by anthropogenic activity. We analyzed park effectiveness at the individual (224 parks) and national (23 countries) level across Africa by comparing the extent of forest loss (as a proxy for deforestation) inside parks to matched unprotected control sites. Although significant geographical variation existed among parks, the majority of African parks had significantly less forest loss within their boundaries (e.g., Mahale Park had 34 times less forest loss within its boundary) than control sites. Accessibility was a significant driver of forest loss. Relatively inaccessible areas had a higher probability (odds ratio >1, p < 0.001) of forest loss but only in ineffective parks, and relatively accessible areas had a higher probability of forest loss but only in effective parks. Smaller parks less effectively prevented forest loss inside park boundaries than larger parks (T = -2.32, p < 0.05), and older parks less effectively prevented forest loss inside park boundaries than younger parks (F 2,154 = -4.11, p < 0.001). Our analyses, the first individual and national assessment of park effectiveness across Africa, demonstrated the complexity of factors (such as geographical variation, accessibility, and park size and age) influencing the ability of a park to curb forest loss within its boundaries. © 2016 Society for Conservation Biology.
Research related to roads in USDA experimental forests [Chapter 16
W. J. Elliot; P. J. Edwards; R. B. Foltz
2014-01-01
Forest roads are essential in experimental forests and rangelands (EFRs) to allow researchers and the public access to research sites and for fire suppression, timber extraction, and fuel management. Sediment from roads can adversely impact watershed health. Since the 1930s, the design and management of forest roads has addressed both access issues and watershed health...
Landscape context mediates avian habitat choice in tropical forest restoration.
Directory of Open Access Journals (Sweden)
J Leighton Reid
Full Text Available Birds both promote and prosper from forest restoration. The ecosystem functions birds perform can increase the pace of forest regeneration and, correspondingly, increase the available habitat for birds and other forest-dependent species. The aim of this study was to learn how tropical forest restoration treatments interact with landscape tree cover to affect the structure and composition of a diverse bird assemblage. We sampled bird communities over two years in 13 restoration sites and two old-growth forests in southern Costa Rica. Restoration sites were established on degraded farmlands in a variety of landscape contexts, and each included a 0.25-ha plantation, island treatment (trees planted in patches, and unplanted control. We analyzed four attributes of bird communities including frugivore abundance, nectarivore abundance, migrant insectivore richness, and compositional similarity of bird communities in restoration plots to bird communities in old-growth forests. All four bird community variables were greater in plantations and/or islands than in control treatments. Frugivore and nectarivore abundance decreased with increasing tree cover in the landscape surrounding restoration plots, whereas compositional similarity to old-growth forests was greatest in plantations embedded in landscapes with high tree cover. Migrant insectivore richness was unaffected by landscape tree cover. Our results agree with previous studies showing that increasing levels of investment in active restoration are positively related to bird richness and abundance, but differences in the effects of landscape tree cover on foraging guilds and community composition suggest that trade-offs between biodiversity conservation and bird-mediated ecosystem functioning may be important for prioritizing restoration sites.
Opportunities and uses of biochar on forest sites in North America [Chapter 15
Deborah S. Page-Dumroese; Mark D. Coleman; Sean C. Thomas
2017-01-01
Biochar may be useful for restoring or revitalizing degraded forest soils and help with carbon sequestration, nutrient leaching losses, and reducing greenhouse gas emissions. However, biochar is not currently widely used on forested lands across North America. This chapter provides an overview of several biochar experiments conducted in North America and discusses the...
Forest canopy temperatures: dynamics, controls, and relationships with ecosystem fluxes
Still, C. J.; Griffith, D.; Kim, Y.; Law, B. E.; Hanson, C. V.; Kwon, H.; Schulze, M.; Detto, M.; Pau, S.
2017-12-01
Temperature strongly affects enzymatic reactions, ecosystem biogeochemistry, and species distributions. Although most focus is on air temperature, the radiative or skin temperature of plants is more relevant. Canopy skin temperature dynamics reflect biophysical, physiological, and anatomical characteristics and interactions with the environment, and can be used to examine forest responses to stresses like droughts and heat waves. Thermal infrared (TIR) imaging allows for extensive temporal and spatial sampling of canopy temperatures, particularly compared to spot measurements using thermocouples. We present results of TIR imaging of forest canopies at eddy covariance flux tower sites in the US Pacific Northwest and in Panama. These forests range from an old-growth temperate rainforest to a second growth semi-arid pine forest to a semi-deciduous tropical forest. Canopy temperature regimes at these sites are highly variable. Canopy temperatures at all forest sites displayed frequent departures from air temperature, particularly during clear sky conditions, with elevated canopy temperatures during the day and depressed canopy temperatures at night compared to air temperature. Comparison of canopy temperatures to fluxes of carbon dioxide, water vapor, and energy reveals stronger relationships than those found with air temperature. Daytime growing season net ecosystem exchange at the pine forest site is better explained by canopy temperature (r2 = 0.61) than air temperature (r2 = 0.52). At the semi-deciduous tropical forest, canopy photosynthesis is highly correlated with canopy temperature (r2 = 0.51), with a distinct optimum temperature for photosynthesis ( 31 °C) that agrees with leaf-level measurements. During the peak of one heat wave at an old-growth temperate rainforest, hourly averaged air temperature exceeded 35 °C, 10 °C above average. Peak hourly canopy temperature approached 40 °C, and leaf-to-air vapor pressure deficit exceeded 6 kPa. These extreme
The public forests of tomorrow
International Nuclear Information System (INIS)
Reidel, C.
1992-01-01
The author presents three different scenarios in this paper. First US national forests in 1890 and the political and economic conditions that directly affected them are discussed. Second, forests in 2092 are described, taking into account world population, climatic change, air pollution, energy supplies, water shortages, water management, wood-based products, changes in governments and government policies. Finally, the author discusses possible changes in public land management designations (e.g. National Parks, Nation Forests) and single purpose agencies (e.g. Park Service, Fish and Wildlife), merged into a new Department of Conservancy. Future government input into planning, carbon credits, easements for conservation land management, decentralized industrial sites, and multi-disciplinary management are suggested
Nagai, Shin; Nakai, Taro; Saitoh, Taku M.; Busey, Robert C.; Kobayashi, Hideki; Suzuki, Rikie; Muraoka, Hiroyuki; Kim, Yongwon
2013-06-01
Evaluation of the carbon, water, and energy balances in evergreen coniferous forests requires accurate in situ and satellite data regarding their spatio-temporal dynamics. Daily digital camera images can be used to determine the relationships among phenology, gross primary productivity (GPP), and meteorological parameters, and to ground-truth satellite observations. In this study, we examine the relationship between seasonal variations in camera-based canopy surface indices and eddy-covariance-based GPP derived from field studies in an Alaskan open canopy black spruce forest and in a Japanese closed canopy cedar forest. The ratio of the green digital number to the total digital number, hue, and GPP showed a bell-shaped seasonal profile at both sites. Canopy surface images for the black spruce forest and cedar forest mainly detected seasonal changes in vegetation on the floor of the forest and in the tree canopy, respectively. In contrast, the seasonal cycles of the ratios of the red and blue digital numbers to the total digital numbers differed between the two sites, possibly due to differences in forest structure and leaf color. These results suggest that forest structural characteristics, such as canopy openness and seasonal forest-floor changes, should be considered during continuous observations of phenology in evergreen coniferous forests.
Forest-biological erosion control on coal-mine spoil banks in Bulgaria
International Nuclear Information System (INIS)
Haigh, M.J.; Gentcheva-Kostadinova, S.; Zheleva, E.
1995-01-01
The forest fallowing of coal-mine spoils helps re-establish the processes of natural, self-sustaining, soil formation. Environmental monitoring in Bulgaria demonstrates that forestation can moderate soil pH (from ph> 3.0 to pH 1.3 g/cm 3 in the 0-5 cm layer) in the case of coal briquette spoils at Pernik, near Sofia. Ground losses from forested, 16-17 degree slope, coal briquette-spoils at Pernik are a quarter of those from an entirely unvegetated section of the same embankment (48.5 vs 12. 1 mm in the period 1988-1994) despite the absence of ground cover beneath the trees. On lignite spoil banks, at Maritsa-Iztok, central Bulgaria, forestation increases the organic content of the soil to greater depths than revegetation with grass, and to a greater degree than conventional agricultural cultivation. On Pinus nigra forested crest sites at Pernik, and in Robinia pseudacacia forested groves on the lignite minespoil banks at Maritsa-Iztok, slopes showed ground advance rather than ground retreat. Slopes protected by mechanical means alone did not allow soil growth and, where the structure broke down, they suffered as much erosion as untreated sites. In sum, the forest fallowing of surface coal-mine disturbed land accelerates organic matter accumulation in the soil, helps improve soil structure, reduces erosion, and may transform soil loss into soil gain, even on steeply sloping sites. 17 refs., 3 figs., 1 tab
Arthropod recolonization in the restoration of a semideciduous forest in southeastern Brazil
Pais, Mara P; Varanda, Elenice M
2010-01-01
The use of arthropods for monitoring habitat changes has grown widely in the last decades. In Brazil, however, most of the studies in restored areas have involved only vegetation changes. The present study aimed at investigating recolonization patterns of epigeic arthropods in recently restored sites of semideciduous forests in southeastern Brazil. We compared the community structure of adjoining sites 5, 17, 29 and 36 months old with that at a nearby forest remnant (reference site). We also ...
Assessing exergy of forest ecosystem using airborne and satellite data
Brovkina, Olga; Fabianek, Tomas; Lukes, Petr; Zemek, Frantisek
2017-04-01
Interactions of the energy flows of forest ecosystem with environment are formed by a suite of forest structure, functions and pathways of self-control. According to recent thermodynamic theory for open systems, concept of exergy of solar radiation has been applied to estimate energy consumptions on evapotranspiration and biomass production in forest ecosystem or to indicate forest decline and human land use impact on ecosystem stability. However, most of the methods for exergy estimation in forest ecosystem is not stable and its physical meaning remains on the surface. This study was aimed to contribute to understanding the exergy of forest ecosystem using combination of remote sensing (RS) and eddy covariance technologies, specifically: 1/to explore exergy of solar radiation depending on structure of solar spectrum (number of spectral bands of RS data), and 2/to explore the relationship between exergy and flux tower eddy covariance measurements. Two study forest sites were located in Western Beskids in the Czech Republic. The first site was dominated by young Norway spruce, the second site was dominated by mature European beech. Airborne hyperspectral data in VNIR, SWIR and TIR spectral regions were acquired 9 times for study sites during a vegetation periods in 2015-2016. Radiometric, geometric and atmospheric corrections of airborne data were performed. Satellite multispectral Landsat-8 cloud-free 21 scenes were downloaded and atmospherically corrected for the period from April to November 2015-2016. Evapotranspiration and latent heat fluxes were collected from operating flux towers located on study sites according to date and time of remote sensing data acquisition. Exergy was calculated for each satellite and airborne scene using various combinations of spectral bands as: Ex=E^out (K+ln E^out/E^in )+R, where Ein is the incoming solar energy, Eout is the reflected solar energy, R = Ein-Eout is absorbed energy, Eout/Ein is albedo and K is the Kullback increment
Directory of Open Access Journals (Sweden)
Marayana Prado Pinheiro
2013-01-01
Full Text Available Aiming at contributing to the knowledge of physical factors affecting community structure in Atlantic Forest remnants of southern Bahia state, Brazil, we analyzed the annual variation in the understory microclimate of a hillside forest fragment in the ‘Reserva Particular do Patrimônio Natural Serra do Teimoso’ (RST and a rustic cacao agroforestry system (Cabruca, located nearby the RST. Canopy openness (CO, air temperature (Ta, air relative humidity (RH and vapor pressure deficit (VPD data were collected between April, 2005 and April, 2006 at the base (RSTB, 340 m and the top (RSTT, 640 m of the RST and at the Cabruca (CB, 250 m. Data of rainfall, Ta, RH and VPD were also collected in an open area (OA, 270 m. The highest rainfalls (> 100 mm occurred in November, 2005 and April, 2006, whereas October, 2005 was the driest month (< 20 mm. CO ranged between 2.5 % in the CB (April, 2006 and 7.7 % in the RST (October, 2005. Low rainfall in October, 2005 affected VPDmax in all sites. Those effects were more pronounced in OA, followed by CB, RSTB and RSTT. During the period of measurements, the values of Ta, RH and VPD in CB were closer to the values measured in OA than to the values measured inside the forest.
The linkages between photosynthesis, productivity, growth and biomass in lowland Amazonian forests.
Malhi, Yadvinder; Doughty, Christopher E; Goldsmith, Gregory R; Metcalfe, Daniel B; Girardin, Cécile A J; Marthews, Toby R; Del Aguila-Pasquel, Jhon; Aragão, Luiz E O C; Araujo-Murakami, Alejandro; Brando, Paulo; da Costa, Antonio C L; Silva-Espejo, Javier E; Farfán Amézquita, Filio; Galbraith, David R; Quesada, Carlos A; Rocha, Wanderley; Salinas-Revilla, Norma; Silvério, Divino; Meir, Patrick; Phillips, Oliver L
2015-06-01
Understanding the relationship between photosynthesis, net primary productivity and growth in forest ecosystems is key to understanding how these ecosystems will respond to global anthropogenic change, yet the linkages among these components are rarely explored in detail. We provide the first comprehensive description of the productivity, respiration and carbon allocation of contrasting lowland Amazonian forests spanning gradients in seasonal water deficit and soil fertility. Using the largest data set assembled to date, ten sites in three countries all studied with a standardized methodology, we find that (i) gross primary productivity (GPP) has a simple relationship with seasonal water deficit, but that (ii) site-to-site variations in GPP have little power in explaining site-to-site spatial variations in net primary productivity (NPP) or growth because of concomitant changes in carbon use efficiency (CUE), and conversely, the woody growth rate of a tropical forest is a very poor proxy for its productivity. Moreover, (iii) spatial patterns of biomass are much more driven by patterns of residence times (i.e. tree mortality rates) than by spatial variation in productivity or tree growth. Current theory and models of tropical forest carbon cycling under projected scenarios of global atmospheric change can benefit from advancing beyond a focus on GPP. By improving our understanding of poorly understood processes such as CUE, NPP allocation and biomass turnover times, we can provide more complete and mechanistic approaches to linking climate and tropical forest carbon cycling. © 2015 John Wiley & Sons Ltd.
Quinn, C.; Dixon, J. L.; Wilcox, A. C.
2017-12-01
In steep, mountainous landscapes, interactions between soil, rock, and biotic factors combine to form complex feedbacks. Here, we explore the dynamic interplay between soil and vegetation and its influence on hillslope sediment storage and movement in the Bitterroot Range of Montana's Rocky Mountains. We focus on a set of analogous forested and non-forested hillslopes along Lost Horse Creek, where avalanche paths determine vegetative density without significant impact on other topographic variables. LiDAR, high-resolution aerial photography, and field mapping are used to determine the local and landscape variables that influence soil cover and sediment storage. We find high-resolution surface roughness is a useful remote proxy to identify bedrock and boulder outcrops, particularly beneath canopy cover. Based on this analysis and field mapping, the spatial extent of soil cover does not vary significantly between forested and non-forested regions, though soils are generally thicker under forest cover. We additionally measure fallout radiogenic nuclides (FRNs; Cs-137 and Pb-210) in soils across 40 sites to provide insight into short-term soil erosion and movement. Preliminary results show high spatial variability in FRN activities of mineral soils in both systems, which may reflect either spatially variable delivery or soil erosion. Additionally, FRN activity of surface litter and duff at the forest floor is three to four times higher than mineral soils in both the forested and non-forested sites, suggesting that FRNs may provide a novel tracer of carbon storage and export. Our results show that the coupled use of isotopic tracers and high resolution spatial data reveal quantitative insights into landscape scale hillslope soil dynamics.
Eddy-covariance methane flux measurements over a European beech forest
Gentsch, Lydia; Siebicke, Lukas; Knohl, Alexander
2015-04-01
The role of forests in global methane (CH4) turnover is currently not well constrained, partially because of the lack of spatially integrative forest-scale measurements of CH4 fluxes. Soil chamber measurements imply that temperate forests generally act as CH4 sinks. Upscaling of chamber observations to the forest scale is however problematic, if the upscaling is not constrained by concurrent 'top-down' measurements, such as of the eddy-covariance type, which provide sufficient integration of spatial variations and of further potential CH4 flux components within forest ecosystems. Ongoing development of laser absorption-based optical instruments, resulting in enhanced measurement stability, precision and sampling speed, has recently improved the prospects for meaningful eddy-covariance measurements at sites with presumably low CH4 fluxes, hence prone to reach the flux detection limit. At present, we are launching eddy-covariance CH4 measurements at a long-running ICOS flux tower site (Hainich National Park, Germany), located in a semi natural, unmanaged, beech dominated forest. Eddy-covariance measurements will be conducted with a laser spectrometer for parallel CH4, H2Ov and CO2 measurements (FGGA, Los Gatos Research, USA). Independent observations of the CO2 flux by the FGGA and a standard Infrared Gas Analyser (LI-7200, LI-COR, USA) will allow to evaluate data quality of measured CH4 fluxes. Here, we want to present first results with a focus on uncertainties of the calculated CH4 fluxes with regard to instrument precision, data processing and site conditions. In future, we plan to compare eddy-covariance flux estimates to side-by-side turbulent flux observations from a novel eddy accumulation system. Furthermore, soil CH4 fluxes will be measured with four automated chambers situated within the tower footprint. Based on a previous soil chamber study at the same site, we expect the Hainich forest site to act as a CH4 sink. However, we hypothesize that our
Winning and Losing Tree Species of Reassembly in Minnesota’s Mixed and Broadleaf Forests
Hanberry, Brice B.; Palik, Brian J.; He, Hong S.
2013-01-01
We examined reassembly of winning and losing tree species, species traits including shade and fire tolerance, and associated disturbance filters and forest ecosystem types due to rapid forest change in the Great Lakes region since 1850. We identified winning and losing species by changes in composition, distribution, and site factors between historical and current surveys in Minnesota’s mixed and broadleaf forests. In the Laurentian Mixed Forest, shade-intolerant aspen replaced shade-intolerant tamarack as the most dominant tree species. Fire-tolerant white pine and jack pine decreased, whereas shade-tolerant ashes, maples, and white cedar increased. In the Eastern Broadleaf Forest, fire-tolerant white oaks and red oaks decreased, while shade-tolerant ashes, American basswood, and maples increased. Tamarack, pines, and oaks have become restricted to sites with either wetter or sandier and drier soils due to increases in aspen and shade-tolerant, fire-sensitive species on mesic sites. The proportion of shade-tolerant species increased in both regions, but selective harvest reduced the applicability of functional groups alone to specify winners and losers. Harvest and existing forestry practices supported aspen dominance in mixed forests, although without aspen forestry and with fire suppression, mixed forests will transition to a greater composition of shade-tolerant species, converging to forests similar to broadleaf forests. A functional group framework provided a perspective of winning and losing species and traits, selective filters, and forest ecosystems that can be generalized to other regions, regardless of species identity. PMID:23613911
Facility siting as a decision process at the Savannah River Site
International Nuclear Information System (INIS)
Wike, L.D.
1995-01-01
Site selection for new facilities at Savannah River Site (SRS) historically has been a process dependent only upon specific requirements of the facility. While this approach is normally well suited to engineering and operational concerns, it can have serious deficiencies in the modern era of regulatory oversight and compliance requirements. There are many issues related to the site selection for a facility that are not directly related to engineering or operational requirements; such environmental concerns can cause large schedule delays and budget impact,s thereby slowing or stopping the progress of a project. Some of the many concerns in locating a facility include: waste site avoidance, National Environmental Policy Act requirements, Clean Water Act, Clean Air Act, wetlands conservation, US Army Corps of Engineers considerations, US Fish and Wildlife Service statutes including threatened and endangered species issues, and State of South Carolina regulations, especially those of the Department of Health and Environmental Control. In addition, there are SRS restrictions on research areas set aside for National Environmental Research Park (NERP), Savannah River Ecology Laboratory, Savannah River Forest Station, University of South Carolina Institute of Archaeology and Anthropology, Southeastern Forest Experimental Station, and Savannah River Technology Center (SRTC) programs. As with facility operational needs, all of these siting considerations do not have equal importance. The purpose of this document is to review recent site selection exercises conducted for a variety of proposed facilities, develop the logic and basis for the methods employed, and standardize the process and terminology for future site selection efforts
Long-term socio-ecological forest research in southeast France
Teissier du Cros, E.; Bariteau, M.; Kramer, K.
2004-01-01
France concentrates its research involving Mediterranean forests and related land-use on a series of long-term study sites meant to assess the effect of historical land-use on the current distribution of forest tree species and on the adaptability of these ecosystems to natural and anthropogenic
Restoration of tropical moist forest on bauxite mined lands in the Brazilian Amazon
John A Parrotta; Oliver H. Knowles
1999-01-01
We evaluated forest structure and composition in 9- to 13-year-old stands established on a bauxite-mined site at Trombetas (Pará), Brazil, using four different reforestation techniques following initial site preparation and topsoil replacement. These techniques included reliance on natural forest regeneration, mixed commercial species plantings of mostly exotic timber...
Tang, Jianwu; Luyssaert, Sebastiaan; Richardson, Andrew D; Kutsch, Werner; Janssens, Ivan A
2014-06-17
The traditional view of forest dynamics originated by Kira and Shidei [Kira T, Shidei T (1967) Jap J Ecol 17:70-87] and Odum [Odum EP (1969) Science 164(3877):262-270] suggests a decline in net primary productivity (NPP) in aging forests due to stabilized gross primary productivity (GPP) and continuously increased autotrophic respiration (Ra). The validity of these trends in GPP and Ra is, however, very difficult to test because of the lack of long-term ecosystem-scale field observations of both GPP and Ra. Ryan and colleagues [Ryan MG, Binkley D, Fownes JH (1997) Ad Ecol Res 27:213-262] have proposed an alternative hypothesis drawn from site-specific results that aboveground respiration and belowground allocation decreased in aging forests. Here, we analyzed data from a recently assembled global database of carbon fluxes and show that the classical view of the mechanisms underlying the age-driven decline in forest NPP is incorrect and thus support Ryan's alternative hypothesis. Our results substantiate the age-driven decline in NPP, but in contrast to the traditional view, both GPP and Ra decline in aging boreal and temperate forests. We find that the decline in NPP in aging forests is primarily driven by GPP, which decreases more rapidly with increasing age than Ra does, but the ratio of NPP/GPP remains approximately constant within a biome. Our analytical models describing forest succession suggest that dynamic forest ecosystem models that follow the traditional paradigm need to be revisited.
International Nuclear Information System (INIS)
Richardson, Justin B.; Friedland, Andrew J.; Engerbretson, Teresa R.; Kaste, James M.; Jackson, Brian P.
2013-01-01
Assessing current Hg pools in forest soils of the northeastern U.S. is important for monitoring changes in Hg cycling. The forest floor, upper and lower mineral horizons were sampled at 17 long-term upland forest sites across the northeastern U.S. in 2011. Forest floor Hg concentration was similar across the study region (274 ± 13 μg kg −1 ) while Hg amount at northern sites (39 ± 6 g ha −1 ) was significantly greater than at western sites (11 ± 4 g ha −1 ). Forest floor Hg was correlated with soil organic matter, soil pH, latitude and mean annual precipitation and these variables explained approximately 70% of the variability when multiple regressed. Mercury concentration and amount in the lower mineral soil was correlated with Fe, soil organic matter and latitude, corresponding with Bs horizons of Spodosols (Podzols). Our analysis shows the importance of regional and soil properties on Hg accumulation in forest soils. -- Highlights: •Mercury in the forest floor and mineral soil was quantified at 17 sites. •Concentrations and amounts were regressed with regional factors and soil properties. •Forest floor Hg was most explained by soil organic matter, pH, and precipitation. •Mineral soil Hg was explained by latitude, Fe concentration, and soil organic matter. •Mineral soil Hg was greatest in Bs horizons of Spodosols due to podzolization. -- Forest floor Hg was correlated with soil organic matter, pH, latitude, and mean annual precipitation. Mineral soil Hg was greatest in Bs horizons of Spodosols
Spatial preference heterogeneity in forest recreation
DEFF Research Database (Denmark)
Abildtrup, Jens; Garcia, Serge; Olsen, Søren Bøye
2013-01-01
In this study, we analyze the preferences for recreational use of forests in Lorraine (Northeastern France), applying stated preference data. Our approach allows us to estimate individual-specific preferences for recreational use of different forest types. These estimates are used in a second stage...... in the estimation of welfare economic values for parking and picnic facilities in the analyzed model. The results underline the importance of considering spatial heterogeneity of preferences carrying out economic valuation of spatial-delineated environmental goods and that the spatial variation in willingness...... of the analysis where we test whether preferences depend on access to recreation sites. We find that there is significant preference heterogeneity with respect to most forest attributes. The spatial analysis shows that preferences for forests with parking and picnic facilities are correlated with having access...
Responses of soil fungi to logging and oil palm agriculture in Southeast Asian tropical forests.
McGuire, K L; D'Angelo, H; Brearley, F Q; Gedallovich, S M; Babar, N; Yang, N; Gillikin, C M; Gradoville, R; Bateman, C; Turner, B L; Mansor, P; Leff, J W; Fierer, N
2015-05-01
Human land use alters soil microbial composition and function in a variety of systems, although few comparable studies have been done in tropical forests and tropical agricultural production areas. Logging and the expansion of oil palm agriculture are two of the most significant drivers of tropical deforestation, and the latter is most prevalent in Southeast Asia. The aim of this study was to compare soil fungal communities from three sites in Malaysia that represent three of the most dominant land-use types in the Southeast Asia tropics: a primary forest, a regenerating forest that had been selectively logged 50 years previously, and a 25-year-old oil palm plantation. Soil cores were collected from three replicate plots at each site, and fungal communities were sequenced using the Illumina platform. Extracellular enzyme assays were assessed as a proxy for soil microbial function. We found that fungal communities were distinct across all sites, although fungal composition in the regenerating forest was more similar to the primary forest than either forest community was to the oil palm site. Ectomycorrhizal fungi, which are important associates of the dominant Dipterocarpaceae tree family in this region, were compositionally distinct across forests, but were nearly absent from oil palm soils. Extracellular enzyme assays indicated that the soil ecosystem in oil palm plantations experienced altered nutrient cycling dynamics, but there were few differences between regenerating and primary forest soils. Together, these results show that logging and the replacement of primary forest with oil palm plantations alter fungal community and function, although forests regenerating from logging had more similarities with primary forests in terms of fungal composition and nutrient cycling potential. Since oil palm agriculture is currently the mostly rapidly expanding equatorial crop and logging is pervasive across tropical ecosystems, these findings may have broad applicability.
Matyssek, R.; Wieser, G.; Nunn, A. J.; Kozovits, A. R.; Reiter, I. M.; Heerdt, C.; Winkler, J. B.; Baumgarten, M.; Häberle, K.-H.; Grams, T. E. E.; Werner, H.; Fabian, P.; Havranek, W. M.
The current AOT40 concept for inferring risks in forest trees by ozone (O 3) injury is based on an accumulated external O 3 exposure rather than an internal O 3 dose or uptake rate. AOT40 assumes O 3 concentrations below 40 nl l -1 and night-time exposure to be negligible. Hence, this concept is rather inconsistent with observed forest conditions. In contrast, the flux concept of cumulative O 3 uptake (CU) into the leaves has the potential of reflecting a physiologically meaningful internal O 3 dose experienced by trees. In this paper, we relate AOT40 to cumulative O 3 uptake into European beech ( Fagus sylvatica), Norway spruce ( Picea abies), European larch ( Larix decidua) and cembran pine ( Pinus cembra) trees differing in size, age and site conditions. We demonstrate that the flux concept can be extended to the tree and the stand level, making use of sap flow measurements through tree trunks. Although in both seedlings and adult trees AOT40 may show some linearity in correlations with average CU, the latter varies, at given AOT40, by 25±11% within and between species. This is because O 3 flux is primarily influenced by stomatal aperture, the latter being affected by climate, canopy position, leaf and tree age while varying between species. In particular, if weighed by detoxification capacity, we suggest, therefore, O 3 uptake related air quality indices to be promoted towards ecologically meaningful standards in forest protection, overcoming the shortcomings of exposure concepts. As O 3 injury results from the balance between O 3 uptake and detoxification in the leaf mesophyll, we conclude the flux concept in combination with measures of biochemical defence to have the capacity for predicting tree response to O 3 stress.
Directory of Open Access Journals (Sweden)
J. Kontkanen
2016-10-01
Full Text Available The oxidation products of monoterpenes likely have a crucial role in the formation and growth of aerosol particles in boreal forests. However, the continuous measurements of monoterpene concentrations are usually not available on decadal timescales, and the direct measurements of the concentrations of monoterpene oxidation product have so far been scarce. In this study we developed proxies for the concentrations of monoterpenes and their oxidation products at a boreal forest site in Hyytiälä, southern Finland. For deriving the proxies we used the monoterpene concentration measured with a proton transfer reaction mass spectrometer (PTR-MS during 2006–2013. Our proxies for the monoterpene concentration take into account the temperature-controlled emissions from the forest ecosystem, the dilution caused by the mixing within the boundary layer and different oxidation processes. All the versions of our proxies captured the seasonal variation of the monoterpene concentration, the typical proxy-to-measurements ratios being between 0.8 and 1.3 in summer and between 0.6 and 2.6 in winter. In addition, the proxies were able to describe the diurnal variation of the monoterpene concentration rather well, especially in summer months. By utilizing one of the proxies, we calculated the concentration of oxidation products of monoterpenes by considering their production in the oxidation and their loss due to condensation on aerosol particles. The concentration of oxidation products was found to have a clear seasonal cycle, with a maximum in summer and a minimum in winter. The concentration of oxidation products was lowest in the morning or around noon and highest in the evening. In the future, our proxies for the monoterpene concentration and their oxidation products can be used, for example, in the analysis of new particle formation and growth in boreal environments.
Sierra, Carlos A; Loescher, Henry W; Harmon, Mark E; Richardson, Andrew D; Hollinger, David Y; Perakis, Steven S
2009-10-01
Interannual variation of carbon fluxes can be attributed to a number of biotic and abiotic controls that operate at different spatial and temporal scales. Type and frequency of disturbance, forest dynamics, and climate regimes are important sources of variability. Assessing the variability of carbon fluxes from these specific sources can enhance the interpretation of past and current observations. Being able to separate the variability caused by forest dynamics from that induced by climate will also give us the ability to determine if the current observed carbon fluxes are within an expected range or whether the ecosystem is undergoing unexpected change. Sources of interannual variation in ecosystem carbon fluxes from three evergreen ecosystems, a tropical, a temperate coniferous, and a boreal forest, were explored using the simulation model STANDCARB. We identified key processes that introduced variation in annual fluxes, but their relative importance differed among the ecosystems studied. In the tropical site, intrinsic forest dynamics contributed approximately 30% of the total variation in annual carbon fluxes. In the temperate and boreal sites, where many forest processes occur over longer temporal scales than those at the tropical site, climate controlled more of the variation among annual fluxes. These results suggest that climate-related variability affects the rates of carbon exchange differently among sites. Simulations in which temperature, precipitation, and radiation varied from year to year (based on historical records of climate variation) had less net carbon stores than simulations in which these variables were held constant (based on historical records of monthly average climate), a result caused by the functional relationship between temperature and respiration. This suggests that, under a more variable temperature regime, large respiratory pulses may become more frequent and high enough to cause a reduction in ecosystem carbon stores. Our results
Sierra, C.A.; Loescher, H.W.; Harmon, M.E.; Richardson, A.D.; Hollinger, D.Y.; Perakis, S.S.
2009-01-01
Interannual variation of carbon fluxes can be attributed to a number of biotic and abiotic controls that operate at different spatial and temporal scales. Type and frequency of disturbance, forest dynamics, and climate regimes are important sources of variability. Assessing the variability of carbon fluxes from these specific sources can enhance the interpretation of past and current observations. Being able to separate the variability caused by forest dynamics from that induced by climate will also give us the ability to determine if the current observed carbon fluxes are within an expected range or whether the ecosystem is undergoing unexpected change. Sources of interannual variation in ecosystem carbon fluxes from three evergreen ecosystems, a tropical, a temperate coniferous, and a boreal forest, were explored using the simulation model STANDCARB. We identified key processes that introduced variation in annual fluxes, but their relative importance differed among the ecosystems studied. In the tropical site, intrinsic forest dynamics contributed ?? 30% of the total variation in annual carbon fluxes. In the temperate and boreal sites, where many forest processes occur over longer temporal scales than those at the tropical site, climate controlled more of the variation among annual fluxes. These results suggest that climate-related variability affects the rates of carbon exchange differently among sites. Simulations in which temperature, precipitation, and radiation varied from year to year (based on historical records of climate variation) had less net carbon stores than simulations in which these variables were held constant (based on historical records of monthly average climate), a result caused by the functional relationship between temperature and respiration. This suggests that, under a more variable temperature regime, large respiratory pulses may become more frequent and high enough to cause a reduction in ecosystem carbon stores. Our results also show
International Nuclear Information System (INIS)
Kolb, Thomas; Dore, Sabina; Montes-Helu, Mario
2013-01-01
We assessed the impacts of extreme late-summer drought on carbon balance in a semi-arid forest region in Arizona. To understand drought impacts over extremes of forest cover, we measured net ecosystem production (NEP), gross primary production (GPP), and total ecosystem respiration (TER) with eddy covariance over five years (2006–10) at an undisturbed ponderosa pine (Pinus ponderosa) forest and at a former forest converted to grassland by intense burning. Drought shifted annual NEP from a weak source of carbon to the atmosphere to a neutral carbon balance at the burned site and from a carbon sink to neutral at the undisturbed site. Carbon fluxes were particularly sensitive to drought in August. Drought shifted August NEP at the undisturbed site from sink to source because the reduction of GPP (70%) exceeded the reduction of TER (35%). At the burned site drought shifted August NEP from weak source to neutral because the reduction of TER (40%) exceeded the reduction of GPP (20%). These results show that the lack of forest recovery after burning and the exposure of undisturbed forests to late-summer drought reduce carbon sink strength and illustrate the high vulnerability of forest carbon sink strength in the southwest US to predicted increases in intense burning and precipitation variability. (letter)
Kolb, Thomas; Dore, Sabina; Montes-Helu, Mario
2013-03-01
We assessed the impacts of extreme late-summer drought on carbon balance in a semi-arid forest region in Arizona. To understand drought impacts over extremes of forest cover, we measured net ecosystem production (NEP), gross primary production (GPP), and total ecosystem respiration (TER) with eddy covariance over five years (2006-10) at an undisturbed ponderosa pine (Pinus ponderosa) forest and at a former forest converted to grassland by intense burning. Drought shifted annual NEP from a weak source of carbon to the atmosphere to a neutral carbon balance at the burned site and from a carbon sink to neutral at the undisturbed site. Carbon fluxes were particularly sensitive to drought in August. Drought shifted August NEP at the undisturbed site from sink to source because the reduction of GPP (70%) exceeded the reduction of TER (35%). At the burned site drought shifted August NEP from weak source to neutral because the reduction of TER (40%) exceeded the reduction of GPP (20%). These results show that the lack of forest recovery after burning and the exposure of undisturbed forests to late-summer drought reduce carbon sink strength and illustrate the high vulnerability of forest carbon sink strength in the southwest US to predicted increases in intense burning and precipitation variability.
Jared M. Thaxton; Susan Cordell; Robert J. Cabin; Darren R. Sandquist
2012-01-01
Invasive non-native species can create especially problematic restoration barriers in subtropical and tropical dry forests. Native dry forests in Hawaii presently cover less than 10% of their original area. Many sites that historically supported dry forest are now completely dominated by non-native species, particularly grasses. Within a grass-dominated site in leeward...
Directory of Open Access Journals (Sweden)
Süleyman ÇELİK
2013-03-01
Full Text Available In order to overcome financial restrictions and so achieve ahigher rate of growth, these countries often utilize external loans.External debts, which are initially taken as additional resources, canaccelerate the investments, economic growth and development whenthey are used efficiently. But if the external debts aren’t used efficientlyand the principal and interest payments of the external debts becomehigher than national income increase, it is required to get debts again topay debts and thereby it causes to increase external debt burden anddecrease the country welfare.Most empirical studies indicate a negative correlation betweenforeign debt and economic growth. In this study, the relationshipbetween economic growth and foreign debt is discussed in terms ofTurkish economy. Using time series data over the 1991–2010 period.The stationarity of time series data used in this study was tested by theADF test. Cointegration test which is developed by Johansen was usedin order to investigate long-term relationship between the variableswhich are stabilize at the same level or not. A least squares regressionanalysis and at last in order to obtain effect direction between thevariables Granger analysis are performed. Analysis show that foreigndebts in Turkey habe a negative effect on economical growth. Accordingto these results, domestic resources should finance the requiredinvestments and external resources should be reduced in order toincrease economic growth-in Turkey. Az gelişmiş ve gelişmekte olan ülkeler finansman kısıtlarınıaşarak yüksek büyüme hızlarına ulaşmak için dış borçlanmaya sık sıkbaşvurmaktadırlar. Başlangıçta ek bir kaynak olarak alınan dış borçlaretkin bir şekilde kullanıldıklarında yatırımları, ekonomik büyümeyi vekalkınmayı hızlandırabilmektedir. Fakat alınan dış borcun etkinkullanılmaması ve dış borcun anapara ve faiz ödemelerinin ulusal gelirartışından daha fazla artış g
Quantifying deforestation and forest degradation with thermal response.
Lin, Hua; Chen, Yajun; Song, Qinghai; Fu, Peili; Cleverly, James; Magliulo, Vincenzo; Law, Beverly E; Gough, Christopher M; Hörtnagl, Lukas; Di Gennaro, Filippo; Matteucci, Giorgio; Montagnani, Leonardo; Duce, Pierpaolo; Shao, Changliang; Kato, Tomomichi; Bonal, Damien; Paul-Limoges, Eugénie; Beringer, Jason; Grace, John; Fan, Zexin
2017-12-31
Deforestation and forest degradation cause the deterioration of resources and ecosystem services. However, there are still no operational indicators to measure forest status, especially for forest degradation. In the present study, we analysed the thermal response number (TRN, calculated by daily total net radiation divided by daily temperature range) of 163 sites including mature forest, disturbed forest, planted forest, shrubland, grassland, savanna vegetation and cropland. TRN generally increased with latitude, however the regression of TRN against latitude differed among vegetation types. Mature forests are superior as thermal buffers, and had significantly higher TRN than disturbed and planted forests. There was a clear boundary between TRN of forest and non-forest vegetation (i.e. grassland and savanna) with the exception of shrubland, whose TRN overlapped with that of forest vegetation. We propose to use the TRN of local mature forest as the optimal TRN (TRN opt ). A forest with lower than 75% of TRN opt was identified as subjected to significant disturbance, and forests with 66% of TRN opt was the threshold for deforestation within the absolute latitude from 30° to 55°. Our results emphasized the irreplaceable thermal buffer capacity of mature forest. TRN can be used for early warning of deforestation and degradation risk. It is therefore a valuable tool in the effort to protect forests and prevent deforestation. Copyright © 2017 Elsevier B.V. All rights reserved.
Increased forest ecosystem carbon and nitrogen storage from nitrogen rich bedrock.
Morford, Scott L; Houlton, Benjamin Z; Dahlgren, Randy A
2011-08-31
Nitrogen (N) limits the productivity of many ecosystems worldwide, thereby restricting the ability of terrestrial ecosystems to offset the effects of rising atmospheric CO(2) emissions naturally. Understanding input pathways of bioavailable N is therefore paramount for predicting carbon (C) storage on land, particularly in temperate and boreal forests. Paradigms of nutrient cycling and limitation posit that new N enters terrestrial ecosystems solely from the atmosphere. Here we show that bedrock comprises a hitherto overlooked source of ecologically available N to forests. We report that the N content of soils and forest foliage on N-rich metasedimentary rocks (350-950 mg N kg(-1)) is elevated by more than 50% compared with similar temperate forest sites underlain by N-poor igneous parent material (30-70 mg N kg(-1)). Natural abundance N isotopes attribute this difference to rock-derived N: (15)N/(14)N values for rock, soils and plants are indistinguishable in sites underlain by N-rich lithology, in marked contrast to sites on N-poor substrates. Furthermore, forests associated with N-rich parent material contain on average 42% more carbon in above-ground tree biomass and 60% more carbon in the upper 30 cm of the soil than similar sites underlain by N-poor rocks. Our results raise the possibility that bedrock N input may represent an important and overlooked component of ecosystem N and C cycling elsewhere.
Perspectives of Spatial Scale in a Wildland Forest Epidemic
W.W. Dillon; S.E. Haas; D.M. Rizzo; R.K. Meentemeyer
2014-01-01
The challenge of observing interactions between plant pathogens, their hosts, and environmental heterogeneity across multiple spatial scales commonly limits our ability to understand and manage wildland forest epidemics. Using the forest pathogen Phytophthora ramorum as a case study, we established 20 multiscale field sites to analyze how host-...
Biodiversity Conservation and the Sacred Forests of Emohua, Rivers ...
African Journals Online (AJOL)
These sacred sites are regarded as the temples of god by the local people due to their beliefs, but technically the forests are centres of biodiversity. In recent times, anthropogenic interference activities expose the forest to threat and challenges which make the development and adoption of conservation strategies inevitable.
Seasonal changes in the radiation balance of subarctic forest and tundra
International Nuclear Information System (INIS)
Lafleur, P.M.; Renzetti, A.V.; Bello, R.
1993-01-01
This paper examines the seasonal behavior of the components of the radiation budget of subarctic tundra and open forest near Churchill, Manitoba. Data were collected between late February and August 1990. The presence of the winter snowpack is the most important factor which affects the difference in radiation balances of tundra and forest. Overall, net radiation was about four to five times larger over the forest when snow covered the ground. Albedo differences were primarily responsible for this difference in net radiation; however, somewhat smaller net longwave losses were experienced at the tundra site. The step decrease in albedo from winter to summer (i.e. snow-covered to snow-free conditions) was significant at both sites. The forest albedo decreased by about three-fold while the tundra experienced a seven-fold decrease. Net radiation at both sites increased in direct response to the albedo change. Transmissivity of the atmosphere near Churchill also appeared to change at about the same time as the loss of the snow cover and may be related to changing air masses which bring about the final snow melt
Restoration treatments in urban park forests drive long-term changes in vegetation trajectories.
Johnson, Lea R; Handel, Steven N
2016-04-01
Municipalities are turning to ecological restoration of urban forests as a measure to improve air quality, ameliorate urban heat island effects, improve storm water infiltration, and provide other social and ecological benefits. However, community dynamics following urban forest restoration treatments are poorly documented. This study examines the long-term effects of ecological restoration undertaken in New York City, New York, USA, to restore native forest in urban park natural areas invaded by woody non-native plants that are regional problems. In 2009 and 2010, we sampled vegetation in 30 invaded sites in three large public parks that were restored 1988-1993, and 30 sites in three large parks that were similarly invaded but had not been restored. Data from these matched plots reveal that the restoration treatment achieved its central goals. After 15-20 years, invasive species removal followed by native tree planting resulted in persistent structural and compositional shifts, significantly lower invasive species abundance, a more complex forest structure, and greater native tree recruitment. Together, these findings indicate that successional trajectories of vegetation dynamics have diverged between restored forests and invaded forests that were not restored. In addition, the data suggest that future composition of these urban forest patches will be novel assemblages. Restored and untreated sites shared a suite of shade-intolerant, quickly-growing tree species that colonize disturbed sites, indicating that restoration treatments created sites hospitable for germination and growth of species adapted to high light conditions and disturbed soils. These findings yield an urban perspective on the use of succession theory in ecological restoration. Models of ecological restoration developed in more pristine environments must be modified for use in cities. By anticipating both urban disturbances and ecological succession, management of urban forest patches can be
Silva,William Goulart da; Metzger,Jean Paul; Bernacci,Luis Carlos; Catharino,Eduardo Luís Martins; Durigan,Giselda; Simões,Sílvio
2008-01-01
The aim of this work was to explore the relationship between tree species richness and morphological characteristics of relief at the Ibiúna Plateau (SE Brazil). We sampled 61 plots of 0.30 ha, systematically established in 20 fragments of secondary forest (2-274 ha) and in three areas within a continuous secondary forest site, Morro Grande Reserve (9,400 ha). At each plot, 100 trees with diameter at breast height > 5 cm were sampled by the point centered quarter method, and total richness an...
The role of forest humus in watershed management in New England
G. R., Jr. Trimble; Howard W. Lull
1956-01-01
Forest humus is one of the most interesting components of the forest environment. Its surface serves as a depository for leaf fall and needle fall, with successive depths marking stages of transmutation from the freshly fallen to the decomposed. And humus is responsive: humus type and depth are indicators of forest treatment and, to some extent, of site quality....
Southern Forests: a Journal of Forest Science - Vol 78, No 2 (2016)
African Journals Online (AJOL)
The value of six key soil variables for incorporation into a South African forest site classification system · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Josua H. Louw, 81-95 ... FULL TEXT DOWNLOAD FULL TEXT. Robin A.W. Gardner, Michael J. Savage, Isa Bertling, 105-113.
International Nuclear Information System (INIS)
Wei, Suhua; Yi, Chuixiang; Hendrey, George; Eaton, Timothy; Rustic, Gerald; Wang, Shaoqiang; Liu, Heping; Krakauer, Nir Y; Wang, Weiguo; Desai, Ankur R; Montagnani, Leonardo; Tha Paw U, Kyaw; Falk, Matthias; Black, Andrew; Bernhofer, Christian; Grünwald, Thomas; Laurila, Tuomas; Cescatti, Alessandro; Moors, Eddy
2014-01-01
Several lines of evidence suggest that the warming climate plays a vital role in driving certain types of extreme weather. The impact of warming and of extreme weather on forest carbon assimilation capacity is poorly known. Filling this knowledge gap is critical towards understanding the amount of carbon that forests can hold. Here, we used a perfect-deficit approach to identify forest canopy photosynthetic capacity (CPC) deficits and analyze how they correlate to climate extremes, based on observational data measured by the eddy covariance method at 27 forest sites over 146 site-years. We found that droughts severely affect the carbon assimilation capacities of evergreen broadleaf forest (EBF) and deciduous broadleaf forest. The carbon assimilation capacities of Mediterranean forests were highly sensitive to climate extremes, while marine forest climates tended to be insensitive to climate extremes. Our estimates suggest an average global reduction of forest CPC due to unfavorable climate extremes of 6.3 Pg C (∼5.2% of global gross primary production) per growing season over 2001–2010, with EBFs contributing 52% of the total reduction
76 FR 65121 - Community Forest and Open Space Conservation Program
2011-10-20
..., environmental benefits including clean air, water, and wildlife habitat; benefits from forest-based educational... Program will be removed as deauthorized by the Farm Security and Rural Investment Act of 2002, and this... benefits, including wildlife habitat, stewardship demonstration sites for forest landowners, and...
Fire regime in a Mexican forest under indigenous resource management.
Fulé, Peter Z; Ramos-Gómez, Mauro; Cortés-Montaño, Citlali; Miller, Andrew M
2011-04-01
The Rarámuri (Tarahumara) people live in the mountains and canyons of the Sierra Madre Occidental of Chihuahua, Mexico. They base their subsistence on multiple-use strategies of their natural resources, including agriculture, pastoralism, and harvesting of native plants and wildlife. Pino Gordo is a Rarámuri settlement in a remote location where the forest has not been commercially logged. We reconstructed the forest fire regime from fire-scarred trees, measured the structure of the never-logged forest, and interviewed community members about fire use. Fire occurrence was consistent throughout the 19th and 20th centuries up to our fire scar collection in 2004. This is the least interrupted surface-fire regime reported to date in North America. Studies from other relict sites such as nature reserves in Mexico or the USA have all shown some recent alterations associated with industrialized society. At Pino Gordo, fires recurred frequently at the three study sites, with a composite mean fire interval of 1.9 years (all fires) to 7.6 years (fires scarring 25% or more of samples). Per-sample fire intervals averaged 10-14 years at the three sites. Approximately two-thirds of fires burned in the season of cambial dormancy, probably during the pre-monsoonal drought. Forests were dominated by pines and contained many large living trees and snags, in contrast to two nearby similar forests that have been logged. Community residents reported using fire for many purposes, consistent with previous literature on fire use by indigenous people. Pino Gordo is a valuable example of a continuing frequent-fire regime in a never-harvested forest. The Rarámuri people have actively conserved this forest through their traditional livelihood and management techniques, as opposed to logging the forest, and have also facilitated the fire regime by burning. The data contribute to a better understanding of the interactions of humans who live in pine forests and the fire regimes of these
The cost of carbon abatement through community forest management in Nepal Himalaya
Energy Technology Data Exchange (ETDEWEB)
Karky, Bhaskar Singh [Economic Analysis Division, International Centre for Integrated Mountain Development, GPO Box 3226, Kathmandu (Nepal); Skutsch, Margaret [Centro de Investigaciones en Geographia Ambiental, Universidad Nacional Autonoma de Mexico, Morelia (Mexico); University of Twente, PO Box 217 7500 AE Enschede (Netherlands)
2010-01-15
This paper estimates the economic returns to carbon abatement through biological sequestration in community managed forest under future REDD policy, and compares these for three possible management scenarios. For the estimation, the research relies on forest inventory data together with other socio-economic and resources use data collected from forest users in three sites of Nepal Himalaya. The paper estimates the incremental carbon from forest enhancement on a yearly basis over a five-year period using the value of 1 and 5 per tCO{sub 2} for conservative analysis. The results based on the three sites indicate that community forest management may be one of the least cost ways to abate carbon with a break-even price under Scenario 2 which ranges from 0.55 to 3.70 per tCO{sub 2}. However, bringing community forests into the carbon market may entail high opportunity costs as forests provide numerous non-monetary benefits to the local population, who regard these as the main incentive for conservation and management. An important finding of the research is that if forest resources use by local communities is not permitted, then carbon trading will not be attractive to them as revenue from carbon will not cover the cost foregone by not harvesting forest resources. (author)
An ecosystem carbon database for Canadian forests
Energy Technology Data Exchange (ETDEWEB)
Shaw, C.H.; Bhatti, J.S.; Sabourin, K.J.
2005-07-01
The forest ecosystem carbon database (FECD) is a compilation of data from more than 700 plots from different forest ecosystems in Canada. It includes more than 60 variables for site, stand and soil characteristics. It is intended for large-scale modelers and analysts working with the carbon budget and dynamics of forest ecosystems, particularly those interested in the response of forest carbon stocks and fluxes to changes in climate and site characteristics. The database includes totals for organic and mineral soil horizons for each plot along with total soil carbon content, tree biomass carbon content by component and total ecosystem carbon content. It is complete for site description information, soil chemistry, stand-level estimates of live tree biomass and carbon components and their totals. Soil carbon content by horizon was also included. The compilation targeted data collected at single points in space, where above ground and below ground carbon levels were measured simultaneously. It was noted that one of the important information gaps lies in the fact that no data was available for the natural disturbance or management histories of the stands where the plots were located. Estimates did not include detrital carbon or root biomass, which can influence the estimates for total ecosystem carbon in some forest types. The preliminary analysis reveals that ecozones can be grouped according to low and high average total biomass carbon content. The groups correlate to ecozones with low and high average total ecosystem carbon. Mineral soil carbon within each group contributes the highest proportion of carbon to the average total ecosystem carbon. It is correlated with a gradient in ecozone climate from cold and dry to warm and wet. 42 refs., 13 tabs., 16 figs.
Directory of Open Access Journals (Sweden)
Pedro Giovâni da Silva
2016-01-01
Full Text Available The Brazilian Atlantic Forest is one of the world's biodiversity hotspots, and is currently highly fragmented and disturbed due to human activities. Variation in environmental conditions in the Atlantic Forest can influence the distribution of species, which may show associations with some environmental features. Dung beetles (Coleoptera: Scarabaeinae are insects that act in nutrient cycling via organic matter decomposition and have been used for monitoring environmental changes. The aim of this study is to identify associations between the spatial distribution of dung beetle species and Atlantic Forest structure. The spatial distribution of some dung beetle species was associated with structural forest features. The number of species among the sampling sites ranged widely, and few species were found in all remnant areas. Principal coordinates analysis indicated that species composition, abundance and biomass showed a spatially structured distribution, and these results were corroborated by permutational multivariate analysis of variance. The indicator value index and redundancy analysis showed an association of several dung beetle species with some explanatory environmental variables related to Atlantic Forest structure. This work demonstrated the existence of a spatially structured distribution of dung beetles, with significant associations between several species and forest structure in Atlantic Forest remnants from Southern Brazil. Keywords: Beta diversity, Species composition, Species diversity, Spatial distribution, Tropical forest
Estimating forest biomass and volume using airborne laser data
Nelson, Ross; Krabill, William; Tonelli, John
1988-01-01
An airborne pulsed laser system was used to obtain canopy height data over a southern pine forest in Georgia in order to predict ground-measured forest biomass and timber volume. Although biomass and volume estimates obtained from the laser data were variable when compared with the corresponding ground measurements site by site, the present models are found to predict mean total tree volume within 2.6 percent of the ground value, and mean biomass within 2.0 percent. The results indicate that species stratification did not consistently improve regression relationships for four southern pine species.
Challenges for Community-Based Forest Management in the KoloAla Site Manompana
Urech, Zora Lea; Sorg, Jean-Pierre; Felber, Hans Rudolph
2013-03-01
Following the IUCN 5th World Congress on Protected Areas in 2003, the then-President of Madagascar decided to increase the area of Madagascar's protected areas from 1.7 to 6 million ha. To combine the aims of protection and timber production, a new concept was developed through the establishment of community-based forest management (CBFM) sites, called KoloAla. However, experience shows that similar management transfers to communities in Madagascar have only been successful in a very few cases. We aimed to explore the success to be expected of this new approach in the particular case of the Manompana corridor at Madagascar's eastern coast. In a first step, the readiness of the corridor's resource users for CBFM has been analysed according to the seven resource users' attributes developed by Ostrom that predict an effective self-organized resource management. In a second step, we explored how KoloAla addresses known challenges of Madagascar's CBFM. Analyses lead in a rather sober conclusion. Although KoloAla attempts to address the goals of poverty alleviation, biodiversity conservation and timber production under a single umbrella, it does so in a rather non-innovative way. Challenges with regard to the state's environmental governance, agricultural inefficiency and thus deforestation remain unsolved.
Calcium oxalate contribution to calcium cycling in forests of contrasting nutrient status
Dauer, Jenny M.; Perakis, Steven S.
2014-01-01
Calcium oxalate (Ca oxalate) is an insoluble biomineral that forms in plants and fungi, and occurs in soils across many types of ecosystems. Assessing how Ca oxalate may shape ecosystem Ca cycling requires information on the distribution of Ca oxalate among plant biomass, detritus, and mineral soil, and how it varies with ecosystem Ca status. We compared two Douglas-fir forests of contrasting ecosystem Ca availability, and found that Ca oxalate was partitioned similarly among plant biomass, detritus and mineral soil major ecosystem compartments at both sites, and total pools of Ca oxalate were greater in the high-Ca forest. However, the proportional importance of Ca oxalate was greater in the low-Ca than high-Ca forest (18% versus 4% of actively cycling ecosystem Ca, respectively). And calcium oxalate in mineral soil, which is of particular interest as a potential long-term Ca reservoir, was a larger portion of total available Ca (exchangeable Ca plus Ca oxalate Ca) in the low-Ca site than the high-Ca site (9% versus 1% of available soil Ca, respectively). Calcium oxalate was the dominant form of Ca returned from plants to soil as leaf litterfall at the high-Ca site, yet calcium oxalate disappeared rapidly from decomposing litter (0.28 yr−1 or faster) at both sites. We conclude that accumulation of Ca oxalate in forest ecosystems appears most closely related to overall Ca supply for live biomass pools, and that the accumulation of Ca oxalate in forest floor and mineral soil is limited by rapid microbial degradation of putatively unavailable Ca oxalate.
Directory of Open Access Journals (Sweden)
Deborah Page-Dumroese
2011-09-01
Full Text Available Biomass harvesting for energy production and forest health can impact the soil resource by altering inherent chemical, physical and biological properties. These impacts raise concern about damaging sensitive forest soils, even with the prospect of maintaining vigorous forest growth through biomass harvesting operations. Current forest biomass harvesting research concurs that harvest impacts to the soil resource are region- and site-specific, although generalized knowledge from decades of research can be incorporated into management activities. Based upon the most current forest harvesting research, we compiled information on harvest activities that decrease, maintain or increase soil-site productivity. We then developed a soil chemical and physical property risk assessment within a geographic information system for a timber producing region within the Northern Rocky Mountain ecoregion. Digital soil and geology databases were used to construct geospatially explicit best management practices to maintain or enhance soil-site productivity. The proposed risk assessments could aid in identifying resilient soils for forest land managers considering biomass operations, policy makers contemplating expansion of biomass harvesting and investors deliberating where to locate bioenergy conversion facilities.
Hegetschweiler, K. Tessa; van Loon, Nicole; Ryser, Annette; Rusterholz, Hans-Peter; Baur, Bruno
2009-02-01
Urban forests are popular recreation areas in Europe. Several of these temperate broad-leaved forests also have a high conservation value due to sustainable management over many centuries. Recreational activities, particularly the use of fireplaces, can cause extensive damage to soil, ground vegetation, shrubs, and trees. Firewood collection depletes woody debris, leading to a loss of habitat for specialized organisms. We examined the effects of fireplace use on forest vegetation and the amount of woody debris by comparing disturbed and control plots in suburban forests in northwestern Switzerland. At frequently used fireplaces, we found reduced species densities in the ground vegetation and shrub layer and changes in plant species composition due to human trampling within an area of 150-200 m2. Picnicking and grilling also reduced the height and changed the age structure of shrubs and young trees. The amount of woody debris was lower in disturbed plots than in control plots. Pieces of wood with a diameter of 0.6-7.6 cm were preferentially collected by fireplace users. The reduction in woody debris volume extended up to a distance of 16 m from the fire ring, covering an area of 800 m2 at each picnic site. In order to preserve the ecological integrity of urban forests and to maintain their attractiveness as important recreation areas, we suggest depositing logging residues to be used as firewood and to restrict visitor movements near picnic sites.
Private valuation of carbon sequestration in forest plantations
Energy Technology Data Exchange (ETDEWEB)
Guitart, A. Bussoni [Facultad de Agronomia, Universidad de la Republica. Avda. E. Garzon, 780, CP 12.900, Montevideo (Uruguay); Rodriguez, L.C. Estraviz [Escola Superior de Agricultura ' ' Luiz de Queiroz' ' , Universidad de Sao, Paulo (Brazil)
2010-01-15
Approval of the Clean Development Mechanism, provided for in the Kyoto Protocol, enables countries with afforested land to trade in carbon emissions reduction certificates related to carbon dioxide equivalent quantities (CO{sub 2-e}) stored within a certain forest area. Potential CO{sub 2-e} above base line sequestration was determined for two forest sites on commercial eucalyptus plantations in northern Brazil (Bahia). Compensation values for silvicultural regimes involving rotation lengths greater than economically optimal were computed using the Faustmann formula. Mean values obtained were US$8.16 (MgCO{sub 2-e}){sup -} {sup 1} and US$7.19 (MgCO{sub 2-e}){sup -} {sup 1} for average and high site indexes, respectively. Results show that carbon supply is more cost-efficient in highly productive sites. Annuities of US$18.8 Mg C{sup -} {sup 1} and US$35.1 Mg C{sup -} {sup 1} and yearly payments of US$4.4 m{sup -} {sup 3} and US$8.2 m{sup -} {sup 3} due for each marginal cubic meter produced were computed for high and average sites, respectively. The estimated value of the tonne of carbon defines minimum values to be paid to forest owners, in order to induce a change in silvicultural management regimes. A reduction of carbon supply could be expected as a result of an increase in wood prices, although it would not respond in a regular manner. For both sites, price elasticity of supply was found to be inelastic and increased as rotation length moved further away from economically optimal: 0.24 and 0.27 for age 11 years in average- and high-productivity sites, respectively. This would be due to biomass production potential as a limiting factor; beyond a certain threshold value, an increase in price does not sustain a proportional change in carbon storage supply. The environmental service valuation model proposed might be adequate for assessing potential supply in plantation forestry, from a private landowner perspective, with an economic opportunity cost. The model is
Forest managment options for sequestering carbon in Mexico
International Nuclear Information System (INIS)
Masera, O.R.; Bellon, M.R.; Segura, G.
1995-01-01
This paper identifies and examines economic response options to avoid carbon emissions and increase carbon sequestration in Mexican forests. A ''Policy'' scenario covering the years 2000, 2010 and 2030 and a ''Technical Potential'' scenario (year 2030) are developed to examine the potential carbon sequestration and costs of each response option. Benefit-cost analyses for three case studies, including management of a pulpwood plantation, a native temperate forest and a native tropical evergreen forest are presented and discussed. The study suggests that a large potential for reducing carbon emissions and increasing carbon sequestration exists in Mexican forests. However, the achievement of this potential will require important reforms to the current institutional setting of the forest sector. The management of native temperate and tropical forests offers the most promising alternatives for carbon sequestration. The cost effectiveness of commercial plantations critically depends on very high site productivity. Restoration of degraded forest lands; particularly through the establishment of energy plantations, also shows a large carbon sequestration potential. (Author)
Arthropod recolonization in the restoration of a semideciduous forest in southeastern Brazil.
Pais, Mara P; Varanda, Elenice M
2010-01-01
The use of arthropods for monitoring habitat changes has grown widely in the last decades. In Brazil, however, most of the studies in restored areas have involved only vegetation changes. The present study aimed at investigating recolonization patterns of epigeic arthropods in recently restored sites of semideciduous forests in southeastern Brazil. We compared the community structure of adjoining sites 5, 17, 29 and 36 months old with that at a nearby forest remnant (reference site). We also determined the most abundant species and looked for ecological indicator species of each site age. Arthropods were sampled using pitfall traps, and their assemblages were described and compared with multi- and univariate statistical methods. Species abundance and richness equivalent to the reference site were reached at five months after planting, however species composition was very distinctive not only in relation to the reference site, but also among restored sites. Some of the main species found in this restoration stage are common in agroecosystems or cerrado vegetation. Nevertheless, there was a clear trend of arthropod fauna in restored sites moving toward the fauna in the forest remnant over time. Our results also highlighted ants and termites because of their abundance and ants because of their high value as ecological indicators of restoration age.
DEFF Research Database (Denmark)
Witt, S H; Streit, F; Jungkunz, M
2017-01-01
Borderline personality disorder (BOR) is determined by environmental and genetic factors, and characterized by affective instability and impulsivity, diagnostic symptoms also observed in manic phases of bipolar disorder (BIP). Up to 20% of BIP patients show comorbidity with BOR. This report...... describes the first case-control genome-wide association study (GWAS) of BOR, performed in one of the largest BOR patient samples worldwide. The focus of our analysis was (i) to detect genes and gene sets involved in BOR and (ii) to investigate the genetic overlap with BIP. As there is considerable genetic...... overlap between BIP, major depression (MDD) and schizophrenia (SCZ) and a high comorbidity of BOR and MDD, we also analyzed the genetic overlap of BOR with SCZ and MDD. GWAS, gene-based tests and gene-set analyses were performed in 998 BOR patients and 1545 controls. Linkage disequilibrium score...
NPP Tropical Forest: Consistent Worldwide Site Estimates, 1967-1999, R1
National Aeronautics and Space Administration — This data set contains documented field measurements of NPP components for 39 old-growth tropical forests distributed worldwide between latitudes 23.58 N and 23.58...
Directory of Open Access Journals (Sweden)
Igor V. Karyakin
2018-03-01
Full Text Available The article analyzes the influence of various types of felling on the occupation of breeding territories by different species of raptors mainly in the Altai Territory forests. Responses of birds of prey to the disturbance factor are also analyzed. Flight initiation distance is determined for each species. A review of international and Russian experience of buffer zones and specially protected forest areas (SPFA around nests of raptors was made. On this basis, the article presents the sizes of specially protected forest areas, thus it is possible to preserve breeding territories of different birds of prey species.
Burns, Sean P.; Maclean, Gordon D.; Blanken, Peter D.; Oncley, Steven P.; Semmer, Steven R.; Monson, Russell K.
2016-09-01
The Niwot Ridge Subalpine Forest AmeriFlux site (US-NR1) has been measuring eddy-covariance ecosystem fluxes of carbon dioxide, heat, and water vapor since 1 November 1998. Throughout this 17-year period there have been changes to the instrumentation and improvements to the data acquisition system. Here, in Part 1 of this three-part series of papers, we describe the hardware and software used for data-collection and metadata documentation. We made changes to the data acquisition system that aimed to reduce the system complexity, increase redundancy, and be as independent as possible from any network outages. Changes to facilitate these improvements were (1) switching to a PC/104-based computer running the National Center for Atmospheric Research (NCAR) In-Situ Data Acquisition Software (NIDAS) that saves the high-frequency data locally and over the network, and (2) time-tagging individual 10 Hz serial data samples using network time protocol (NTP) coupled to a GPS-based clock, providing a network-independent, accurate time base. Since making these improvements almost 2 years ago, the successful capture of high-rate data has been better than 99.98 %. We also provide philosophical concepts that shaped our design of the data system and are applicable to many different types of environmental data collection.
Rapid warming accelerates tree growth decline in semi-arid forests of Inner Asia.
Liu, Hongyan; Park Williams, A; Allen, Craig D; Guo, Dali; Wu, Xiuchen; Anenkhonov, Oleg A; Liang, Eryuan; Sandanov, Denis V; Yin, Yi; Qi, Zhaohuan; Badmaeva, Natalya K
2013-08-01
Forests around the world are subject to risk of high rates of tree growth decline and increased tree mortality from combinations of climate warming and drought, notably in semi-arid settings. Here, we assess how climate warming has affected tree growth in one of the world's most extensive zones of semi-arid forests, in Inner Asia, a region where lack of data limits our understanding of how climate change may impact forests. We show that pervasive tree growth declines since 1994 in Inner Asia have been confined to semi-arid forests, where growing season water stress has been rising due to warming-induced increases in atmospheric moisture demand. A causal link between increasing drought and declining growth at semi-arid sites is corroborated by correlation analyses comparing annual climate data to records of tree-ring widths. These ring-width records tend to be substantially more sensitive to drought variability at semi-arid sites than at semi-humid sites. Fire occurrence and insect/pathogen attacks have increased in tandem with the most recent (2007-2009) documented episode of tree mortality. If warming in Inner Asia continues, further increases in forest stress and tree mortality could be expected, potentially driving the eventual regional loss of current semi-arid forests. © 2013 John Wiley & Sons Ltd.
Fire History of Appalachian Forests of the Lower St-Lawrence Region (Southern Quebec
Directory of Open Access Journals (Sweden)
Serge Payette
2017-04-01
Full Text Available Sugar maple (Acer saccharum forests are among the main forest types of eastern North America. Sugar maple stands growing on Appalachian soils of the Lower St-Lawrence region are located at the northeastern limit of the northern hardwood forest zone. Given the biogeographical position of these forests at the edge of the boreal biome, we aimed to reconstruct the fire history and document the occurrence of temperate and boreal trees in sugar maple sites during the Holocene based on soil macrocharcoal analysis. Despite having experienced a different number of fire events, the fire history of the maple sites was broadly similar, with two main periods of fire activity, i.e., early- to mid-Holocene and late-Holocene. A long fire-free interval of at least 3500 years separated the two periods from the mid-Holocene to 2000 years ago. The maple sites differ with respect to fire frequency and synchronicity of the last millennia. According to the botanical composition of charcoal, forest vegetation remained relatively homogenous during the Holocene, except recently. Conifer and broadleaf species coexisted in mixed forests during the Holocene, in phase with fire events promoting the regeneration of boreal and temperate tree assemblages including balsam fir (Abies balsamea and sugar maple.
Development of spatial scaling technique of forest health sample point information
Lee, J.; Ryu, J.; Choi, Y. Y.; Chung, H. I.; Kim, S. H.; Jeon, S. W.
2017-12-01
Most forest health assessments are limited to monitoring sampling sites. The monitoring of forest health in Britain in Britain was carried out mainly on five species (Norway spruce, Sitka spruce, Scots pine, Oak, Beech) Database construction using Oracle database program with density The Forest Health Assessment in GreatBay in the United States was conducted to identify the characteristics of the ecosystem populations of each area based on the evaluation of forest health by tree species, diameter at breast height, water pipe and density in summer and fall of 200. In the case of Korea, in the first evaluation report on forest health vitality, 1000 sample points were placed in the forests using a systematic method of arranging forests at 4Km × 4Km at regular intervals based on an sample point, and 29 items in four categories such as tree health, vegetation, soil, and atmosphere. As mentioned above, existing researches have been done through the monitoring of the survey sample points, and it is difficult to collect information to support customized policies for the regional survey sites. In the case of special forests such as urban forests and major forests, policy and management appropriate to the forest characteristics are needed. Therefore, it is necessary to expand the survey headquarters for diagnosis and evaluation of customized forest health. For this reason, we have constructed a method of spatial scale through the spatial interpolation according to the characteristics of each index of the main sample point table of 29 index in the four points of diagnosis and evaluation report of the first forest health vitality report, PCA statistical analysis and correlative analysis are conducted to construct the indicators with significance, and then weights are selected for each index, and evaluation of forest health is conducted through statistical grading.
Impacts of Human Activities on Tree Species Composition Along the Forest Savanna Boundary in Nigeria
Directory of Open Access Journals (Sweden)
Christiana Ndidi Egbinola
2016-02-01
Full Text Available The study investigated the tree species composition along the forest-savanna boundary in Oyo state of Nigeria with the aim of assessing the impact of human activities on the floristic composition. A transect was placed along the study area and species data was collected from quadrats placed in study plots within different study sites. Detrended Correspondence Analysis (DCA was used to determine vegetation assemblages, while both correlation and the analysis of variance (ANOVA were used to show the relationship between species in the different study sites. Results of the DCA revealed three species assemblages, an area with only forest species, another with only savanna species and a third with both forest/savanna species. ANOVA results further revealed that within the forest and savanna assemblages, species in mature and successional sites were alike. The study therefore revealed that human activities’ within the region is leading to the establishment of savanna species and an elimination of forest species.
Occurrence and formation of chloroform at Danish forest sites
DEFF Research Database (Denmark)
Haselmann, K.F.; Ketola, R.A.; Laturnus, F.
2000-01-01
the initial soil air concentration after 38 h, while the concentrations of the other volatile chlorinated compounds investigated remained fairly constant. The observed chloroform concentration profiles and release rates may indicate a biogenic formation of chloroform in the upper soil layer of spruce forests...... of the annual anthropogenic chloroform emissions, and, therefore, the terrestrial environment can be considered as an important contributor to the atmospheric chloroform input. (C) 1999 Elsevier Science Ltd. All rights reserved....
Distance from forest edge affects bee pollinators in oilseed rape fields.
Bailey, Samantha; Requier, Fabrice; Nusillard, Benoît; Roberts, Stuart P M; Potts, Simon G; Bouget, Christophe
2014-02-01
Wild pollinators have been shown to enhance the pollination of Brassica napus (oilseed rape) and thus increase its market value. Several studies have previously shown that pollination services are greater in crops adjoining forest patches or other seminatural habitats than in crops completely surrounded by other crops. In this study, we investigated the specific importance of forest edges in providing potential pollinators in B. napus fields in two areas in France. Bees were caught with yellow pan traps at increasing distances from both warm and cold forest edges into B. napus fields during the blooming period. A total of 4594 individual bees, representing six families and 83 taxa, were collected. We found that both bee abundance and taxa richness were negatively affected by the distance from forest edge. However, responses varied between bee groups and edge orientations. The ITD (Inter-Tegular distance) of the species, a good proxy for bee foraging range, seems to limit how far the bees can travel from the forest edge. We found a greater abundance of cuckoo bees (Nomada spp.) of Andrena spp. and Andrena spp. males at forest edges, which we assume indicate suitable nesting sites, or at least mating sites, for some abundant Andrena species and their parasites (Fig. 1). Synthesis and Applications. This study provides one of the first examples in temperate ecosystems of how forest edges may actually act as a reservoir of potential pollinators and directly benefit agricultural crops by providing nesting or mating sites for important early spring pollinators. Policy-makers and land managers should take forest edges into account and encourage their protection in the agricultural matrix to promote wild bees and their pollination services.
Recovery of Biomass Following Shifting Cultivation in Dry Tropical Forests of the Yucatan
Read, L; Lawrence, Deborah; Foster, David Russell
2003-01-01
Land-use change in the tropics is creating secondary forest at an unprecedented rate. In the tropical Americas, mature dry tropical forest is rapidly being converted to secondary forest during the fallow period of shifting cultivation. This study addresses changes in forest biomass during forest recovery following shifting cultivation of maize (corn) in the Southern Yucatan Peninsular Region (SYPR), Mexico. We sampled stems .1 cm diameter at breast height at 36 study sites in t...
Forest resilience to drought varies across biomes.
Gazol, Antonio; Camarero, Jesus Julio; Vicente-Serrano, Sergio M; Sánchez-Salguero, Raúl; Gutiérrez, Emilia; de Luis, Martin; Sangüesa-Barreda, Gabriel; Novak, Klemen; Rozas, Vicente; Tíscar, Pedro A; Linares, Juan C; Martín-Hernández, Natalia; Martínez Del Castillo, Edurne; Ribas, Montse; García-González, Ignacio; Silla, Fernando; Camisón, Alvaro; Génova, Mar; Olano, José M; Longares, Luis A; Hevia, Andrea; Tomás-Burguera, Miquel; Galván, J Diego
2018-05-01
Forecasted increase drought frequency and severity may drive worldwide declines in forest productivity. Species-level responses to a drier world are likely to be influenced by their functional traits. Here, we analyse forest resilience to drought using an extensive network of tree-ring width data and satellite imagery. We compiled proxies of forest growth and productivity (TRWi, absolutely dated ring-width indices; NDVI, Normalized Difference Vegetation Index) for 11 tree species and 502 forests in Spain corresponding to Mediterranean, temperate, and continental biomes. Four different components of forest resilience to drought were calculated based on TRWi and NDVI data before, during, and after four major droughts (1986, 1994-1995, 1999, and 2005), and pointed out that TRWi data were more sensitive metrics of forest resilience to drought than NDVI data. Resilience was related to both drought severity and forest composition. Evergreen gymnosperms dominating semi-arid Mediterranean forests showed the lowest resistance to drought, but higher recovery than deciduous angiosperms dominating humid temperate forests. Moreover, semi-arid gymnosperm forests presented a negative temporal trend in the resistance to drought, but this pattern was absent in continental and temperate forests. Although gymnosperms in dry Mediterranean forests showed a faster recovery after drought, their recovery potential could be constrained if droughts become more frequent. Conversely, angiosperms and gymnosperms inhabiting temperate and continental sites might have problems to recover after more intense droughts since they resist drought but are less able to recover afterwards. © 2018 John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Razi Ahmed
2013-06-01
Full Text Available Estimates of above ground biomass density in forests are crucial for refining global climate models and understanding climate change. Although data from field studies can be aggregated to estimate carbon stocks on global scales, the sparsity of such field data, temporal heterogeneity and methodological variations introduce large errors. Remote sensing measurements from spaceborne sensors are a realistic alternative for global carbon accounting; however, the uncertainty of such measurements is not well known and remains an active area of research. This article describes an effort to collect field data at the Harvard and Howland Forest sites, set in the temperate forests of the Northeastern United States in an attempt to establish ground truth forest biomass for calibration of remote sensing measurements. We present an assessment of the quality of ground truth biomass estimates derived from three different sets of diameter-based allometric equations over the Harvard and Howland Forests to establish the contribution of errors in ground truth data to the error in biomass estimates from remote sensing measurements.
Directory of Open Access Journals (Sweden)
Hua Zhou
2016-08-01
Full Text Available Sustained forest management of Cunninghamia lanceolata (Chinese fir plantations in subtropical China is restricted by the limited availability of quantitative data. This study combines inventory data and tree-ring analysis of Chinese fir from natural and plantation forests that were subjected to controlled burning or brush clearing site preparations. Inter-annual variation of Chinese fir tree-ring widths were measured for the controlled burning, brush clearing and natural forest sites. The mean annual diametric growth of Chinese fir was 0.56 cm·year−1 for the natural forest, 0.80 cm·year−1 for the brush clearing site and 1.10 cm·year−1 for the controlled burning site. The time needed to reach the minimum cutting/logging diameter of 15 cm was 14 years in the controlled burning site, 19 years in the brush clearing site and >40 years in the natural forest. The biological rotation ages for the burning, cutting and natural forest sites were 15, 26 and >100 years, respectively. The total aboveground biomasses for the burning and clearing sites were 269.8 t·ha−1 and 252 t·ha−1, respectively. These results suggest that the current 25-year cutting cycle greatly underestimates the growth rate of Chinese fir plantations.
A contribution to the sessile oak site and beech site defining in central Serbia
Directory of Open Access Journals (Sweden)
Krstić Milun
2009-01-01
Full Text Available The study was carried out in sessile oak forests and beech forests in the region central Serbia. The stands are classified as pure stands with the percentage of other species up to 10% per tree number, mixed forests of sessile oak with other species, and mixed forests of beech with other species, whose percentage does not exceed 50%. Altogether 257 stands were monitored - 202 beech stands and 55 sessile oak stands. By the applied method of defining the local heat potential (Lujić, 1960, modified by Ratknić et al. (2001 and Krstić (2004, 2008, which represents possibility of soil heating without vegetation, were determined. In this way, a scale of 162 possible combinations of local heat potential was obtained, which explains more precisely the dependence of beech stands and sessile oak stands on the topographic conditions. By applying the weighted values of the thermal co-ordinates of aspect and slope (E for each altitudinal belt of 100 m, it was concluded that pure stands have the widest ecological range. Pure beech stands occur at the sites with 34 combinations of thermal co-ordinates E.V=4.6 to 8.12. Pure sessile oak stands occur at the sites with 12 combinations of thermal co-ordinates E.V=5.10 to 8.11. The percentage of mixed beech stands with other broadleaf species is the highest at the sites with the co-ordinate V=10-11 (at the altitudes between 700 and 900 m is about 60 %. Mixed stands of sessile oak and beech are located on the terrains with combinations of thermal co-ordinates E.V=7.9 to 8.12. By using the local heat potential of a region, it can be identified which sites, i.e. which combinations of exposure, slope and altitude belong to the particular tree species. Consequently, a more reliable selection of tree species can be done for the bio-reclamation of barrens and other deforested terrains.
How People Domesticated Amazonian Forests
Levis, C.; Flores, Bernardo; Moreira, Priscilla; Luize, Bruno G.; Alves, Rubana; Franco-Moraes, Juliano; Lins, Juliana; Konings, Evelien; Pena Claros, M.; Bongers, F.; Costa, Flavia; Clement, Charles
2018-01-01
For millennia, Amazonian peoples have managed forest resources, modifying the natural environment in subtle and persistent ways. Legacies of past human occupation are striking near archaeological sites, yet we still lack a clear picture of how human management practices resulted in the domestication
Post-Fire Restoration Plan for Sustainable Forest Management in South Korea
Directory of Open Access Journals (Sweden)
Soung-Ryoul Ryu
2017-05-01
Full Text Available This review was to determine a standard post-fire restoration strategy for use in South Korea according to the magnitude of the damage and the condition of the affected site. The government has strongly enforced reforestation in deforested areas as well as fire prevention and suppression since the 1960s. These efforts have successfully recovered dense even-aged forests over the last five decades. However, high fuel loading and the homogeneous structure have made forests vulnerable to large fires. In recent years, large forest fires have occurred in the eastern coastal region of Korea. Forest fires can significantly influence the economic and social activities of the residents of such affected forest regions. Burned areas may require urgent and long-term restoration strategies, depending on the condition of the affected site. Erosion control is the most important component of an urgent restoration and should be completed before a rainy season to prevent secondary damage such as landslides and sediment runoff in burned areas. Long-term restoration is necessary to renew forest functions such as timber production, water conservation, ecosystem conservation, and recreation for residents. Sound restoration for burned areas is critical for restoring healthy ecological functions of forests and providing economic incentives to local residents.
International Nuclear Information System (INIS)
Boggs, Johnny L.; McNulty, Steven G.; Pardo, Linda H.
2007-01-01
We evaluated foliar and forest floor chemistry across a gradient of N deposition in the Northeast at 11 red spruce (Picea rubens Sarg.) sites in 1987/1988 and foliar and forest floor chemistry and basal area growth at six paired spruce and deciduous sites in 1999. The six red spruce plots were a subset of the original 1987/1988 spruce sites. In 1999, we observed a significant correlation between mean growing season temperature and red spruce basal area growth. Red spruce and deciduous foliar %N correlated significantly with N deposition. Although N deposition has not changed significantly from 1987/1988 to 1999, net nitrification potential decreased significantly at Whiteface. This decrease in net potential nitrification is not consistent with the N saturation hypothesis and suggests that non-N deposition controls, such as climatic factors and immobilization of down dead wood, might have limited N cycling. - Data from the 1999 remeasurement of the red spruce forests suggest that N deposition, to some extent, is continuing to influence red spruce across the northeastern US as illustrated by a significant correlation between N deposition and red spruce foliar %N. Our data also suggest that the decrease in forest floor %N and net nitrification potential across sites from 1987 to 1999 may be due to factors other than N deposition, such as climatic factors and N immobilization in fine woody material (<5 cm diameter)
Multi-aged Forest: an Optimal Management Strategy for Carbon Sequestration
Yao, L.; Tang, X.; Ma, M.
2017-12-01
Disturbances and climatic changes significantly affect forest ecosystem productivity, water use efficiency (WUE) and carbon (C) flux dynamics. A deep understanding of terrestrial feedbacks to such effects and recovery mechanisms in forests across contrasting climatic regimes is essential to predict future regional/global C and water budgets, which are also closely related to the potential forest management decisions. However, the resilience of multi-aged and even-aged forests to disturbances has been debated for more than 60 years because of technical measurement constraints. Here we evaluated 62 site-years of eddy covariance measurements of net ecosystem production (NEP), evapotranspiration (ET), the estimates of gross primary productivity (GPP), ecosystem respiration (Re) and ecosystem-level WUE, as well as the relationships with environmental controls in three chronosequences of multi- and even-aged coniferous forests covering the Mediterranean, temperate and boreal regions. Age-specific dynamics in multi-year mean annual NEP and WUE revealed that forest age is a key variable that determines the sign and magnitude of recovering forest C source-sink strength from disturbances. However, the trends of annual NEP and WUE across succession stages between two stand structures differed substantially. The successional patterns of NEP exhibited an inverted-U trend with age at the two even-aged chronosequences, whereas NEP of the multi-aged chronosequence increased steadily through time. Meanwhile, site-level WUE of even-aged forests decreased gradually from young to mature, whereas an apparent increase occurred for the same forest age in multi-aged stands. Compared with even-aged forests, multi-aged forests sequestered more CO2 with forest age and maintained a relatively higher WUE in the later succession periods. With regard to the available flux measurements in this study, these behaviors are independent of tree species, stand ages and climate conditions . We also
Koarashi, Jun; Atarashi-Andoh, Mariko; Matsunaga, Takeshi; Sanada, Yukihisa
2016-12-01
The Fukushima Daiichi nuclear power plant disaster caused serious radiocesium (137Cs) contamination of forest ecosystems over a wide area. Forest-floor organic layers play a key role in controlling the overall bioavailability of 137Cs in forest ecosystems; however, there is still an insufficient understanding of how forest types influence the retention capability of 137Cs in organic layers in Japanese forest ecosystems. Here we conducted plot-scale investigations on the retention of 137Cs in organic layers at two contrasting forest sites in Fukushima. In a deciduous broad-leaved forest, approximately 80% of the deposited 137Cs migrated to mineral soil located below the organic layers within two years after the accident, with an ecological half-life of approximately one year. Conversely, in an evergreen coniferous forest, more than half of the deposited 137Cs remained in the organic layers, with an ecological half-life of 2.1 years. The observed retention behavior can be well explained by the tree phenology and accumulation of 137Cs associated with litter materials with different degrees of degradation in the organic layers. Spatial and temporal patterns of gamma-ray dose rates depended on the retention capability. Our results demonstrate that enhanced radiation risks last longer in evergreen coniferous forests than in deciduous broad-leaved forests.
Temperature and rainfall interact to control carbon cycling in tropical forests.
Taylor, Philip G; Cleveland, Cory C; Wieder, William R; Sullivan, Benjamin W; Doughty, Christopher E; Dobrowski, Solomon Z; Townsend, Alan R
2017-06-01
Tropical forests dominate global terrestrial carbon (C) exchange, and recent droughts in the Amazon Basin have contributed to short-term declines in terrestrial carbon dioxide uptake and storage. However, the effects of longer-term climate variability on tropical forest carbon dynamics are still not well understood. We synthesised field data from more than 150 tropical forest sites to explore how climate regulates tropical forest aboveground net primary productivity (ANPP) and organic matter decomposition, and combined those data with two existing databases to explore climate - C relationships globally. While previous analyses have focused on the effects of either temperature or rainfall on ANPP, our results highlight the importance of interactions between temperature and rainfall on the C cycle. In cool forests (forests (> 20 °C) it consistently enhanced both ANPP and decomposition. At the global scale, our analysis showed an increase in ANPP with rainfall in relatively warm sites, inconsistent with declines in ANPP with rainfall reported previously. Overall, our results alter our understanding of climate - C cycle relationships, with high precipitation accelerating rates of C exchange with the atmosphere in the most productive biome on earth. © 2017 John Wiley & Sons Ltd/CNRS.
Deposition of nitrogen oxides and ozone to Danish forest sites
DEFF Research Database (Denmark)
Pilegaard, K.; Jensen, N.O.; Hummelshøj, P.
1995-01-01
of the influence of meteorological factors. The viscous sub-layer resistance is derived by a new theory, taking the bluff roughness elements of the forest and the dimension of the needles/leaves as well as the LAI into account. The fluxes of nitrogen dioxide and ozone are related to the fluxes of water vapour...
Management of western coniferous forest habitat for nesting accipiter hawks
Richard T. Reynolds
1983-01-01
Availability of nesting sites can limit accipiter populations. Because accipiters nest in dense forest stands, any alteration that opens these stands is likely to lessen their desirability as nest sites. Tree growth and the associated changes in the vegetative structure of aging nest sites limit the number of years sites will be suitable. Therefore, prospective...
LBA-ECO TG-07 Trace Gas Fluxes, Undisturbed and Logged Sites, Para, Brazil: 2000-2002
M.M. Keller; R.K. Varner; J.D. Dias; H.S. Silva; P.M. Crill; Jr. de Oliveira; G.P. Asner
2009-01-01
Trace gas fluxes of carbon dioxide, methane, nitrous oxide, and nitric oxide were measured manually at undisturbed and logged forest sites in the Tapajos National Forest, near Santarem, Para, Brazil. Manual measurements were made approximately weekly at both the undisturbed and logged sites. Fluxes from clay and sand soils were completed at the undisturbed sites....
Ewers, B. E.; Peckham, S. D.; Mackay, D. S.; Pendall, E.; Frank, J. M.; Massman, W. J.; Reed, D. E.; Borkhuu, B.
2014-12-01
In recent decades, bark beetle infestation in western North America has reached epidemic levels. The resulting widespread forest mortality may have profound effects on present and future water and carbon cycling with potential negative consequences to a region that relies on water from montane and subalpine watersheds. We simulated stand-level ecosystem fluxes of water and carbon at two bark beetle-attacked conifer forests in southeast Wyoming, USA. The lower elevation site dominated by lodgepole pine (Pinus contorta) was attacked by mountain pine beetle (Dendroctonus ponderosae) during 2008-2010. The high elevation Engelmann spruce (Picea engelmannii) dominated site was attacked by the spruce beetle (Dendroctonus rufipennis) during roughly the same time period. Both beetle infestations resulted in >60% canopy mortality in the footprint of eddy covariance towers located at each site. However, carbon and water fluxes responses to mortality depended on the forest type. Using data collected at the sites, we scaled simulated plant hydraulic conductivity by either percent canopy mortality or loss of live tree basal area during infestation. We also simulated a case of no beetle attack. At the lodgepole site, the no-beetle model best fit the data and showed no significant change in growing season carbon flux and a 15% decrease in evapotranspiration (ET). However, at the spruce site, the simulation that tracked canopy loss agreed best with observations: carbon flux decreased by 72% and ET decreased by 31%. In the lodgepole stand, simulated soil water content agreed with spatially distributed measurements that were weighted to reflect overall mortality in the tower footprint. Although these two forest ecosystems are only 20 km apart, separated by less than 300m in elevation, and have been impacted by similar mortality agents, the associated changes in carbon and water cycling are significantly different. Beetle effects on hydrologic cycling were greatest at high elevation
Physiological and psychological effects of walking in stay-in forest therapy.
Park, Bum-Jin; Tsunetsugu, Yuko; Morikawa, Takeshi; Kagawa, Takahide; Lee, Juyoung; Ikei, Harumi; Song, Chorong; Miyazaki, Yoshifumi
2014-01-01
To provide scientific evidence of the physiological and psychological effects of forest and urban environments on 47 young male adults undergoing stay-in forest therapy. Field experiments were conducted at four sites in Japan. At each site, 12 subjects participated in the experiment. The experiments were conducted in forest and urban environments, and the subjects' physiological and psychological responses to these environments were compared. On the first day, six subjects were sent to a forest area, and the other six were sent to an urban area as controls. The groups were switched the next day. Heart rate variability and heart rate were measured to assess physiological responses. The semantic differential method for assessing emotions, the reports of "refreshed" feeling, and the Profile of Mood States (POMS) were used to assess psychological responses. The physiological and psychological responses of each subject were recorded during and after walking, and the differences in indices were compared between the two environments. The forest environment was associated with a higher parasympathetic nervous activity, a lower sympathetic nervous activity, and a lower heart rate than the urban environment. The subjective evaluation scores were generally in accordance with the physiological reactions and were significantly higher in the forest environment than in the urban environment. POMS measurements showed that the forest environment was psychologically relaxing and enhanced psychological vigor. This study provided clear scientific evidence of the physiological effects of forest therapy. The results will contribute to the development of forest therapy research and support the inclusion of forest therapy in preventive medicine.
Trends in stream nitrogen concentrations for forested reference catchments across the USA
A. Argerich; S.L. Johnson; S.D. Sebestyen; C.C. Rhoades; E. Greathouse; J.D. Knoepp; M.B. Adams; G.E. Likens; J.L. Campbell; W.H. McDowell; F.N. Scatena; G.G. Ice
2013-01-01
To examine whether stream nitrogen concentrations in forested reference catchments have changed over time and if patterns were consistent across the USA, we synthesized up to 44 yr of data collected from 22 catchments at seven USDA Forest Service Experimental Forests. Trends in stream nitrogen presented high spatial variability both among catchments at a site and among...
Lutz, David A; Burakowski, Elizabeth A; Murphy, Mackenzie B; Borsuk, Mark E; Niemiec, Rebecca M; Howarth, Richard B
2016-01-01
Forests are more frequently being managed to store and sequester carbon for the purposes of climate change mitigation. Generally, this practice involves long-term conservation of intact mature forests and/or reductions in the frequency and intensity of timber harvests. However, incorporating the influence of forest surface albedo often suggests that long rotation lengths may not always be optimal in mitigating climate change in forests characterized by frequent snowfall. To address this, we investigated trade-offs between three ecosystem services: carbon storage, albedo-related radiative forcing, and timber provisioning. We calculated optimal rotation length at 498 diverse Forest Inventory and Analysis forest sites in the state of New Hampshire, USA. We found that the mean optimal rotation lengths across all sites was 94 yr (standard deviation of sample means = 44 yr), with a large cluster of short optimal rotation lengths that were calculated at high elevations in the White Mountain National Forest. Using a regression tree approach, we found that timber growth, annual storage of carbon, and the difference between annual albedo in mature forest vs. a post-harvest landscape were the most important variables that influenced optimal rotation. Additionally, we found that the choice of a baseline albedo value for each site significantly altered the optimal rotation lengths across all sites, lowering the mean rotation to 59 yr with a high albedo baseline, and increasing the mean rotation to 112 yr given a low albedo baseline. Given these results, we suggest that utilizing temperate forests in New Hampshire for climate mitigation purposes through carbon storage and the cessation of harvest is appropriate at a site-dependent level that varies significantly across the state.
LBA-ECO TG-07 Ground-based Biometry Data at km 83 Site, TapajosNational Forest: 1997
M.M. Keller; M.W. Palace
2009-01-01
A field inventory of trees was conducted in March of 1997 in a logging concession at the Tapajos National Forest, south of Santarem, Para, Brazil. The inventory was conducted by the foresters and technicians of the Tropical Forest Foundation (FFT) and included all trees with diameter at breast height greater than or equal to 35 cm. Four blocks of approximately 100 ha...
Directory of Open Access Journals (Sweden)
Arief Priyadi
2014-11-01
Full Text Available Vegetation studies to reveal tree diversity and its contribution to carbon stock were conducted in three different sites of upland forest in Bali, Indonesia. The sites were located approximately 60 km north of the Bali Province capital city of Denpasar in an area named Bedugul. Those three sites were Mt. Mangu (forest area east of Beratan lake, forest area west of Buyan lake and forest area south of Tamblingan lake. There were 44, 29, and 21 tree species of 14, 19, 14 families with Shannon Diversity Index (H’ of 2.87, 2.64 and 1.69 respectively. Carbon stock average of above ground tree biomass from these sites were 214.2, 693.0 and 749.1 ton.ha-1 respectively. Tree species with top Summed Dominance Ratio (SDR in each of those sites were Platea latifolia in Mt. Mangu, Planchonella sp. in Buyan, and Tabernaemontana macrocarpa in Tamblingan. Average carbon content of these three species were 493.25, 12,876.26 and 40.35 kg.ha-1 respectively.
Silvicultural activities in Pringle Falls Experimental Forest, Central Oregon
Andrew Youngblood; Kim Johnson; Jim Schlaich; Boyd Wickman
2004-01-01
Pringle Falls Experimental Forest has been a center for research in ponderosa pine forests east of the crest of the Cascade Range since 1931. Long-term research facilities, sites, and future research opportunities are currently at risk from stand-replacement wildfire because of changes in stand structure resulting from past fire exclusion. At the same time, many of the...
Hydraulic properties and fine root mass of Larix sibirica along forest edge-interior gradients
Chenlemuge, Tselmeg; Dulamsuren, Choimaa; Hertel, Dietrich; Schuldt, Bernhard; Leuschner, Christoph; Hauck, Markus
2015-02-01
At its southernmost distribution limit in Inner Asia, the boreal forest disintegrates into forest fragments on moist sites (e.g. north-facing slopes), which are embedded in grasslands. This landscape mosaic is characterized by a much higher forest edge-to-interior ratio than in closed boreal forests. Earlier work in the forest-steppe ecotone of Mongolia has shown that Larix sibirica trees at forest edges grow faster than in the forest interior, as the more xeric environment at the edge promotes self-thinning and edges are preferentially targeted by selective logging and livestock grazing. Lowered stand density reduces competition for water in these semi-arid forests, where productivity is usually limited by summer drought. We studied how branch and coarse root hydraulic architecture and xylem conductivity, fine root biomass and necromass, and fine root morphology of L. sibirica respond to sites differing in water availability. Studying forest edge-interior gradients in two regions of western Mongolia, we found a significant reduction of branch theoretical (Kp) and empirical conductivity (Ks) in the putatively more drought-affected forest interior in the Mongolian Altai (mean precipitation: 120 mm yr-1), while no branch xylem modification occurred in the moister Khangai Mountains (215 mm yr-1). Kp and Ks were several times larger in roots than in branches, but root hydraulics were not influenced by stand density or mean annual precipitation. Very low fine root biomass: necromass ratios at all sites, and in the forest interior in particular, suggest that L. sibirica seeks to maintain a relatively high root conductivity by producing large conduits, which results in high root mortality due to embolism during drought. Our results suggest that L. sibirica is adapted to the semi-arid climate at its southernmost distribution limit by considerable plasticity of the branch hydraulic system and a small but apparently dynamic fine root system.
Energy and greenhouse gas balance of the use of forest residues for bioenergy production in the UK
International Nuclear Information System (INIS)
Whittaker, Carly; Mortimer, Nigel; Murphy, Richard; Matthews, Robert
2011-01-01
Life cycle analysis is used to assess the energy requirements and greenhouse gas (GHG) emissions associated with extracting UK forest harvesting residues for use as a biomass resource. Three forest harvesting residues were examined (whole tree thinnings, roundwood and brash bales), and each have their own energy and emission profile. The whole forest rotation was examined, including original site establishment, forest road construction, biomass harvesting during thinning and final clear-fell events, chipping and transportation. Generally, higher yielding sites give lower GHG emissions per ‘oven dried tonne’ (ODT) forest residues, but GHG emissions ‘per hectare’ are higher as more biomass is extracted. Greater quantities of biomass, however, ultimately mean greater displacement of conventional fuels and therefore greater potential for GHG emission mitigation. Although forest road construction and site establishment are “one off” events they are highly energy-intensive operations associated with high diesel fuel consumption, when placed in context with the full forest rotation, however, their relative contributions to the overall energy requirements and GHG emissions are small. The lower bulk density of wood chips means that transportation energy requirements and GHG emissions are higher compared with roundwood logs and brash bales, suggesting that chipping should occur near the end-user of application. -- Highlights: ► GHGs and fuel consumption assessed for UK clear-fell conifer forest residues. ► Energy use and GHG emissions for forest road construction characterised. ► Lower energy requirements and GHG emissions per ODT for higher yielding sites. ► Transport energy and GHG emissions higher for wood chip than roundwood or brash bales. ► Results useful in predicting GHG mitigation potential from UK commercial conifer forest residues.
Iverson, Louis R.; Cook, Elizabeth A.; Graham, Robin L.; Olson, Jerry S.; Frank, Thomas; Ke, Ying; Treworgy, Colin; Risser, Paul G.
1987-01-01
This report summarizes progress made in our investigation of forest productivity assessment using TM and other biogeographical data during the third six-month period of the grant. Data acquisition and methodology hurdles are largely complete. Four study areas for which the appropriate TM and ancillary data were available are currently being intensively analyzed. Significant relationships have been found on a site by site basis to suggest that forest productivity can be qualitatively assessed using TM band values and site characteristics. Perhaps the most promising results relate TM unsupervised classes to forest productivity, with enhancement from elevation data. During the final phases of the research, multi-temporal and regional comparisons of results will be addressed, as well as the predictability of forest productivity patterns over a large region using TM data and/or TM nested within AVHRR data.
Environmental variability and its relationship to site index in Mediterranean maritine pine
Energy Technology Data Exchange (ETDEWEB)
Bravo-Oviedo, A.; Roig, S.; Bravo, F.; Montero, G.; Rio, M. del
2011-07-01
Environmental variability and site productivity relationships, estimated by means of soil-site equations, are considered a milestone in decision making of forest management. The adequacy of silviculture systems is related to tree response to environmental conditions. The objectives of this paper are to study climatic and edaphic variability in Mediterranean Maritime pine (Pinus pinaster) forests in Spain, and the practical use of such variability in determining forest productivity by means of site index estimation. Principal component analysis was used to describe environmental conditions and patterns. Site index predictive models were fitted using partial least squares and parsimoniously by ordinary least square. Climatic variables along with parent material defined an ecological regionalization from warm and humid to cold and dry sites. Results showed that temperature and precipitation in autumn and winter, along with longitudinal gradient define extreme site qualities. The best qualities are located in warm and humid sites whereas the poorest ones are found in cold and dry regions. Site index values are poorly explained by soil properties. However, clay content in the first mineral horizon improved the soil-site model considerably. Climate is the main driver of productivity of Mediterranean Maritime pine in a broad scale. Site index differences within a homogenous climatic region are associated to soil properties. (Author) 47 refs.
Mangrove forest composition and structure in Las Perlas Archipelago, Pacific Panama
Directory of Open Access Journals (Sweden)
Tom McGowan
2010-09-01
Full Text Available Mangrove forest is an important ecosystem that provides many services, but in Panama, as in other countries, they are under threat due to a variety of human activities. Nowadays, large areas of mangroves continue to be lost without been described and lack of management strategies. This study focused on the mangrove structure in the two largest islands, Isla del Rey and Isla San Jose, of Las Perlas Archipelago (LPA, Pacific Panama. Assessment of Landsat satellite imagery revealed loss of mangroves in the LPA of 965ha in the period 1974-1986, and 248ha in the period 1986-2000. The majority of the loss (>77% from the two study islands was due to timber extraction and agricultural development. In May 2006, permanent plots following the CARICOMP protocol were established at two sites on Isla del Rey (R1 and R2 and one site on Isla San Jose (SJ where standardized metrics such as species, height and diameter at breast height of adult trees and seedlings were recorded. Forest structure differed at the three sites, although R1 and R2 were most similar. At R1, Laguncularia racemosa was the important species and R2 was dominated by Pelliciera rhizophorae. Examination of the forest structure and classified imagery indicated that these sites are spatially dynamic and appear to be rejuvenating. The forest structure would indicate that the sites have been growth-limited previously by human activities and possibly by other factors. SJ was dominated by Rhizophora mangle and appears to have a mature forest with large adult trees and few seedlings. It does not appear to have shown the same extent of spatial regrowth as the other two sites between 1986 and 2000 and is relatively static. The establishment of permanent plots and monitoring will be useful as part of the management plan, as the LPA shows a variety of mangrove structures and could be subject to further coastal development. Rev. Biol. Trop. 58 (3: 857-869. Epub 2010 September 01.
Mangrove forest composition and structure in Las Perlas Archipelago, Pacific Panama.
McGowan, Tom; Cunningham, Sarah L; Guzmán, Héctor M; Mair, James M; Guevara, José M; Betts, Tanja
2010-09-01
Mangrove forest is an important ecosystem that provides many services, but in Panama, as in other countries, they are under threat due to a variety of human activities. Nowadays, large areas of mangroves continue to be lost without been described and lack of management strategies. This study focused on the mangrove structure in the two largest islands, Isla del Rey and Isla San Jose, of Las Perlas Archipelago (LPA), Pacific Panama. Assessment of Landsat satellite imagery revealed loss of mangroves in the LPA of 965ha in the period 1974-1986, and 248ha in the period 1986-2000. The majority of the loss (>77%) from the two study islands was due to timber extraction and agricultural development. In May 2006, permanent plots following the CARICOMP protocol were established at two sites on Isla del Rey (R1 and R2) and one site on Isla San Jose (SJ) where standardized metrics such as species, height and diameter at breast height of adult trees and seedlings were recorded. Forest structure differed at the three sites, although R1 and R2 were most similar. At R1, Laguncularia racemosa was the important species and R2 was dominated by Pelliciera rhizophorae. Examination of the forest structure and classified imagery indicated that these sites are spatially dynamic and appear to be rejuvenating. The forest structure would indicate that the sites have been growth-limited previously by human activities and possibly by other factors. SJ was dominated by Rhizophora mangle and appears to have a mature forest with large adult trees and few seedlings. It does not appear to have shown the same extent of spatial regrowth as the other two sites between 1986 and 2000 and is relatively static. The establishment of permanent plots and monitoring will be useful as part of the management plan, as the LPA shows a variety of mangrove structures and could be subject to further coastal development.
Kato, H.; Onda, Y.; Komatsu, Y.; Yoda, H.
2012-12-01
Soil, vegetation and other ecological compartments are expected to be highly contaminated by the deposited radionuclides after the Fukushima Daiichi nuclear power plant (NPP) accident triggered by a magnitude 9.1 earthquake and the resulting tsunami on Marchi 11, 2011. Study site have been established in Yamakiya district, Kawamata Town, Fukushima prefecture, located about 35 km from Fukushima power plant, and designated as the evacuated zone. The total deposition of radioactive materials at the study site ranged from 0.02to >10 M Bq/m2 for Cs-137. The mature cedar, young cedar, and broad-leaf stands were selected as experimental site for the monitoring of spatio-temporal variability of the deposited radionuclides after the accidental release of radioactive materials. In order to measure the vertical distribution of radioactivity in forest, a tower with the same height of tree have been established at each experimental site. The measurement of radioactivity by using a portable Ge gamma-ray detector (Detective-DX-100, Ortec) and radionuclide analysis of leaf samples at different height revealed that a large proportion of radionuclides which deposited on forest were trapped by canopies of the cedar forests. In contrast, in the broad-leaf forest highest radioactivity was found at the forest floor. Furthermore, spatio-temporal variability of radioactivity at the forest floor indicated that huge amount of caesium still remains on the canopy of coniferous forest, and subsequently transfers to forest floor in association with throughfall, stemflow, and litter fall.
The Value of Forest Conservation for Water Quality Protection
Directory of Open Access Journals (Sweden)
Melissa M. Kreye
2014-05-01
Full Text Available Forests protect water quality by reducing soil erosion, sedimentation, and pollution; yet there is little information about the economic value of conserving forests for water quality protection in much of the United States. To assess this value, we conducted a meta-analysis of willingness-to-pay (WTP for protecting unimpaired waters, and econometrically determined several significant drivers of WTP: type of conservation instrument (tool, aquatic resource type, geographic context, spatial scale, time, and household income. Using a benefit transfer to two highly forested sites, we illustrate the importance of these factors on WTP for water quality protection programs, forest conservation and policy design.
Dynamics of Coarse Woody Debris Characteristics in the Qinling Mountain Forests in China
Directory of Open Access Journals (Sweden)
Jie Yuan
2017-10-01
Full Text Available Coarse woody debris (CWD is an essential component in defining the structure and function of forest ecosystems. Long-term dynamics of CWD characteristics not only affect the release rates of chemical elements from CWD, but also the species diversity of inhabiting plants, animals, insects, and microorganisms as well as the overall health of ecosystems. However, few quantitative studies have been done on the long-term dynamics of CWD characteristics in forest ecosystems in China. In this study, we conducted nine tree censuses between 1996 and 2016 at the Huoditang Experimental Forest in the Qinling Mountains of China. We quantified forest biomass including CWD and CWD characteristics such as decay states and diameter classes during this period and correlated with stand, site, and climatic variables. The forest biomass was dominated by live tree biomass (88%; followed by CWD mass (6%–10%. Understory biomass contributed only a small portion (1%–4% of the overall biomass. Significant differences in average annual increment of CWD mass were found among forest stands of different species (p < 0.0001. Forest biomass, stand age, forest type, aspect, slope, stand density, annual average temperature, and precipitation were all significantly correlated with CWD mass (p < 0.05, with forest type exhibiting the strongest correlation (r2 = 0.8256. Over time, the annual mass of different CWD characteristics increased linearly from 1996–2016 across all forest types. Our study revealed that forest biomass, including CWD characteristics, varied by forest type. Stand and site characteristics (forest biomass, forest type, aspect, slope and stand density along with temperature and precipitation played a major role in the dynamics of CWD in the studied forest ecosystems.
Preliminary assessment of soil erosion impact during forest restoration process
Lai, Yen-Jen; Chang, Cheng-Sheng; Tsao, Tsung-Ming; Wey, Tsong-Huei; Chiang, Po-Neng; Wang, Ya-Nan
2014-05-01
Taiwan has a fragile geology and steep terrain. The 921 earthquake, Typhoon Toraji, Typhoon Morakot, and the exploitation and use of the woodland by local residents have severely damaged the landscape and posed more severe challenges to the montane ecosystem. A land conservation project has been implemented by the Experimental Forest of National Taiwan University which reclaimed approximately 1,500 hectares of leased woodland from 2008 to 2010, primarily used to grow bamboo, tea trees, betel nut, fruit, and vegetable and about 1,298 hectares have been reforested. The process of forest restoration involves clear cutting, soil preparation and a six-year weeding and tending period which may affect the amount of soil erosion dramatically. This study tried to assess the impact of forest restoration from the perspective of soil erosion through leased-land recovery periods and would like to benefit the practical implementation of reforestation in the future. A new plantation reforested in the early 2013 and a nearby 29-year-old mature forest were chosen as experimental and comparison sites. A self-designed weir was set up in a small watershed of each site for the runoff and sediment yield observation. According to the observed results from May to August 2013, a raining season in Taiwan, the runoff and erosion would not as high as we expected, because the in-situ soil texture of both sites is sandy loam to sandy with high percentage of coarse fragment which increased the infiltration. There were around 200 kg to 250 kg of wet sand/soil yielded in mature forest during the hit of Typhoon Soulik while the rest of the time only suspended material be yielded at both sites. To further investigate the influence of the six-year weeding and tending period, long term observations are needed for a more completed assessment of soil erosion impact.
Assessment of Soil Organic Carbon Stock of Temperate Coniferous Forests in Northern Kashmir
Directory of Open Access Journals (Sweden)
Davood A. Dar
2015-02-01
Full Text Available Soil organic carbon (SOC estimation in temperate forests of the Himalaya is important to estimate their contribution to regional, national and global carbon stocks. Physico chemical properties of soil were quantified to assess soil organic carbon density (SOC and SOC CO2 mitigation density at two soil depths (0-10 and 10-20 cms under temperate forest in the Northern region of Kashmir Himalayas India. The results indicate that conductance, moisture content, organic carbon and organic matter were significantly higher while as pH and bulk density were lower at Gulmarg forest site. SOC % was ranging from 2.31± 0.96 at Gulmarg meadow site to 2.31 ± 0.26 in Gulmarg forest site. SOC stocks in these temperate forests were from 36.39 ±15.40 to 50.09 ± 15.51 Mg C ha-1. The present study reveals that natural vegetation is the main contributor of soil quality as it maintained the soil organic carbon stock. In addition, organic matter is an important indicator of soil quality and environmental parameters such as soil moisture and soil biological activity change soil carbon sequestration potential in temperate forest ecosystems.DOI: http://dx.doi.org/10.3126/ije.v4i1.12186International Journal of Environment Volume-4, Issue-1, Dec-Feb 2014/15; page: 161-178